Issuu on Google+

Prakiraan Cuaca Jumat (21/8) Medan 24-320C

Berastagi 16-27 0 C

R. Prapat 24-330C

Parapat 17-28 0C

P. Siantar 19-29 C

Sibolga 21-31 0 C

0

Hujan guntur

Berawan

BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

JUMAT, Legi, 21 Agustus 2009/30 Sa’ban 1430 H

No: 22888 Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman

Harga Eceran: Rp 2.500,-

Petrus Dan Munir Jangan Terulang Antara

BREVET KOMANDO KEHORMATAN. Presiden Susilo Bambang Yudhoyono (kanan) menerima penganugerahan Brevet Komando Kehormatan yang disematkan oleh Kasad Jenderal TNI Agustadi Sasongko Purnomo di Markas Satuan81 Kopassus, Cijantung, Jakarta Timur, Kamis (20/8). Berita baca halaman 2.

SBY Siapkan Program Seratus Hari Pemerintahan Baru JAKARTA (Antara): Susilo Bambang Yudhoyono (SBY) sebagai calon presiden terpilih periode 2009-2014 akan menyiapkan rencana aksi pemerintah untuk lima tahun ke depan, termasuk di dalamnya program kerja 100 hari pertama. Dalam pidato penerimaan atas hasil Komisi Pemilihan Umum (KPU) yang menetapkan dirinya sebagai presiden terpilih dari proses Pemilu 2009, Yudhoyono di Arena Pekan Raya Jakarta (PRJ), Kemayoran, Jakarta, Kamis(20/8) malam,

Lanjut ke hal 2 kol. 1

BACA DI HALAMAN DALAM Mendagri Instruksikan Pembuatan KTP Diperketat Menteri Dalam Negeri (Mendagri) Mardiyanto menginstruksikan kepada jajarannya di daerah agar memperketat pembuatan Kartu Tanda Penduduk (KTP) sebagai langkah antisipasi penyusupan para pelaku terorisme. 5

Menkeu Di DPR: Ekonomi RI Hadapi 10 Tantangan Meskipun fase krisis ekonomi global sudah mulai terlewati, namun pemerintah memperkirakan perekonomian Indonesia di 2010 masih diliputi oleh ketidakpastian. 27

Listrik Tidak Boleh Padam Selama Ramadhan Gubsu Syamsul Arifin mengingatkan kembali PT PLN agar memenuhi janjinya tidak melakukan pemadaman listrik pada bulan suci Ramadhan. 9

Umat Islam Diminta Makmurkan Masjid Dewan Masjid Indonesia (DMI) Sumut mengimbau masyarakat memakmurkan masjid dan mushalla bersamaan datangnya bulan suci Ramadhan. 10

Warkop Harapan Dibongkar PJ Walikota Medan Rahudman Harahap memimpin pembongkaran warung kopi (warkop) di belakang kampus Yayasan Pendidikan Harapan Medan yakni Jl. Samanhudi dan Jl. Misbah. 11

Pemilih Afghanistan Takut Dengan Ancaman Taliban Ancaman Taliban nampaknya ‘menciutkan nyali’ pemilih di kawasan yang dikuasai militan ketika masyarakat Afghanistan memilih presiden baru. 3

Polres Asahan Amankan Perampok Antar Provinsi Bersenpi Anggota sindikat perampok bersenjata api (senpi) antar provinsi diamankan Polres Asahan di tempat dan waktu yang berbeda. Dua pucuk senjata api jenis FN organik diamankan. 17

Albayan Puasa Oleh H Syarifuddin Elhayat

Mimbar Jumat-13

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengatakan operasi khusus seperti penembakan misterius (petrus) tidak boleh digunakan lagi untuk menangani gangguan dan ancaman keamanan dalam negeri, juga tidak boleh terjadi penyimpangan seperti kasus Munir. Dalam pengarahannya di Gedung Balai Komando, Markas Kopassus TNI-AD, Cijantung, Jakarta, Kamis (20/8), Presiden mengatakan para prajurit harus menjaga akuntabilitas setinggi-tingginya sesuai dengan ketentuan UU dan UUD 1945. “Kita punya pengalaman, katakanlah, pengalaman buruk dalam kasus penembak misterius, penculikan, termasuk kasus Munir, yang tidak sesuai undang-undang dan UUD 1945,” katanya. Para prajurit Komando Pasukan Khusus (Kopassus) harus menjaga akuntabilitas setinggi-tingginya dalam menjaga dan melindungi keamanan dalam negeri Indonesia sesuai undang-undang agar tidak terjadi penyimpangan seperti kasus Munir. Semua pihak, khususnya TNI dan Polri harus dapat menjalankan tugas pokok dan fungsinya secara tepat dan benar sesuai UU dan UUD 1945. “Sebagai kepala negara saya ingatkan agar dalam menjalankan tugas pokok masing-masing tetap dilakukan secara transparan dan akuntabel.

Lanjut ke hal 2 kol. 1

Antara

ISLAMIC CENTRE LHOKSEUMAWE: Sebuah perahu nelayan melintas tidak jauh dari gedung Islamic Centre milik pemkab Aceh Utara yang dibangun senilai Rp110 miliar lebih, Kamis (20/8). Bangunan termegah milik pemerintah Kabupaten Aceh Utara telah diserahkan kepada pemerintah kota Lhokseumawe belum lama ini.

Besok Puasa JAKARTA (Antara): Pemerintah melalui sidang itsbat (penetapan awal bulan Ramadhan-Red), yang dipimpin Menteri Agama Muhammad Maftuh Basyuni menetapkan awal Ramadhan 1430 H jatuh pada Sabtu, 22 Agustus 2009. Dalam kesempatan itu Menag juga menetapkan Badan Hisab dan Rukyat sebagai lembaga tetap penyelenggara hisab dan rukyat. “Badan ini telah kita tetapkan sebagai lembaga tetap sejak 14 Juli 2009,” kata Menag pada sidang itsbat di kantor Departemen Agama, Jakarta, Kamis (20/8)malam. Sidang tersebut dihadiri Menteri Komunikasi dan Informatika M. Nuh, Ketua Majelis Ulama Indonesia Prof Dr Umar Shihab, Wakil Ketua Komisi VIII DPR Said Abdullah, pimpinan ormas-ormas Islam, para duta besar dan perwakilan negara sahabat, serta anggota Badan Hisab dan Rukyat Depag. Menag mengatakan, pihaknya menyetujui Badan Hisab dan Rukyat untuk melakukan sidang hisab maupun rukyat dilakukan setiap bulan sebagaimana usulan Nahdlatul Ulama dan Muhammadiyah. “Saya setuju sidang dilakukan

setiap bulan kalau perlu mengundang pihak yang berbeda,” ujarnya. Ia juga mengatakan, pada tahun ini pemantauan juga dilakukan di sembilan titik di seluruh Indonesia dengan menggunakan teropong canggih. Sembilan titik pemantauan tersebut terletak di Pantai Longa Aceh, Bosca Bandung, Pelabuhan ratu, Sukabumi, Gresik, Lamongan Jatim, Semarang, Kupang, Ternate, Makassar. Lanjut ke hal 2 kol. 1

Dr Azahari Janjikan Rp2 M Bagi Pelaku Jihad DEPOK (Waspada): Dr Azahari memberikan iming-iming menggiurkan pada calon pengikutnya. Calon pengikut yang bersedia berjihad akan diberikan uang Rp 2 miliar. Bila si pengikut tewas, keluarga akan mendapat Rp 10 juta per bulan. Iming-iming Dr Azahari terungkap dari pengakuan Tjitra Rahardja, 23, warga Depok yang diperiksa polisi

KUALA LUMPUR (Antara): Malaysia akhirnya menyetujui paspor TKI (tenaga kerja Indonesia) dipegang oleh pemiliknya, dan bukan dipegang oleh majikan atau agensi pekerja asing, sebagai salah satu hasil perundingan bilateral di Putrajaya. “Itu adalah salah satu kesepakatan pertemuan Pokja Indonesia-Malaysia ke-3 yang berlangsung di kementerian dalam negeri Malaysia di Putrajaya hari ini,” kata Dirjen Hukum dan Perjanjian Internasional Deplu RI Arif Havas Oegroseno, di KBRI Kuala Lumpur, Kamis (20/8).

Pertemuan Pokja (kelompok kerja) atau working group itu dihadiri juga oleh Dirjen Pembinaan dan PenempatanTenaga Kerja Luar Negeri Depnakertrans I Gusti Gede Arke, wakil Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI), dan Badan Reserse Kriminal (Bareskrim) Mabes Polri. Pertemuan itu membicarakan revisi nota kesepahaman (MoU) tahun 2006. Selama belum ada kesepakatan mengenai MoU yang baru, Indonesia tidak akan mencabut kebijakan

Lanjut ke hal 2 kol. 6

Ulama Perlu Dialog Bersama Bahas Persoalan Umat Islam Di Sumut

Mimbar Jumat-14

Waspada/Surya Efendi

“Hai orang-orang yang beriman, kamu diwajibkan berpuasa sebagaimana halnya orang-orang sebelum kamu supaya kamu menjadi orang-orang yang bertakwa.” (Q.S. al-Baqarah ayat 183)

Lanjut ke hal 2 kol. 6

H. Maslin Batubara Luncurkan Buku 100 Poda Kearifan

Oleh K.H. Amiruddin, MS

Imsak: 04:54 Subuh: 05:04

mengirim pembantu rumah tangga (PRT) ke Malaysia yang dilakukan sejak 26 Juni 2009. Pertemuan sehari itu juga menghasilkan kesepakatan mengenai gaji. Kedua negara sepakat adanya skala gaji dan gaji awal sehingga memungkinkan adanya kenaikan berkala gaji TKI atau PRT (pembantu rumah tangga) Indonesia. Kesepakatan lainnya ialah pembantu Indonesia diberikan libur satu hari per minggu dan dibentuknya

Pertemuan Tjitra dengan teroris yang ahli merakit bom itu terjadi pada tahun 2002 sebelum bom Bali. Saat itu, Tjitra diajak temannya ke rumah ustad Kholik di Serang, Banten. “Saya diajak sama teman. Di situ ada sekitar 14 orang, termasuk saya bertemu dengan Dr Azahari,” kata Tjitra di Jl Giring-giring II, Sukmajaya, Depok, Jawa Barat, Kamis (20/8). Pada pertemuan itu, menurut Tjitra, Dr Azahari sempet mengatakan, siapa saja yang mau masuk ajarannya untuk berjihad, akan diberi uang Rp 1 miliar. “Apabila nanti meninggal dunia karena berjihad, setiap bulan keluarganya akan diberi uang sekitar Rp 10 juta,” janji Azahari seperti ditirukan Tjitra. Dari 14 orang itu, akhirnya cuma satu orang yang masuk ajaran Azahari. Pria itu adalah Asmar Latinsani yang melakukan aksi bom bunuh diri dengan menggunakan mobil Toyota Kijang di depan Hotel JW Marriott pada 5 Agustus 2003. Tjitra yakin pria yang ditemuinya Dr Azahari dari kartu anggota yang

Malaysia Setujui Paspor Dipegang TKI

Marhaban Ya Ramadhan

Jadwal imsakiyah untuk wilayah Medan sekitarnya

terkait dengan buron tersangka kasus bom JW Marriott dan Ritz-Carton, Syaifudin Zuhri . Tjitra mengaku bertemu dengan Syaifudin Zuhri. Tidak hanya itu, Tjitra juga mengaku pernah bertemu dengan Dr Azahari, gembong teroris yang tewas dengan bom bunuh diri saat digerebek Densus 88 di Batu, Jawa Timur, pada 2005 lalu .

PELUNCURAN BUKU: Penulis buku 100 Poda Kearifan, DR H Maslin Batubara menyerahkan buku kepada Gubsu diwakili Asisten IV yang juga Pj Walikota Medan Rahudman Harahap di Hotel Garuda Plaza Medan, Kamis (20/8) malam. Peluncuran buku itu ditandai penyambutan bulan suci Ramadhan 1430 H bersama ulama dan cendikiawan Sumatera Utara.

MEDAN (Waspada): Para ulama, tokoh agama dan cendikiawan di Sumut dinilai perlu duduk bersama membahas masalah yang sedang dihadapi umat Islam di Sumut saat ini. “Kita perlu mendialogkan apa saja yang bisa dilakukan untuk membangun yang lebih baik bagi umat Islam di Sumut,” kata Rektor Univa, Prof. Dr. Syahrin Harahap, MA, saat memberikan sambutan dalam penluncuran buku 100 Poda Kearifan oleh Cendikiawan Sumut, H. Maslin Batubara di Hotel Garuda Plaza Medan, Kamis (20/8) malam. Turut hadir dalam acara peluncuran buku tersebut Tuan Guru Babussalam Langkat, Walikota Medan Rahudman Harahap, Ketua MUI

100 Wanita Paling Kuat Di Dunia DAFTAR Wanita Paling Kuat Forbes bukan tentang selebriti atau popularitas, ini hanya tentang pengaruh. Berdasarkan daftar yang dibuat majalah Forbes, wanita paling kuat dan paling berpengaruh Indonesia adalah Sri Mulyani Indrawati — Menteri Koordinator Perekonomian dan Menteri Keuangan RI. Dia merupakan satu-satunya wanita Indonesia yang masuk dalam daftar 100 wanita paling kuat versi Forbes. Dalam daftar itu Sri Mulyani menduduki urutan ke-71. Ratu Rania dari Jordania me-

Michelle Obama Sri Mulyani rupakan wanita yang paling banyak pedulinya tentang wanita Timur Tengah. Dia (yang menduduki urutan ke-75 daftar Wanita Paling Kuat Forbes) adalah seorang wanita terlalu

banyak mendengar tentang keluh kesah kaum wanita Arab dan Timur Tengah. Untuk menghimpun daftar tersebut, Forbes memperhatikan kaum wanita yang menjalankan pemerintahan, perusahaan besar atau pengaruhnya di berbagai lembaga nonprofit. Ranking mereka didasarkan pada satu kombinasi dari dua catatan: pandangan dan penjelasan dari pers dan berdasarkan besarnya organisasi atau negara yang dipimpin para wanita tersebut.

Lanjut ke hal 2 kol. 1

Sumut Prof. Dr. H Abdullah Syah, MA, Ketua MUI Medan Prof. HM. Hatta, Rektor IAIN Sumut Prof. Nur Ahmad Fadhil, Kakandepag Sumut Syariful Mahya, Kapendam I/BB H, Asren Nasution, Kadis Infokom Pemprovsu Drs. Eddy Syofian, MAP, mantan Walikota Medan Bachtiar Jafar, serta Pemimpin Redaksi Waspada H. Prabudi Said, serta sejumlah cendikiawan, tokoh agama dan pimpinan ormas Islam Sumut. Syahrin mengatakan banyak masalah yang sedang dihadapi dalam perkembangan agama Islam di Sumut saat ini. Seperti persoalan semakin ditinggalkannya Parpol-parpol Islam oleh umat. Serta persoalan Islam yang diidentikkan dengan terorisme. Kemudian juga persoalan semakin menjauhnya umat Islam dengan para ulama. Sehingga ucapan para ulama saat ini sudah tidak lagi didengarkan oleh umat. “Ulama bilang ke arah A, umat malah bergerak ke arah B,” kata Guru Besar IAIN Sumut itu. Lanjut ke hal 2 kol. 3

erampang Seramp ang

Ratu Elizabeth II

- Terima Rp2 M bisa diperiksa KPK? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Berawan dan peluang hujan lokal Angin : Barat Daya - Barat Laut Kec. antara 10 s/d 30 Km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 330C - 250C BMKG Polonia

EDISI ACEH

JUMAT, Legi, 21 Agustus 2009 /30 Sya’ban 1430 H � No: 22888/A Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman � Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Jangan Gunakan ‘Petrus’

Internet

Bagus Budi Pranoto alias Urwah. Pria kelahiran Kudus, 2 November 1978 bersuku Jawa. Urwah memiliki ciri fisik tinggi badan lebih dari 160 cm, bentuk kepala lonjong, warna mata hitam, bentuk alis tebal bentuk bibir tebal. Ciri-ciri khusus pria tersebut, memiliki tahi lalat di bawah bibir sebelah kiri dan memiliki noktah pada pelipis sebelah kiri.

Sosok Bagus, Buronan Teroris Itu KUDUS (Waspada): Bagus Budi Pranoto alias Urwah yang menjadi buronan polisi tidak lagi tercatat sebagai warga Desa Mijen, Kecamatan Kaliwungu, Kabupaten Kudus. Bagus diduga terlibat dalam kasus peledakan bom di Hotel JW Marriott dan Ritz-Carlton. “Berdasarkan hasil catatan sipil dari Kantor Catatan Sipil dan Kependudukan Kabupaten Kudus, warga kami yang bernama Bagus Budi Pranoto tidak lagi terdaftar sebagai warga Mijen,” kata Kepala Desa Mijen, Kecamatan Kaliwungu, Kabupaten Kudus, Sujono, Kamis (20/8). Kalau didasarkan pada catatan kartu keluarga (KK) yang dikeluarkan tahun 2006, katanya, Bagus masih tercatat sebagai anggota keluarga Isman bersama tiga adiknya yang lain. “Sedangkan berdasarkan catatan terakhir anggota keluarga Isman yang masih terdaftar dalam catatan sipil sementara, hanya Isman dan istri serta anak keduanya,” ujarnya. Untuk itu, kata dia, nama Bagus dalam KK keluarga Isman yang dikeluarkan pada 2006 diberi keterangan pindah karena menikah dengan warga Solo. “Demikian pula anak Isman yang lain, seperti Faris, diberi keterangan meninggal, sedangkan Wati pindah alamat karena menikah,” ujarnya. Hanya saja, kata Sujono, pihak desa hingga kini belum Lanjut ke hal 2 kol. 3

Pria Mengaku Noordin Diperiksa Densus 88 SAMARINDA (Antara): Roni Pranata, 18, pria yang ditangkap anggota Polsekta Sungai Kunjang, Samarinda, Rabu (19/8), karena mengaku sebagai teroris Noordin M Top, masih menjalani pemeriksaan intensif oleh Detasemen Khusus (Densus) 88 Polda Kaltim. “Kasus ini telah kami serahkan ke Densus 88,” ungkap Kapolsekta Sungai Kunjang, Ajun Komisaris Erlan Munaji kepada Antara di Samarinda, Kamis (20/8). Hingga Kamis sore, dua anggota Densus 88 terlihat masih terus melakukan pemeriksaan terhadap pemuda tanggung yang merupakan warga di Jl KH Harun Nafsi, Samarinda Seberang itu. Roni terlihat lesu saat menjalani pemeriksaan di salah satu ruang Mapolsekta Sungai Kunjang sejak pagi hingga sore. “Dia (Roni) mengaku sangat menyesali perbuatannya melakukan tindakan yang sangat meresahkan warga, khususnya kepada teman dekatnya yang ia kirimi pesan singkat,” ungkap seorang anggota Polsekta Sungai Kunjang. Terungkapnya kasus itu bermula dari laporan Septy Wiyana, 17, warga Jl Flamboyan, Sungai Kunjang ke Polsekta Sungai Kunjang, Rabu (19/8) sore. Wanita yang menjadi teman dekat Roni Pranata itu Lanjut ke hal 2 kol. 3

Baca Halaman Dalam Selama Ramadhan Murid Belajar Enam Kali Pasca Ramadhan 1430 H/2009, pelajar di Aceh Utara harus mampu berwudhuk dan shalat yang benar, kata Kadisdik, M. Jamil, M.Kes, Kamis (20/ 8). “Tiga kali pertemuan pada Minggu kedua dan tiga kali pada Minggu ketiga, sedang Minggu pertama dan keempat tetap libur total,” tandasnya.

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengatakan operasi khusus seperti penembakan misterius (petrus) tidak boleh digunakan lagi untuk menangani gangguan dan ancaman keamanan dalam negeri, juga tidak boleh terjadi penyimpangan seperti kasus Munir. Dalam pengarahannya di Gedung Balai Komando, Markas Kopassus TNI-AD, Cijantung, Jakarta, Kamis, Presiden mengatakan para prajurit harus menjaga akuntabilitas setinggitingginya sesuai dengan ketentuan UU dan UUD 1945. “Kita punya pengalaman, katakanlah, pengalaman buruk dalam kasus penembak misterius, penculikan, termasuk kasus Munir, yang tidak sesuai undang-undang dan UUD 1945,” katanya. Para prajurit Komando Pasukan Khusus (Kopassus) harus menjaga akuntabilitas setinggi-tingginya dalam menjaga dan melindungi keamanan dalam negeri Indonesia sesuai undang-undang agar tidak terjadi penyimpangan seperti kasus Munir. Semua pihak, khususnya TNI dan Polri harus dapat menjalankan tugas pokok dan fungsinya secara tepat dan benar sesuai UU dan UUD 1945. “Sebagai kepala negara saya ingatkan agar dalam menjalankan tugas pokok masing-masing tetap dilakukan secara transparan dan akuntabel. Janganlah dalam melakukan tugas negara, kita melawan UU dan UUD 1945,” kata Yudhoyono menegaskan. Presiden mengatakan, negara Lanjut ke hal 2 kol. 3

Antara

ISLAMIC CENTRE. Sebuah perahu nelayan melintas tidak jauh dari gedung Islamic Centre milik pemkab Aceh Utara yang dibangun senilai Rp.110 miliyar lebih, Kamis (20/8). Bangunan termegah milik pemerintah Kabupaten Aceh Utara telah di serahkan kepada pemerintah kota Lhokseumawe belum lama ini.

Sidang Demo Anarki Protap

Dosen Dan Mahasiswa Dihukum 11 Tahun MEDAN ( Waspada): Poltak Panjaitan sebagai dosen Universitas Negeri Medan dihukum 3 tahun 6 bulan penjara dalam persidangan di Pengadilan Negeri Medan, Kamis (20/ 8), karena terlibat demo anarki menuntut ProvinsiTapanuli (Protap) yang

menewaskan Ketua DPRDSU Abdul Azis Angkat. Pada persidangan terpisah, dua mahasiswa, Ricard Ricardo dan Roya Frans Sagala dijatuhi hukuman 4 tahun dan 3 tahun 6 bulan penjara oleh majelis hakim yang menangani

Kasda Kosong, Kaum Duafa Terkatung-katung BIREUEN (Wasapada): Puluhan kaum duafa dari berbagai kecamatan di Kabupaten Bireuen terkatungkatung di Setdakab Bireuen. Padahal bantuan untuk duafa telah dianggarkan dalam APBD TA-2009. Rupanya kas daerah (Kasda) kosong. Halimah, 59, warga Leubu Kecamatan Makmur, Kamis (20/8) mengaku sudah tiga hari menunggu pencairan uang bantuan duafa Rp300 ribu perorang di bagian Sosial Setda Bireuen. “Kami sudah tiga hari bolakbalik ke Bireuen mendapatkan bantuan itu, namun kami selalu diminta sabar menunggu karena Kasda Bireuen sedang kosong,” ujarnya. Dia mengharapkan uang itu segera dicairkan, sehingga bisa digunakan

untuk membeli setumpuk daging meugang dan segala kebutuhan puasa. Dalam APBD Bireuen tahun 2009 te-lah dianggarkan dana bantuan kaum duafa Rp450 juta. Untuk tahap pertama telah disalurkan Rp150 juta Juni lalu. Dana bantuan duafa ini, diberikan kepada setiap kaum duafa yang telah mengajukan permohonan yang disetujui kepala desa dan camat. Setiap desa dibatasi maksimal lima orang. Kabag Sosial Setda Bireuen, Drs. Munir yang dikonfirmasi membenarkan belum menyalurkan dana bantuan duafa tahap kedua dan ketiga karena Kasda sedang kosong. Pantauan Waspada, bagian sosial ditutup, terlihat pegawainyamenghindaridarikaumduafa yang menunggu di teras Setda.(b03)

perkara keduanya. Vonis majelis hakim kepada ketiga terpidana lebih ringan dari tuntutan para Jaksa Penuntut Umum (JPU), di mana persidangan sebelumnya meminta agar mereka dihukum 7 tahun penjara. Ketiganya dinyatakan terbukti bersalah secara sah dan menyakinkan sebagaimana diatur dan diancam pasal 146 yo 55 ayat 1 ke 1 KHUPidana, dalam hal pembubaran sidang paripurna dewan yang sah. “Berdasarkan fakta dan keterangan saksi di persidangan, Poltak Panjaitan, terbukti ikut dalam aksi demo anarki bersama ribuan massa pendukung Protap di gedung DPRDSU pada 3 Februari 2009,” kata majelis hakim diketuai Kusnoto. Namun, lanjutnya, peran serta terpidana dalam aksi demo itu hanya sebatas ikut meramaikan unjukrasa. “Terpidana tidak terlibat langsung dalam aksi pengrusakan dan penyerangan hingga menewaskan ketua DRPRD itu, “ tegasnya. Pertimbangan lain, majelis hakim menjatuhkan vonis 3 tahun 6 bulan penjara kepada terpidana karena dia hanya sebagai simpatisan dan sudah meminta maaf secara langsung Lanjut ke hal 2 kol. 3

Warna-warni Realitas Sosial Di Aceh Tambo Shaho Oleh Drs H Ameer Hamzah Tambo si go tunjak pertanda waktu ibadat Tambo dua go tunjak musyawarah atau rapat Tambo lhee go tunjak tanda woe lam jrat. Tambo shawo beudoh beuleugat…….. Beduk dalam bahasa Aceh disebut tambo. Tambo dibuat dari kayu besar yang berlubang. Panjang kira-kira vsatu meter atau lebih, luas bundarannya kira-kira 60 atau 70 cm. Sangat tergantung besar kecilnya pohon kayu didapatkan. Tambo di Aceh hanya diberi penutup dengan kulit lembu satu sisi saja, satu sisi lagi tetap berlobang supaya suaranya besar. Suara tambo itu dapat menjangkau sampai sepuluh kilometer. Lanjut ke hal 2 kol. 1

warna abu-abu dipadu dengan celana warna hitam. “Di lantai bawah masih banyak tamu yang menunggu dan ingin bertemu dengan Bapak,” kata Rauf—tak lain adalah ajudan sang Wagub. “Baik, saya segera turun menemui mereka,” jawab Muhammad Nazar sambil mengayunkan langkah menuju ke luar ruangan diiringi ajudan dan sejumlah pengawal dan beberapa orang wartawan. Dari ruang kerjanya yang terletak di Lantai II Kantor Gubernur Aceh, Muhammad Nazar langsung turun ke Lantai I bangunan megah itu melalui tangga yang terdapat di sisi kiri ruang kerjanya. Di teras belakang sekitar seratusan kaluarga miskin dan kaum dhuafa telah menunggu sang pimpinan datang. Tidak hanya kaum ibu yang menggendong anaknya, ada juga kaum ayah dan beberapa tuna netra. Sejenak Wagub Muhammad Nazar tertegun melihat mereka. Tanpa basa-basi,Wagub Muhammad Nazar langsung menanyakan asal kampung halaman meWaspada/Jaka Rasyid reka dan tujuan mereka datang Kantor Gubernur Pemerintah Aceh, sejak Rabu (19/8) malam disesaki warga ke Banda Aceh. dari berbagai daerah untuk mengambil uang meugang dari Pemerintah Aceh, Mendegar pertanyaan itu, setiap warga pemilik KTP Aceh diberikan Rp100.000,- uang meugang. Banyaknya seorang laki-laki paruh baya wargayangmengantrimembuatpintukacautamakantorgubernurpecahkarena Lanjut ke hal 2 kol. 1 berdesakan. Foto direkam Kamis (20/8) siang.

WAKTU menunjukkan pukul 17.15 WIB ketika Wakil Gubernur Aceh Muhammad Nazar, bersiap-siap hendak meninggalkan ruang kerjanya, pulang ke rumah dinas di kawasan Lapangan Blang Padang, Kota Banda Aceh. Sesaat kemudian, terdengar suara pintu kamar kerja sang wagub diketuk dari luar. Seorang pria tambun bernama Rauf masuk dan langsung menyapa Wakil Gubernur Aceh yang hari itu mengenakan kemeja lengan panjang

199.354 Calhaj Lunasi BPIH NAD 3.383 Orang JAKARTA (Waspada): Hari ke 24 pelunasan BPIH, Rabu (19/8) calhaj yang telah melunasi BPIH berjumlah 199.354 orang, terdiri dari jemaah regular 184.191 orang dan BPIH Khusus 15.163 orang. Hal itu diungkapkan Direktur Pelayanan Haji Zakaria Anshar di Jakarta, Kamis (20/8). Menurut Zakaria, calhaj propinsi Jawa Barat yang terbanyak melunasi

BPIH, 36.046 orang, disusul Jawa Timur 33.127 orang, Jawa Tengah 28.784 orang, Banten 8.212 orang, Sumut 7.793 orang, Sulsel 6.699 orang, DKI Jakarta 6.796 orang, dan Sumsel 6.156 orang. Lampung 5.920 orang, Riau 4.840 orang, NTB 4.364 orang, Sumbar 4.246 Lanjut ke hal 2 kol. 3

Waspada/Iskandar

Wakil Gubernur Aceh Muhammad Nazar, Kamis (20/8), meninjau aktivitas sejumlah pasar di Kota Banda Aceh dan Kabupaten Aceh Besar dan persediaan bahan makanan sebelum bulan puasa. Pada kesempatan itu, Wagub Muhammad Nazar juga sempat meninjau penjualan daging pada hari pertama meugang di pasar musiman Peunayong.

Meugang Pertama, Harga Daging Rp110 ribu-Rp130/Kg Harga Gula Dan Migor Naik BANDA ACEH (Waspada): Hari pertama ‘meugang’ puasa tahun ini, harga daging sapi di Kota Banda Aceh dan sekitarnya antara Rp80.000 sampai Rp100.000 per kilogram. Sementara harga gula dan minyak goreng bergerak naik sejak sehari sebelum hari meugang. Bahkan di beberapa pasar musiman yang khusus menjual daging meugang, harga daging sapi lokal senilai Rp110.000 per kilogram. Sedangkan harga daging sapi luar Aceh, seperti Sapi Medan Rp85. 000 per kilogram, Sapi Lampung dan Sapi Bali Rp95.000 per kilogram. Begitupun, harga beras dan bahan kebutuhan pokok lainnya stabil, baik di Pasar Peunayong maupun di Pasar Lambaro, Aceh Besar. Bahkan, persediaan sejumlah bahan kebutuhan pokok di kedua pasar itu seperti beras mampu bertahan hingga lima bulan mendatang. “Masyarakat tidak perlu khawatir dengan persediaan bahan makanan pokok, persediaan kita cukup kuat sampai akhir lebaran nanti. Persediaan beras bahkan cukup untuk lima bulan ke depan,” kataWakil Gubernur Aceh Muhammad Nazar menjawab

Waspada usai meninjau sejumlah pasar di Kota Banda Aceh dan Kabupaten Aceh Besar, Kamis (20/8). Menyinggung adanya kenaikan harga gula pasir dan minyak goreng sejak dua hari terakhir, Wakil Gubernur yang sempat berdialog dengan pedagang kelontong di Pasar Peunayong mengatakan, hal itu disebabkan naiknya harga beli dari Medan oleh pedagang. Pantauan Waspada, harga gula pasir yang sebelumnya Rp8.500Rp9.000 per kilogram, naik menjadi Rp10.000 per kilogram. Sedangkan Lanjut ke hal 2 kol. 1

erampang Seramp ang - Mohon maaf yang kena serampang - He... he... he...

2

Berita Utama

WASPADA Jumat 21 Agustus 2009

Perampokan SPBU Lamteumen, Diduga Orang Dalam Terlibat

Sadarkan Teroris Melalui Komunikasi Yang Baik DEPOK (Waspada): Mantan Kepala Densus 88, Brigjen (purn) Suryadharma Salim menilai, komunikasi dan pendekatan yang baik terhadap para teroris cara yang efektif untuk menyadarkan mereka ketimbang membuat berbagai macam tulisan di buku maupun media. “Tulisan apapun yang dibuat belum tentu akan berpengaruh kepada mereka. Bara api teroris bukan dipadamkan dengan keliling Indonesia. Berkomunikasilah sebanyak mungkin dengan mereka,” ujarnya kepada wartawan seusai peluncuran buku Deradikalisasi Terorisme di Gedung FISIP Universitas Indonesia, Depok, Kamis (20/8). Menurut Suryadharma, tidaklah mudah untuk menyadarkan para teroris karena keyakinan terhadap ideologi seakan telah tertanam dalam dirinya. Dalil-dalil dan perkataan tidak akan berpengaruh terhadap mereka. Hidup bersama para pelaku teror, menurutnya, merupakan salah satu cara yang dapat dilakukan untuk menyadarkan mereka. Hal tersebut dapat dilakukan oleh aparat kepolisian terhadap para tahanan pelaku teroris. Aparat, menurutnya dapat menyadarkan mereka sewaktu dalam tahanan dengan cara menjadikan para teroris itu sebagai sahabat. “Banyak orang menilai mereka para teroris akan sadar melalui buku tapi tidak ada manfaat buku terhadap mereka. Mereka tidak akan percaya kepada siapapun. Karenanya siapapun yang kami tahan jadikan sahabat mu,” katanya.(kps)

Meugang Pertama, Harga ... minyak goreng, dari Rp8.000-Rp8.500 naik menjadi Rp9.000Rp9.500 per kilogram. Selain ke Pasar Peunayong, Wakil Gubernur Aceh Muhammah Nazar didampingi sejumlah pimpinan instansi terkait, juga berkunjung ke Pasar Hewan Ulee Kareng dan Pasar Lambaro. Capai Rp130.000/Kg Sementara harga pasaran daging meugang di Aceh Timur, Provinsi Aceh, Jumat (21/8) hari ini diperkirakan senilai Rp130.000 per kilogram (Kg). Memuncaknya harga daging itu diperkirakan akibat banyaknya permintaan konsumen. Bahkan hari ini (kemarin— red) harga daging senilai Rp120.000/Kg. “Kita memperkirakan harga daging senilai Rp120.000 per kilogram. Meski tak jauh berbeda, namun jika permintaannya lebih banyak sebagaimana tahun lalu, maka harga daging bisa-bisa harga daging senilai Rp130.000 – Rp150.000 per kilogram,” ungkap Mukhtar, penjual daging meugang di Kota Idi Rayeuk. Kepada Waspada, Kamis (20/8) dia mengatakan, taksiran jumlah lembu meugang yang akan dipotong hari ini, khususnya di Kecamatan Idi Rayeuk mencapai 200 ekor. Lembu itu dipasok dari berbagai pelosok dalam berbagai wilayah Ibukota Kabupaten Aceh Timur. Hal yang sama juga dikabarkan di beberapa kecamatan lainnya, seperti di Kecamatan Darul Aman dan Peureulak serta sejumlah kecamatan wilayah barat Aceh Timur. Lembu yang dipotong rata-rata 50 ekor per kecamatan. “Ya meugang besok kita duga meningkat harga daging, karena hari ini saja (kemarin—red) yang motong satu dua harga daging senilai Rp120.000/Kg,” kata Ilyas, warga Bagok—Nurussalam. (b09/cmad)

199.354 Calhaj Lunasi ... orang, Kalsel 3.381 orang, NAD 3.383 orang, Yogya 2.983 orang, Kaltim 2.667 orang, Kalbar 2.288 orang, Jambi 2.502 orang, Sulteng 1.691 orang, Bengkulu 1.570 orang, Sultra 1.625 orang, Sulbar 1.391 orang, Kalteng 1.270 orang, Kepri 968 orang, Babel 901 orang, Maluku Utara 966 orang, Gorontalo 850 orang, Sulut 605 orang, Maluku 580 orang, Papua 502 orang, NTT 407 orang Papua Barat 283 orang, dan Bali 202 orang. Hari ke dua puluh tiga pelunasan BPIH, Rabu ini, kata Zakaria, nilai tukar US dollar ke rupiah, senilai Rp10.030. Perpanjangan pelunasan BPIH berlangsung dari tanggal 18 sampai 28 Agustus 2009. Bagi jamaah calon haji yang telah melunasi BPIH, selanjutnya mendaftarkan diri di Kantor Dep.Agama kabupaten/kota tempat jamaah berdomisili, paling lambat 1 minggu setelah pelunasan BPIH. (kps)

Pria Mengaku Noordin ... mengaku menerima sebuah pesan singkat (SMS) dari seseorang yang mengaku sebagai buronan teroris yang paling dicari polisi, Noordin Moh Top. Dalam SMS itu, orang yang mengaku Noordin itu mengajak Septy Wiyana menjadi “pengantin” (pelaku bom bunuh diri) untuk meledakan Samarinda Central Plaza (SCP). Septy Wiyana kemudian melaporkannya ke Pos Polisi Loa Buah yang selanjutnya meneruskan laporan itu ke Polsekta Sungai Kunjang. “Pelaku (Roni) mengaku hanya iseng mengirimkan SMS itu kepada Septy Wiyana. Dia mengaku, telah menaruh hati kepada wanita itu sejak duduk di bangku SMU, namun sampai sekarang belum mendapat jawaban,” ungkap seorang anggota penyidik Polsekta Sungai Kunjang. Kepada polisi, Roni Pranata mengaku tidak menduga jika perbuatannya tersebut berakibat fatal. “Pelaku ditangkap setelah sempat dipancing untuk menemui Septy Wiyana. Dia diminta datang ke Pos Polisi Loa Buah dan ternyata selang beberapa menit kemudian Roni Pranata langsung kami tangkap,” ujar polisi tersebut.

Jangan Gunakan ... tidak akan ragu-ragu menegakkan supremasi hukum dalam penanganan terorisme, kelompok separatis dan pemberontakan bersenjata. “Namun, semua harus dijalankan secara konstitusional, transparan dan akuntabel,” ujarnya. Sebelumnya, Presiden Yudhoyono diresmikan sebagai warga kehormatan Komando Pasukan Khusus TNI-AD ditandai dengan penyematan Brevet Kehormatan Kopassus oleh Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo. Dalam acara itu hadir sejumlah menteri kabinet, seperti Menteri Pertahanan Juwono Sudarsono, Menteri Hukum dan HAM Andi Mattalatta, Menlu Hassan Wirajuda, Mensesneg Hatta Radjasa, dan Sekretaris Kabinet Sudi Silalahi. Hadir pula mantan Komandan Jenderal Kopassus Mayjen Soenarko dan Letjen Syaiful Rizal.

Tambo Shaho ... Setiap meunasah di Aceh ada sebuah tambo yang berfungsi sebagai alat komunikasi. Tambo mengiringi tanda waktu shalat adalah tambo yang dipukul sekali tunjak tanpa jeda. Bila ada rapat (musyawarah) di meunasah kampong tersebut, tambo akan dipukul sebanyak dua kali tunjak atau sekali jeda. Bila penduduk mendengar suara tambo dua kali jeda (bahasa Aceh: dua go tunjak) itu pasti ada rapat di meunasah atau kelaur gotong royong. Bila ada yang mendengar tiga kali tunjakj atau dua kali jeda, itu pertanda ada orang meninggal. Tambo shaho (beduk shahur) dipukul sangat lama oleh anak-anak muda yang tidur di meunasah. Mereka, anak-anak muda berkongsi bergiliran memmukul beduk dengan berbagai irama yang mereka sukai. Tujuan tambo shaho adalah untuk membangun penghuni rumah agar bangun dari tidur untuk memasak makanan sahur. Tambo shahur akan berhenti ketika anak-anak muda pulang ke rumah makan sahur.

Antara

TIDAK MELAUT: Seorang nelayan warga Desa Pusong Kecamatan Banda Sakti Lhokseumawe Provinsi Aceh melintas di depan puluhan kapal boat, Kamis (20/8). Sejak Rabu kemarin ratusan kapal boat nelayan tidak melaut dalam rangka mengahadapi Meugang Ramadhan di Aceh.

Pakaian Ketat Jangan Masuk Aceh KOTA LHOKSEUMAWE (Waspada): Ustadz DR H Rusli Hasbi, Lc, MA, dosen Universitas Islam Negeri (UIN) Syarif Hidayatullah Jakarta, di mesjid komplek Mapolresta Lhokseumawe, seusai memberikan tausyiah menyambut bulan Ramadhan 1430 H kepada wartawan mengatakan, pakaian ketat jangan masuk Aceh. Menjawab Waspada, Hasbi putra Aceh asli itu mengatakan, untuk mencegah putri Aceh memakai pakaian

ketat, pemerintah harus membuat peraturan baru yakni melakukan sensor terhadap sejumlah mobil pemasok pakaian di perbatasan antara Aceh dan Sumatera Utara. “Pemerintah harus menghentikan setiap mobil yang memasok pakaian ketat ke Aceh di perbatasan. Ini bisa dilakukan oleh masyarakat bekerja sama dengan pemerintah, kalau memang mau diterapkan. Jadi lebih kepada pencegahan, bukan penindakan dengan kekerasan,” sebut dosen di Universitas Islam Negeri (UIN) Syarif Hidayatullah Jakarta itu. Ditanya terkait aksi sejumlah

santri di Aceh yang sering merobek pakaian ketat kaum perempuan dalam razia mengatasnamakan penegakan amar makruf nahi mungkar, Rusli Hasbi mengatakan,“Pada zaman Rasulullah SAW yang hidup di masa Jahiliyah, beliau tidak pernah memerintahkan tentaranya untuk merobekrobek pakaian perempuan. Makanya menangani amarma’ruf nahimungkar tidak perlu melalui kekerasan, karena pendekatan lebih sukses dari pada kekerasan. Kalau suatu waktu dia sudah melawan baru pakai kekerasan, tapi harus lebih dulu dengan pendekatan.” (cmun)

Presiden Yudhoyono Terima Brevet Kehormatan Kopassus JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menerima Brevet Komando Kehormatan Komando Pasukan Khusus (Kopassus), karena yang bersangkutan dinilai telah memberikan dukungan dan pengabdian terbaik kepada korps baret merah tersebut. Upacara penyematan Brevet Komando Kehormatan tersebut dipimpin Presiden Yudhoyono di Markas Komando Kopassus, Cijantung, Jakarta, Kamis. Penyematan Brevet Kehormatan Komando dilak-

sanakan oleh Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo. Hadir dalam upacara itu Menteri Pertahanan Juwono Sudarsono, Kepala Staf Umum TNI Laksamana Madya TNI Didiek Heru Purnomo, Komandan Pasukan Khas TNI Angkatan Udara Marsekal Pertama Harry dan jajaran TNI lainnya. Sebelum penyematan, Presiden Yudhoyono didampingi Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo dan Komandan

Jenderal Kopassus MayjenTNI Pramono Edhie Wibowo menyaksikan demonstrasi keterampilan prajurit Satuan Penanggulangan Teror-81 Kopassus. Peragaan kemampuan tempur itu bertujuan memberikan gambaran tentang kesiapan Kopassus menghadapi setiap ancaman yang dihadapi bangsa dan negara Indonesia. Usai penyematan Brevet Kehormatan Komando, Presiden Yudhoyono memberikan pengarahan kepada seluruh prajurit Korps Baret Merah.

Sri Mulyani Masuk Daftar 100 Wanita Paling Berpengaruh Di Dunia JAKARTA (Waspada): Indonesia menempatkan wakilnya dalam daftar 100 perempuan paling berpengaruh keluaran majalah bisnis Forbes edisi terbaru. Forbes memilih Menteri Keuangan yang yang juga pelaksana tugas Menko Perekonomian, Sri Mu-lyani Indrawati. Sri Mulyani berada di jajaran ke71 dalam daftar itu. Forbes menilai Sri Mulyani berperan dalam menga-tasi dampak resesi global di Indone-sia. Terutama dalam kebijakan fis- kal dan mempengaruhi negara lain untuk menopang cadangan devisa Indonesia lewat skema bilateral swap agreements.

Sosok Bagus, Buronan ... mengetahui alamat terakhir Bagus. “Bahkan, kami juga tidak mengetahui adanya informasi Bagus pernah dipenjara terkait dengan jaringan teroris. Kami mengetahui informasi tersebut justru dari sejumlah media,” ujarnya. Warga tidak tahu Berdasarkan catatan di pemerintahan di Desa Mijen, katanya, Bagus merupakan anak pertama dari empat bersaudara. Sementara Kepala Sekolah Madrasah Ibtidaiyah (MI) Ma’rifatul Ulum 01 di Desa Mijen Fatoni mengakui Bagus pernah menempuh pendidikan di sekolah ini hingga lulus. “Berdasarkan catatan sekolah, dia masuk tahun 1984 dan lulus tahun 1989, dengan nomor induk 1246,” ujarnya. Hanya saja, lanjut dia, saat Bagus menempuh pendidikan di MI Ma’rifatul Ulum, pihaknya belum menjabat sebagai kepala sekolah. “Saya mulai menjabat sebagai kepala sekolah tahun 2001,” ujarnya. Meskipun pemberitaan media begitu gencar, ternyata sejumlah warga sekitar rumah kediaman keluarga Bagus belum banyak mengetahui adanya informasi Bagus menjadi daftar pencarian orang (DPO) polisi. Sutini, 45, tetangga Bagus, mengakui belum mengetahui informasi adanya pemberitaan terkait status Bagus sebagai DPO polisi. “Selama ini, warga mengenal Bagus sebagai orang yang santun dan rajin beribadah,” ujarnya. Sebelumnya, kata Sutini, warga setempat memang pernah mendengar informasi Bagus ditahan polisi karena terkait jaringan teroris. “Saya sempat tak percaya, Bagus ditahan

Forbes juga merasa Sri Mulyani berperan penting dalam memerangi rezim korupsi di Indonesia. Depkeu, klaim Forbes, menjadi salah satu departemen yang korupsinya terkecil dari total departemen di Indonesia. Tak lupa, Forbes memuji Sri Mulyani karena mempermudah aturan investasi dan terus membuat insentif pajak bagi pengusaha. Pada urutan pertama, untuk keempat kali berturut-turut adalah Kanselir Jerman Angela Merkel. Dalam lima besar, perempuan Asia Tenggara yang masuk adalah CEO Temasek, Ho Ching di urutan lima.

Dalam daftar itu, Forbes menganggap figur Sri Mulyani lebih berpengaruh ketimbang Ratu Rania asal Yordania di posisi 75. Ratu menurut Forbes salah satu figur terpenting dan paling didengar di Timur Tengah. Forbes bahkan melacak jejaring sosial, Twitter, sang Ratu dan menemukan ada lebih dari 600 ribu ‘pengikut’. AS adalah negara terbanyak yang menempatkan kaum hawa dalam posisi paling berpengaruh. Nyaris separuh daftar dikuasai perempuan asal AS, baik itu di pemerintahan maupun di sektor bisnis. (republikonline)

polisi gara-gara terkait aksi terorisme,” ujarnya. Anak penjemur gabah Disinggung soal kepulangan Bagus ke rumah orangtuanya di Desa Mijen, Kecamatan Kaliwungu, menurut Sutini, hanya melihat sekali pada waktu Lebaran 2008. “Setelah itu, saya tidak mengetahui lagi kapan Bagus pulang karena saya sibuk dengan pekerjaan saya sebagai penjual alas penjemur gabah,” ujarnya. Ia menambahkan, ayah Bagus juga memiliki aktivitas yang hampir sama, setiap hari sibuk membuat alas penjemur gabah dan dijual sendiri. Meskipun Bagus dikaitkan dengan jaringan teroris, katanya, warga setempat masih bersikap ramah terhadap keluarganya. “Selama ini, keluarga Bagus dikenal baik karena tidak pernah melakukan hal-hal yang merugikan warga sekitar,” ujarnya. Berdasarkan keterangan polisi yang merilis identitas empat buronan yang diduga terlibat dalam kasus peledakan bom di Hotel JW Marriott dan RitzCarlton, salah seorang di antaranya adalah Bagus Budi Pranoto alias Urwah. Sementara tiga buronan lainnya adalah Syaifudin Zuhri bin Djaelani Irsyad alias

Udin alias Soleh, Ario Sudarso alias Suparjo Dwi Anggoro alias Aji alias Dayat alias Mistam Usamudin, dan Mohamad Syahrir. Internet Bagus Budi Pranoto alias Urwah. Pria kelahiran Kudus, 2 November 1978 bersuku Jawa. Urwah memiliki ciri fisik tinggi badan lebih dari 160 cm, bentuk kepala lonjong, warna mata hitam, bentuk alis tebal bentuk bibir tebal. Ciri-ciri khusus pria tersebut, memiliki tahi lalat di bawah bibir sebelah kiri dan memiliki noktah pada pelipis sebelah kiri.

BANDA ACEH (Waspada): Kepala Kepolisian Daerah Aceh Irjen Pol Adityawarman menduga kasus perampokan SPBU Lamteumen beberapa hari lalu, terlibat orang dalam. Sebab, pelaku memfokuskan aksinya itu pada uang tunai dan mengetahui persis tempat penyimpanannya. “Pelaku memokuskan aksinya hanya pada uang yang ada dalam tempat penyimpanan, sedangkan barang-barang lain tidak disentuhnya. Dari situ kita bisa memperkirakan bahwa pelaku sudah mempelajari dan kemungkinan ada orang dalam yang terlibat,” kata Irjen Pol Adityawarman, Rabu (19/8). Menurut Kapolda, sebelum beraksi para pelaku telah mengetahui ada uang hasil penjualan yang di simpan di kantor SPBU tersebut dan belum

disetor ke bank. Tentang perampokan itu sendiri, Kapolda Irjen Pol Adityawarman menduga ada sesuatu sebab akibat, sehingga pihak kepolisian yang menangani kasus tersebut terus melakukan penyelidikan untuk pengungkapannya. Selain perampokan SPBU milik PT Sinar Desa di Simpang Lamteumen itu, pihak kepolisian daerah itui juga memberi atensi terhadap kriminal bersenjata yang terjadi pada bulan ini, yakni pencurian dengan melepaskan tembakan ke udara yang terjadi di Kabupaten Pidie dan pemberondongan di Aceh Timur. “Kita telah membentuk tim khusus di bawah Dit Reskrim untuk menangani ketiga kasus ini,” kata Kapolda lagi.(b09)

Dosen Dan Mahasiswa ... kepada keluarga korban di persidangan. Namun, yang memberatkan terpidana, tambah Kusnoto, perbuatannya merusak citra dosen dan lembaga pendidikan. Materi putusan terhadap dua mahasiswa tidak jauh berbeda. Atas putusan itu, masing-masing terpidana melalui kuasa hukumnya menyatakan banding. Sedangkan para JPU menyatakan pikir-pikir untuk menentukan sikap selanjutnya. Dua Lagi Dituntut 14 Tahun Sedangkan pada persidangan lain-nya, Jaksa Penuntut Umum (JPU) menuntut dua mahasiswa yakni, Juliandi R Sitompul dan Jumpa Sihombing masing-masing selama 7 tahun penjara. Di hadapan majelis hakim, Inang Kasmawati, JPU Sabrina, SH mengatakan, terdakwa Juliandi R Sitompul dinyatakan terbukti secara sah dan menyakinkan bersalah sebagaimana diatur pasal 146 yo 55 ayat 1 ke 1 KHUPidana karena melakukan pembubaran sidang paripurna DPRD yang sah. Hal serupa disampaikan JPU Y Sihombing. ”Kami memohon majelis hakim menangani perkara ini menjatuhkan hukuman kepada kedua terdakwa 7 tahun penjara,” kata kedua JPU pada akhir amar tuntutannya. Atas tuntutan itu, kedua terdakwa dan kuasa hukumnya menyatakan akan mengajukan pledoi (pembelaan). Majelis hakim kemudian menunda sidang hingga 27 Agustus 2009. Dalam kasus itu, para terpidana dan terdakwa didakwa JPU melakukan perbuatan pidana membubarkan sidang paripurna DPRDSU yang sah dan mendesak digelarnya sidang paripurna pembentukan Protap. Akibatnya, agenda persidangan yang digelar pada waktu itu dihentikan. Demonstrasi anarki dari para massa pendukung Protap mendesak almarhum Ketua DPRDSU Abdul Azis Angkat meneken rekomendasi pengesahan pembentukan Protap hingga menewaskan cendikiawan muslim itu. Aksi anarki itu juga merusak fasilitas gedung yang ada di dalam ruang sidang paripurna dengan kerugian materil mencapai lebih kurang Rp350 juta. (h05)

Warna-warni Realitas ... memberanikan diri bangun dari tempat duduknya dan menjawab: “Kami datang dari berbagai daerah Pak, ada yang dari Banda Aceh, dari Aceh Besar, Pidie, Lhokseumawe dan Aceh Utara. Kami datang untuk menemui Bapak dan Pak Gubernur untuk minta bantuan daging meugang.” Mendengar hal itu, Wagub sempat menasehati ‘para tamu’ itu agar memanfaatkan lahan dan potensi yang mereka miliki untuk dijadikan sumber penghidupan. Setelah berbincang-bincang dengan mereka, Nazar memerintah stafnya untuk mendata para tamu tersebut untuk diberikan bantuan, meskipun dana untuk itu tidak dialokasi dalam APBA. Menurut Wagub, fenomena itu tidak hanya pada hari itu (kemarin-red), semenjak dua hari lalu. Mereka tidak saja datang ke kantor, tetapi juga ke rumah dinas di kawasan Blang Padang, bahkan ke rumah pribadinya di kawasan Jeulingke. “Perlu kearifan lokal untuk mencegah agar masyarakat tidak malas bekerja dan menekan angka penduduk miskin di wilayah ini. Kami sudah mewacanakan adanya sebuah aturan agar masyarakat tidak malas sehingga kemiskinan tidak bertambah, yakni melalui kearifan lokal,” ujarnya saat ditanyai wartawan ihwal kedatangan ratusan warga menjelang “meugang” (hari penyembelihan hewan ternak) menyambut Ramadan di kantornya, Rabu (19/8). Muhammad Nazar menjelaskan, kearifan lokal dimaksud adalah apa yang pernah dipraktekkan pada masa-masa kesultanan Aceh, seperti melahirkan aturan hukum sehingga adanya sebuah Qanun (Perda) yang akan mengatur kewajiban bekerja bagi setiap penduduk di Provinsi Aceh. “Masa kesultanan Aceh tempo dulu, pihak kerajaan menggelar ‘swepping’ untuk mencari setiap warga yang tidak mau bekerja. Dengan cara itu, maka seluruh penduduk memiliki aktivitasnya sehingga tidak ada rakyat yang miskin,” kata Nazar. Wagub menambahkan, berdasarkan data yang ada, angka kemiskinan di Aceh mencapai sekitar 23 persen dari total penduduk provinsi itu sekitar 4,3 juta jiwa. “Itu data dari Badan Pusat Statistik (BPS). Tapi, kami yakini angka kemiskinan di Aceh di bawah 20 persen, dengan menggunakan indikator hampir seluruh penduduk di atas usia 15 tahun di Aceh memiliki perangkat komunikasi (HP) dan warga yang menunaikan ibadah haji meningkat setiap tahun.” Di pihak lain, Wagub menjelaskan kedatangan ratusan warga ke kantor gubernur maupun sejumlah kantor bupati/walikota di Aceh itu merupakan salah satu persoalan sosial di provinsi yang dipimpinnya. “Kita semua prihatin dengan kondisi semacam ini, dan ini terjadi setiap tahun menjelang puasa atau hari raya. Ini problem sosial,” ungkapnya. Akan tetapi, dia menambahkan yang datang untuk meminta bantuan atau hanya sekedar uang ‘daging meugang’ itu bukan seluruhnya masyarakat miskin. Pihaknya mensinyalir ada juga di antaranya yang diorganisir pihak-pihak tertentu dan menggerakkan mereka untuk berbondong-bondong datang minta bantuan ke pemerintah. “Tapi itu semua kami sikapi dengan baik. Saya tidak mengusir jika ada masyarakat yang datang meminta bantuan. Tapi, kita juga tidak boleh membiarkan masyarakat larut dengan cara meminta-minta,” tambah Muhammad Nazar. (b09)

Berita Utama

2 Undian Penentuan Stan Ramadhan Fair Ricuh MEDAN (Waspada): Puluhan pedagang lama Ramadhan Fair mengamuk di depan ruangan Kasuari Hotel Garuda Plaza Medan,Kamis (20/8). Pasalnya, mereka tidak lagi mendapat stan yang disediakan pada kegiatan ini. Tidak dilibatkannya lagi para pedagang ini telah dimulai sejak pertama tidak menerima undangan dari even organizer kegiatan tersebut (PT Duta Agung Grup). Padahal, mereka sudah melakukan pendaftaran ulang dengan menyerahkan bukti pedagang lama, mengisi formulir di atas materai, pas photo dan lainnya. Namun, persyaratan yang diisi di Kantor Dinas Kebudayaan dan Pariwisata (Disbudpar) Kota Medan 10 Agustus lalu, hanya memenuhi berkas saja. “Saya dari pertama berjualan dan sudah bisa dibuktikan dengan permohonan saya dan pedagang tahun lalu sudah diterima. Tapi, kenapa sekarang tidak bisa berjualan. Mana janji pemko yang hanya membolehkan pedagang lama. Kalau tidak bisa, mana berkas saya, kembalikan,” tegasnya. Apa yang disampaikan pedagang ini memang benar, kelihatan mereka yang berjualan adalah sebagian muka baru, para keluarga pejabat, anggota dewan, ormas dan lainnya. Memang setiap tahunnya, dia berjualan busana muslim, beberapa PNS yang mengguna-

kan baju Dinas Perhubungan Kota Medan, Dinas Pendapatan Kota Medan. Anggota DPRD Medan dan perwakilan ormas, parpol dan lainnya. Kabid Sarana Pariwisata Dinas Kebudayaan dan Pariwisata Kota Medan Ramlan, mengaku tidak ikut bertanggung jawab atas kejadian ini. “Tanyalah sama kadis, aku hanya meninjau dan menyaksikan pencabutan nomor stan. Bukan aku penanggung jawab kegiatan ini,” ucapnya. Perwakilan PT Duta Agung Groupselaku EO kegiatan yang menghabiskan dana Rp2,5 miliar dari APBD Kota Medan ini, M Rusli mengatakan, mereka mengundang pedagang atas data yang diberikan Disbudpar. “Kami baru mengerjakan proyek tersebut baru tahun ini. Masalah pengaturan pedagang itu dinas, kami hanya menerima laporan pedagang yang berjualan dari disbudpar dan mengundangnya. Sementara daftar ulang, berkas yang sudah masuk tidak ada sama kami. Kejadian ini memang memalukan sekali,” terang manajer lapangan ini. “Memang yang diutamakan pedagang lama. Kejadian ini juga di luar dugaan kami. Apabila ada perubahan atau penambahan stan akibat kejadian ini, nanti kami koordinasikan ke dinas,” tandasnya. (h10)

Besok Puasa ... Ketua Badan Hisab dan Rukyat, Muchtar Iljas yang menyampaikan hasil pemantauan di seluruh Indonesia, menyebutkan bahwa perhitungan data hisab yang dihimpun oleh Direktorat Jendral Bimas Islam dari 29 titik pemantauan di seluruh Indonesia menyatakan bahwa ijtima 29 Syaban 1430H/2009 M bertepatan hari Kamis, 20 Agustus 2009, ketinggian hilal masih dibawah ufuk berada pada posisi -3 derajat, 10 menit sampai 0 derajat, 30 menit. “Saat matahari terbenam pada tanggal tersebut di seluruh Indonesia, posisi hilal berada di bawah ufuk. Berdasarkan laporan itu maka dapat disepakati bahwa 1 Ramadhan jatuh pada hari Sabtu, 22 Agustus 2008,” kata Muchtar yang juga Direktur Urusan Agama Islam Depag. Sementara Ketua Laznah Falaqiah NU, Ahmad Gozali Masruri mengatakan, sejak NU ada pedoman yang dipakai adalah rukyatul hilal didukung oleh data hisab. “NU juga melakukan hisab karena kita punya kalender, tetapi hisab itu perlu dilakukan koreksi,” ujarnya. Ia juga mengusulkan agar rukyatul hilal dilakukan sebulan sekali. Sedangkan pengurus Muhammadiyah, Abdul Fatah Wibisono mensyukuri keputusan pemerintah yang menetapkan awal Ramadhan jatuh 22 Agustus 2009, karena Muhammadiyah juga mengawali puasa pada hari yang sama. “Kami juga setuju usulan NU agar rukyatul hilal dilakukan setiap bulan,” kata wakil sekretaris Majelis Tarjih Muhammadiyah ini. Anggota LAPAN, Jamaluddin merasa kuatir dalam penentuan awal Ramadhan dan 1 Syawal yang sering terjadi perbedaan. Tapi pada tahun ini menghasilkan kesimpulan yang sama. “Kalau kriterianya masih seperti ini, tahun depan bisa terjadi perbedaan,” ujarnya.

Petrus Dan Munir ... Janganlah dalam melakukan tugas negara, kita melawan UU dan UUD 1945,” kata Yudhoyono menegaskan. Presiden mengatakan negara tidak akan ragu-ragu menegakkan supremasi hukum dalam penanganan terorisme, kelompok separatis dan pemberontakan bersenjata. “Namun, semua harus dijalankan secara konstitusional, transparan dan akuntabel,” ujarnya. Sebelumnya, Presiden Yudhoyono diresmikan sebagai warga kehormatan Komando Pasukan Khusus TNI-AD ditandai dengan penyematan Brevet Kehormatan Kopassus oleh Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo. Dalam acara itu hadir sejumlah menteri kabinet, seperti Menteri Pertahanan Juwono Sudarsono, Menteri Hukum dan HAM Andi Mattalatta, Menlu Hassan Wirajuda, Mensesneg Hatta Radjasa, dan Sekretaris Kabinet Sudi Silalahi.

SBY Siapkan Program ... mengatakan pada hakikatnya program kerja lima tahun ke depan adalah keberlanjutan yang dipertajam dari kerja pemerintahan lima tahun lalu yang ia pimpin. Postulat kampanye “Yang sudah baik dilanjutkan dan yang belum baik diperbaiki” kembali diulangi Yudhoyono di atas panggung kemenangan. “Dalam dua bulan ke depan akan disiapkan rencana aksi untuk pemerintahan 2009-2014, di dalamnya termasuk program kerja seratus hari pertama dan agenda lima tahun ke depan,” tuturnya. Menurut dia, rencana kerja pemerintah selama lima tahun mendatang pada dasarnya adalah penjabaran dari visi dan misi yang telah ia sampaikan selama rangkaian kampanye Pemilu 2009. Di antara fokus program kerja yang disebutkan oleh Yudhoyono untuk lima tahun ke depan adalah peningkatan kualitas pendidikan, kesehatan, serta memperkuat sektor perekonomian rakyat, terutama usaha kecil, mikro dan menengah. Selain itu, pemerintahan mendatang juga akan mendorong revitalisasi pertanian dan perindustrian, serta mempercepat pembangunan infrastruktur. Untuk kebutuhan itu, Yudhoyono berjanji akan membentuk kabinet yang terdiri atas menteri-menteri yang kompeten, bersih, jujur, dan penuh dedikasi, baik dari kalangan partai maupun nonpartai. “Pakta integritas dan kontrak kinerja karena itu akan menjadi bagian penting pelaksanaan kabinet mendatang. Saya akan memilih yang terbaik, profesional, baik dari partai politik maupun nonpartai politik,” ujarnya. Yudhoyono pun berjanji agar para menterinya di kabinet mendatang itu sudah bisa bekerja sejak hari pertama mereka dilantik. Sementara untuk menteri-menteri Kabinet Indonesia Bersatu yang saat ini masih mengemban tugas, Yudhoyono mengatakan, mereka telah diinstruksikan untuk tetap bekerja sebagaimana mestinya hingga masa jabatan mereka berakhir pada Oktober 2009.

100 Wanita Paling ... Berada di urutan No. 1, untuk keempatkalinya berturutturut, adalah Kanselir Jerman Angela Merkel. September tahun ini dia akan menghadapi pemilihan. Dia adalah pemimpin wanita yang menguasai negara yang perekonomiannya menduduki ranking keempat terbesar di dunia. Dia menghadapi satu saat yang keras, namun GDP Jerman diharapkan akan meningkat tahun ini meski ada beberapa ganjalan sesuai dengan krisis ekonomi dunia saat ini. Selain Angela Merkel, posisi nomor dua dan tiga adalah Sheila Bair Ketua Federal Deposit Insurance Corp dan Indra Nooyi Ketua Eksekutif PepsiCo masing-masing dari AS. Nomor 36 Hillary Rodham Clinton Menlu AS, nomor 40 Michelle Obama isteri Presiden AS menyusul nomor 41 dan 42 Oprah Winfrey dan Ratu Inggris Elizabeth II. Presiden Filipina Gloria Arroyo berada di urutan ke 44.(m07)

WASPADA

Jumat 21 Agustus 2009

Presiden Yudhoyono Terima Brevet Kehormatan Kopassus

Waspada/Ibnu Kasir

Bupati Langkat Ngogesa Sitepu menyaksikan penandatanganan nota kesepakatan (MoU) antara Pertamina Pusat – PT Pelindo 1 dan Pemkab Langkat untuk pengoperasian pelabuhan Pangkalansusu di aula kantor Kementerian BUMN Jalan Merdeka Selatan Jakarta , Kamis (20/8) sore.

MoU Telah Dibuat, Pangkalansusu Menjadi Pelabuhan Internasional JAK ARTA ( Waspada): Harapan masyarakat Langkat khususnya yang berdomisili di wilayah Teluk Haru agar daerahnya memiliki pelabuhan umum dan internasional dalam waktu dekat segera terwujud. Bupati Langkat Ngogesa Sitepu telah menandatangani nota kesepakatan (MoU) dengan PT Pelindo I tentang pengoperasian Pelabuhan Pangkalansusu di aula kantor Kementerian BUMN Jalan Merdeka Selatan Jakarta, Kamis (20/8) sore. Penandatanganan nota kesepakatan (MoU) untuk pengoperasian pelabuhan Pangkalansusu menjadi pelabuhan ekspor/impor diawali oleh fihak Pertamina Pusat dengan PT Pelindo 1, selanjutnya dari Dirut PT Pelindo 1 , Arie Sukamto dengan Bupati Langkat Ngogesa Sitepu serta disaksi-

kan Menneg BUMN Sofyan Djalil , Kementerian Perhubungan RI dan Parlindungan Purba anggota DPD RI asal Sumut. Bupati Langkat Ngogesa Sitepu ketika dihubungi seusai acara tersebut mengemukakan, pelabuhan Pangkalansusu sebelumnya merupakan pelabuhan khusus milik Pertamina. Dengan adanya nota kesepakatan ini pelabuhan tersebut bakal berkembang sebagai pelabuhan umum yang sangat strategis . Kelak, bila Pelabuhan Pangkalansusu yang sudah vakum sejak beberapa tahun belakangan ini diaktifkan tentunya mampu menyerap tenaga kerja serta menghidupkan denyut nadi perekonomian masyarakat di sekitar kawasan tersebut, ujar Bupati Ngogesa Sitepu menjelaskan.

Hal senada juga dikemukakan Parlindungan Purba anggota DPD RI yang hadir dalam acara tersebut . Menurutnya pelabuhan Pangkalansusu sangat penting dikembangkan. Kalau dulu ditutup, maka bila dikembangkan jadi pelabuhan internasional ditambah lagi dibangun pada kawasan berikat, bayangkan berapa banyak lapangan kerja yang terserap. Sementara itu sumber Waspada menyebutkan sejak beberapa bulan yang lalu, perusahaan investasi Thailand yang bermitra dengan group perusahaan China dan Timur Tengah sudah menjajaki investasi di Kabupaten Langkat, khususnya meninjau lokasi rencana pembangunan pelabuhan internasional di Pangkalan Susu tersebut. (a01)

Sidang Demo Anarki Protap

Dosen Dan Mahasiswa Dihukum 11 Tahun MEDAN (Waspada): Poltak Panjaitan sebagai dosen Universitas Negeri Medan dihukum 3 tahun 6 bulan penjara dalam persidangan di Pengadilan Negeri Medan, Kamis (20/8), karena terlibat demo anarki menuntut Provinsi Tapanuli (Protap) yang menewaskan Ketua DPRDSU Abdul Azis Angkat. Pada persidangan terpisah, dua mahasiswa, Ricard Ricardo dan Roya Frans Sagala dijatuhi hukuman 4 tahun dan 3 tahun 6 bulan penjara oleh majelis hakim yang menangani perkara keduanya. Vonis majelis hakim kepada ketiga terpidana lebih ringan dari tuntutan para Jaksa Penuntut Umum (JPU), di mana persidangan sebelumnya meminta agar mereka dihukum 7 tahun penjara. Ketiganya dinyatakan terbukti bersalah secara sah dan meyakinkan sebagaimana diatur dan diancam pasal 146 yo 55 ayat 1 ke 1 KHUPidana, dalam hal pembubaran sidang paripurna dewan yang sah. “Berdasarkan fakta dan keterangan saksi di persidangan,

Poltak Panjaitan, terbukti ikut dalam aksi demo anarki bersama ribuan massa pendukung Protap di gedung DPRDSU pada 3 Februari 2009,” kata majelis hakim diketuai Kusnoto. Namun, lanjutnya, peran serta terpidana dalam aksi demo itu hanya sebatas ikut meramaikan unjukrasa. “Terpidana tidak terlibat langsung dalam aksi pengerusakan dan penyerangan hingga menewaskan ketua DRPRD itu, “ tegasnya. Pertimbangan lain, majelis hakim menjatuhkan vonis 3 tahun 6 bulan penjara kepada terpidana karena dia hanya sebagai simpatisan dan sudah meminta maaf secara langsung kepada keluarga korban di persidangan. Namun, yang memberatkan terpidana, tambah Kusnoto, perbuatannya merusak citra dosen dan lembaga pendidikan. Materi putusan terhadap dua mahasiswa tidak jauh berbeda. Atas putusan itu, masing-masing terpidana melalui kuasa hukumnya menyatakan banding. Sedangkan para JPU menyatakan pikir-

pikir untuk menentukan sikap selanjutnya. Dituntut 14 Tahun Sedangkan pada persidangan lainnya, Jaksa Penuntut Umum ( JPU) menuntut dua mahasiswa yakni, Juliandi R Sitompul dan Jumpa Sihombing masing-masing selama 7 tahun penjara. Di hadapan majelis hakim, Inang Kasmawati, JPU Sabrina, SH mengatakan, terdakwa Juliandi R Sitompul dinyatakan terbukti secara sah dan meyakinkan bersalah sebagaimana diatur pasal 146 yo 55 ayat 1 ke 1 KHUPidana karena melakukan pembubaran sidang paripurna DPRD yang sah. Hal serupa disampaikan JPU Y Sihombing. “Kami memohon majelis hakim menangani perkara ini menjatuhkan hukuman kepada kedua terdakwa 7 tahun penjara,” kata kedua JPU pada akhir amar tuntutannya. Atas tuntutan itu, kedua terdakwa dan kuasa hukumnya menyatakan akan mengajukan pledoi (pembelaan). Majelis hakim menunda sidang hingga 27 Agustus 2009. (h05)

Ulama Perlu Dialog ...

menyadari pentingnya untuk menyampaikan kebenaran kepada umat, akhirnya 100 pernik nasehat dan tausyiah tentang kehidupan dan keberagaman saya ini dibuat,” kata Maslin. Maslin sendiri mengaku bersyukur buku tersebut dapat diterbitkan ketika usianya sudah 72 tahun, karena ada hadis yang menyatakan jika ada seseorang yang mendapat hidayah Allah karena ajakan mu, sungguh hal itu lebih baik bagimu dibanding unta merah (kendaraan yang paling mewah dan mahal pada jaman rasul). “Selain itu, karena warisan terbaik bukanlah harta, tapi ilmu,” katanya. Sementara itu, Gubsu dalam sambutannya yang dibacakan Asisten IV Pemprovsu yang juga Walikota Medan, Rahudman Harahap menyambut baik peluncuran buku tersebut, karena dalam kenyataan kehidupan saat ini, belum seluruh umat mampu menerapkan ajaran agama dengan baik. “Sehingga buku ini diharapkan dapat dijadikan pelajaran dan keteladanan bagi umat Islam saat ini. Apalagi dalam rangka memasuki bulan Ramadhan penuh hi’mah, diharapkan dapat meningkatkan ukhuwah islamiyah diantara kita,” katanya. Dalam kesempatan itu, H. Maslin Batubara menyerahkan buku tersebut kepada 16 ulama, tokoh, cendikiawan dan pemimpin ormas Islam di Sumut. Ke 16 tokoh tersebut, GubsuH. Syamsul Arifin,

Pangdam I/BB Burhanuddin Amin, Kapoldasu Irjen Pol. Badroedin Haiti, Ketua MUI Sumut Prof. Abdullah Syah, Kakanwil Depagsu Syariful Mahya Bandar, Ketua PB Alwashliyah KH. Aziddin, Ketua DPRDSU, Rektor IAIN SU Prof. Nur Ahmad Fadhill, Kepala TVRI Sumut Husein Gani, Ketua PW Muhammadiyah Sumut, Ketua PW NU Sumut, Pemimpin Redaksi Harian Waspada Prabudi Said, Kadis Infokom Eddy Syofian, Tuan Syeh Basilam, Ketua Koalisi Umat Sumut.(h11)

Melihat kondisi itulah, kata Syahrin, para cendikiawan muslim yang banyak berjuang dalam mengembangkan agama Islam di Sumut, seperti H. Maslin Batubara, mengusulkan agar para tokoh-tokoh agama di Sumut berdialog untuk mencari untuk mengatasi persoalan tersebut. “Pertemuan dengan ulama, cendikiawan muslim dan praktisi yang konsern pada perkembangan agama Islam di Sumut diharapkan mampu menjelaskan tentang kondisi umat. Serta mencari upaya untuk mengatasi cobaan itu,” katanya. Syahrin menambahkan, kondisi tersebut juga menyebabkan buku seperti 100 Poda Kearifan yang berisi tentang pernik-pernik filosofi kehidupan dan keberagamaan oleh H. Maslin Batubara yang dikumpulkannya sejak 1994, dapat berguna dalam rangka tugas kolektif untuk saling menasehati dan menjadi bahan renungan keagamaan bagi umat. Sementara itu, cendikiawan muslim dan juga pengusaha, H. Maslim Batubara, dalam sambutannya mengatakan buku tersebut berisi 100 filosofinya dalam kehidupan dan keberagaman yang dikumpulkan secara teliti dan cermat oleh Prof. Dr. Syahrin Harahap. “Awalnya saya ragu untuk membuat buku ini. Hati saya sempat bertanya apakah betul statemen saya yang dikumpulkan oleh Prof Syahrin ini memang berguna bagi umat. Tapi

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menerima Brevet Komando Kehormatan Komando Pasukan Khusus (Kopassus), karena yang bersangkutan dinilai telah memberikan dukungan dan pengabdian terbaik kepada korps baret merah tersebut. Upacara penyematan Brevet Komando Kehormatan tersebut dipimpin Presiden Yudhoyono di Markas Komando Kopassus, Cijantung, Jakarta, Kamis (20/8). Penyematan Brevet Kehormatan Komando dilaksanakan oleh Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo. Hadir dalam upacara tersebut Menteri Pertahanan Juwono Sudarsono, Kepala Staf Umum TNI Laksamana Madya TNI Didiek Heru Purnomo, Komandan Pasukan Khas TNI Angkatan

Udara Marsekal Pertama Harry dan jajaran TNI lainnya. Sebelum penyematan, Presiden Yudhoyono didampingi Kepala Staf Angkatan Darat Jenderal TNI Agustadi Sasongko Purnomo dan Komandan Jenderal Kopassus Mayjen TNI Pramono Edhie Wibowo menyaksikan demonstrasi keterampilan prajurit Satuan Penanggulangan Teror-81 Kopassus. Peragaan kemampuan tempur itu bertujuan memberikan gambaran tentang kesiapan Kopassus menghadapi setiap ancaman yang dihadapi bangsa dan negara Indonesia. Usai penyematan Brevet Kehormatan Komando, Presiden Yudhoyono memberikan pengarahan kepada seluruh prajurit Korps Baret Merah.

PD: Mega Nggak Ucapkan Selamat Juga Tidak Apa-apa JAKARTA (Waspada): Kubu SBY-Boediono sama sekali tidak mempermasalahkan sikap Megawati Soekarnoputri yang belum sampaikan selamat atas keunggulan SBY dalam Pilpres 2009. Tak perlu dipermasalahkan juga bila Mega tidak menyampaikan ucapan selamat. “Nggak mengucapkan selamat juga tidak apa-apa,” ujar Ketum DPP Partai Demokrat Hadi Utomo, sebelum acara pidato penerimaan SBY-Boediono, di Arena PRJ, Kemayoran, Jakarta, Kamis (20/8). Hadi menegaskan, ucapan selamat adalah etika dalam sebuah kompetisi, tidak terkecuali kompetisi politik. Pengakuan terbuka atas keunggulan pihak kompetitor juga merupakan

budaya dan kebiasaan yang sangat lazim di bangsa Indonesia. “Ucapan selamat itu etika dalam politik, dulu kan pernah membuat pernyataan siap menang dan siap kalah. Itu budaya kita,” papar Hadi. Lebih lanjut Hadi menyatakan maksud kunjungannya ke kediaman Megawati Soekarnoputri semalam juga bukan membahas ucapan selamat tersebut. Melainkan untuk silahturahmi dan membuka peluang kerjasama dengan PDIP di masa mendatang. “Silahturahmi supaya nantinya akan ada kerjasama yang baik di Senayan sana,” ujar Hadi. (dtc)

Tidak Ada Kesepakatan PD Dukung Taufiq Kiemas JAKARTA (Waspada): Ketum DPP PD Hadi Utomo menegaskan maksud kunjungannya ke rumah Megawati untuk keperluan silaturrahmi. Tidak ada kesepakatan khusus mendukung Taufiq Kiemas sebagai bakal calon ketua MPR 2009-2014. “Tidak ada tawar menawar. Ketua MPR ditentukan anggota legislatif di Senayan,” ujar Hadi Utomo sebelum pidato penerimaan SBYBoediono di Arena PRJ, Jakarta, Kamis (20/8). Menurut Hadi, dalam UU Susduk jelas dinyatakan bahwa mekanisme penentuan Ketua MPR merupakan kewenangan antara para

anggota DPD dan DPR terpilih periode 20092014. Karena itu proses penetapannya akan sangat dipengaruhi dinamika politik hasil Pemilu 2009. “Ketua mungkin oleh parpol yang memperoleh suara terbanyak,” imbuh Hadi. Namun demikian dia mengakui bahwa silahturahmi ke rumah Mega semalam terkait dengan target politik tertentu, yakni membuka peluang kerjasama antara dua parpol di dalam parlemen lima tahun mendatang. “Silaturrahmi supaya nantinya ada kerjasama yang baik di Senayan sana,” pungkas Hadi. (dtc)

SBY Kirim Salam Pada Abu Bakar Ba’asyir JAKARTA (Waspada): Setelah sempat terlibat salah paham, DPP Majelis Dzikir SBY Nurussalam bersilaturahmi ke Pondok Pesantren Al Mu’min, Ngruki, Solo. Sekaligus, majelis dzikir tersebut menyampaikan salam dari Presiden SBY kepada Ustad Abu Bakar Ba’asyir. Pertemuan berlangsung tertutup siang hari ini, Kamis (20/8). Rombongan pihak DPP Majelis Dzikir SBY Nurussalam dipimpin ketua umum mereka, H. Haris Thahir. “Presiden SBY, yang juga pembina Majelis Dzikir juga mengirim salam untuk Ustad (Ba’asyir)”, kata Haris, dalam surat elektronik yang detikcom terima. Di dalam surat elektronik itu dijelaskan maksud kunjungan untuk silaturahmi terkait datangnya bulan suci Ramadan. Pertemuan berlangsung akrab dan konstruktif serta ada kesepakatan membuka peluang dialog bila ada

Malaysia Setujui ... Satgas (satuan tugas) baik Indonesia dan Malaysia untuk memantau pelaksanaan MOU yang baru, katanya. “Masing-masing akan membuat TOR atau Juklak (petunjuk pelaksana) kemudian dibahas bersama hingga terciptanya Juklak bersama tentang bagaimana memantau pelaksanaan MoU yang baru,”

Dr Azahari Janjikan ... menempel di bajunya. “Saya melihat ada semacam kartu anggota yang menempel di baju Dr Azahari. Di situ ada tulisan Dr Azahari beserta fotonya,” jawab pria berusia 23 tahun tersebut yakin. Azahari yang dia kenal, imbuhnya selalu berpakaian biasa saja dengan menggunakan peci, kemeja, dengan jenggot tipis dan kumis tidak ter-

masalah di masa mendatang. “Kedua belah pihak membuka pintu dialog intensif untuk mencari titik temu dari setiap permasalahan, jangan sampai umat Islam dipecah belah pihak-pihak tertentu,” ujar Haris. Di dalam surat elektronik itu juga disebutkan bahwa Ustadz Ba’asyir mengingatkan agar Pemerintah RI agar bersikap tegas kepada Israel yang menurutnya masih menjajah bangsa Palestina. Dia mendesak Presiden SBY segera mencabut SK pembukaan Kantor Dagang Israel di Jakarta yang dikeluarkan pada 2001. ”Jangan justru membangun hubungan dagang atau dalam bentuk apa pun dengan Israel. Sebab, hal itu menyakiti hati umat Islam secara khusus dan masyarakat dunia pada umumnya,” kata Direktur Pondok Pesantren Al Mukmin, Ngruki, Ustadz Wahyudin. (dtc)

kata Arif Havas. “Kami akan bertemu lagi dengan Pokja Malaysia dua minggu lagi di Jakarta untuk membahas mengenai MOU baru dan Juklak mengenai Satgas pemantau implementasi MoU. Selama belum ada kesepakatan dan MoU baru, kebijakan penghentian pengiriman PRT ke Malaysia akan berjalan terus,” katanya.

Dirjen Gede Arke mengingatkan siapapun yang mencoba mengirim PRT ke Malaysia dan melanggar kebijakan ini akan diambil tindakan tegas dan dituduh melanggar UU Perdagangan manusia. “Sudah banyak mereka yang mengirim TKI dan PRT ilegal terkena UU Anti-Perdagangan Manusia. Jadi jangan coba-coba,” tambah dia.

lalu tebal. “Kalau saya secara pribadi menolak ajakan Dr Azahari,” pungkas Tjitra. Ketua RT 9/10, tempat Tjitra tinggal, Sutarmanto menjelaskan, Tjitra sempat menghilang 2 bulan. Karena ingin mengorek cerita Tjitra, Sutarmanto mengundang Tjitra datang ke rumahnya dengan alasan minta diurut. Sembari diurut, keduanya bercerita. Dari situlah keluar pengakuan Tjitra bahwa dia

pernah bertemu dengan Syaifudin di Yogyakarta. Tertarik dengan cerita Tjitra, Sutarmanto lalu memanggil polisi. Akhirnya 3 polisi datang dan memeriksa Tjitra hingga kini di rumah Sutarmanto. Menur ut Sutarmanto, Tjitra telah banyak berubah dibandingkan saat sebelum menghilang. Tjitra seperti orang linglung dan banyak tertawa saat ditanya. (dtc)

Luar Negeri

WASPADA Jumat 21 Agustus 2009

Serangan Di Hari Pemilu Afghanistan, 26 Tewas KABUL, Afghanistan (AP): Para pejabat senior keamanan mengatakan 26 warga sipil dan pasukan keamanan tewas dalam serangan militan di hari pemilihan di Afghanistan Kamis (20/8). Kematian itu terjadi ketika jutaan warga Afghanistan memberikan surat suaranya dalam pemilihan presiden dan dewan provinsi di seluruh negeri tersebut. Para pejabat keamanan mengatakan delapan tentara Afghanistan, sembilan polisi dan sembilan warga sipil tewas dalam serangan tersebut. Serangkaian serangan kecil yang terjadi di berbagai tempat telah menyebabkan rendahnya angka pemilih di beberapa daerah Afghanistan, teristimewa di selatan yang bergolak. Seorang pejabat senior Afghanistan mengatakan kepada The Associated Press dia memperkirakan jumlah pemilih secara keseluruhan berkisar 40 sampai 50 persen dari 15 juta warga yang terdaftar memilih. Ancaman Taliban nampaknya ‘menciutkan nyali’ pemilih di kawasan yang dikuasai militan di selatan Kamis ketika masyarakat Afghanistan memilih presiden baru yang akan memimpin negara mereka yang terpuruk di dalam berbagai problem. Para militan melancarkan

serangan roket, bom bunuhdiri dekat beberapa tempat pemungutan suara. Rendahnya jumlah pemilih di selatan akan merusak peluang Presiden Hamid Karzai untuk terpilih kembali dan situasi itu akan meningkatkan popularitas penantang utamanya, mantan Menlu Abdullah Abdullah. Jumlah pemilih di utara nampak tinggi, suatu isyarat baik bagi Abdullah. Para pejabat internasional meramalkan satu pemilihan yang tidak sempurna — pemilihan presiden langsung yang kedua kalinya yang pernah dilakukan di Afghanistan — namun menyiratkan harapan bahwa masyarakat Afghanistan akan menerima itu sebagai suatu yang sah, satu komponen penting dari strategi perang Presiden AS Barack Obama. Militan Taliban berjanji akan menagganggu pemungutan suara dan mengumumkan berbagai ancaman bahwa siapa yang memberikan suaranya akan dihukum. Tempat-tempat pemungutan suara dibuka pada pukul

07:00 waktu setempat Kamis (20/ 8), untuk pemilihan presiden kedua di Afghanistan, yang diselenggarakan di bawah keamanan yang ketat di tengah ancaman Taliban untuk menggagalkan pemilihan itu. Sekitar 17 juta warga Afghanistan tercatat berhak memilih - dalam pemilu ketiga yang diadakan sejak rezim garis keras Taliban ditumbangkan dalam serangan yang dipimpin Amerika Serikat pada akhir tahun 2001. “Di beberapa daerah pemungutan suara telah dibuka, di tempat-tempat lainnya akan dibuka dalam tempo lima menit lagi,” kata seorang juru bicara Komisi Pemilu Independen, Noor Mohammad Noor. Komisi menjadwalkan akan membuka 6.700 pusat pemungutan suara di seluruh negeri, namun jumlah yang telah dibuka akan diumumkan di media kemudian, katanya. Karzai: Lawan Taliban Presiden Karzai menyeru rakyat Afghanistan agar membangkang terhadap ancaman Taliban dan memberi suara, beberapa jam sebelum pemungutan suara dimulai dalam pemilihan umum Kamis, yang merupakan ujicoba paling be-

rat dalam mandatnya sendiri dan demokrasi rapuh di negeri tersebut. Jalan-jalan di ibukota Afghanistan, Kabul, tegang, polisi disebar dengan masa tugas bergilir selama 24 jam, dan Karzai berkeras Taliban, yang lebih kuat dari kapan pun sejak mereka digulingkan pada 2001, akan gagal dalam melaksanakan janji mereka guna mengganggu pemilihan presiden kedua di ne-

geri tersebut. Sementara itu, roket-roket kecil menghantam kota selatan Afghanistan, provinsi Kandahar, Kamis, kata gubernur provinsi tersebut. Penembakan roketroket itu terjadi pada saat rakyat Afghanistan siap untuk melakukan pemungutan suara dalam pemilihan presiden yang tegang, karena kelompok garis keras Taliban berikrar akan menggagalkan pemilihan. (m07)

Pasukan Irak Siaga Tinggi Setelah Rangkaian Pengeboman Di Baghdad BAGHDAD, Irak (Antara/AFP): Pasukan Irak siaga tinggi, Kamis (20/8), setelah dua serangan bom truk yang menewaskan 95 orang dan mencederai hampir 600 orang pada hari paling berdarah di Baghdad dalam 18 bulan. PM Nuri al Maliki, Rabu malam, berikrar akan merombak keamanan negara itu sementara Menteri Luar Negeri Hoshyar Zebari, yang kompleks kementeriannya termasuk di antara gedung yang jadi sasaran, mengatakan ada “pelanggaran keamanan yang serius”. Ledakan itu terjadi berselang beberapa menit di dekat kementerian pemerintah sementara sebuah bom mobil dan serangkaian serangan mortir menambah pembunuhan di ibu kota itu, yang telah berada dalam kontrol keamanan Irak sejak pasukan Amerika Serikat ditarik dari berbagai kota di negara yang porak poranda akibat perang itu pada akhir Juni lalu. Al Maliki berembuk dengan para pejabat intelijen dan keamanannya,Rabu,danmembuatsejumlah“keputusandanpenting dan tindakan segera disepakati menyangkut keamanan dan kestabilan di Baghdad”, kata kantornya dalam sebuah pernyataan.

3 Makkah Siapkan Diri Sambut Jamaah Umrah Bulan Ramadan BULAN Ramadan besok tiba. Bagi mereka yang ingin mendapatkan berkah bulan suci itu, tentu mereka memikirkan apa yang harus mereka lakukan bersama Ramadan. Mereka amat berbahagia dengan datangnya Ramadan yang dinanti-nantikan.Banyak orang yang tidak menyangka mereka akan dapat bertemu lagi dengan Ramadan dan mereka akan menyatakan syukurnya kepada Allah Subhana Wata’ala yang telah memberi kesempatan bertemu lagi dengan bulan yang penuh berkah itu. Di Makkah sendiri, semua departemen pemerintah telah siap untuk menyambut datangnya bulan suci Ramadan. Para pejabat di kota suci itu telah pula menyiapkan penyambutan bagi kedatangan para jamaah Umrah dan pengunjung lainnya yang membanjiri Makkah dari berbagai penjuru dunia selama sebulan itu. Kepresidenan Umum Urusan Dua Masjid Suci memulai satu rencana yang menyeluruh untuk memberikan suasana tenteram bagi para jamaah di Masjidil Haram dan kawasan sekitarnya. Kepresidenan itu mengatakan pihaknya bekerja sama dengan badan-badan terkait guna mengatur arus jamaah yang keluar dan masuk ke dan dari Masjidil Haram. Kementerian Urusan Islam telah mengerahkan semua sumber daya manusia dan materialnya untuk menyambut para tamu. Sementara itu, Pertahanan Sipil telah menyiapkan sebanyak 4.000 petugas dan teknisi dalam menyambut Ramadan. Sesuai dengan rencana itu, Makkah dibagi menjadi sembilan wilayah untuk membantu pengaturan seandainya terjadi hal-hal darurat. Menurut Direktur Pertahanan Sipil Kol. Jameel Muhammad Omar Arbaeen, Pertahanan Sipil saat ini memiliki 61 unit pemadam kebakaran, 31 unit pertolongan, 480 patroli keamanan, 11 tim bantuan cepat, 10 tim evakuasi dan delapan unit pemantau untuk memeriksa polusi di dalam terowongan-terowongan di kota. Kol. Arbaeen mengatakan Pertahanan Sipil memiliki 280 unit bantuan cepat yang dilengkapi dengan alat pemadam kebakaran dan alat

penyelamatan. “Mereka akan bekerja sepanjang waktu dan akan siap bergerak setiap saat untuk memberikan pertolongan apa pun risikonya,” kata kolonel itu. Sejumlah helikopter dikerahkan untuk secara terus menerus terbang di atas kota Makkah guna menghadapi kemungkinan hal-hal darurat. “Sebanyak 15 stasiun kerja yang dijaga oleh lebih dari 350 paramedis terlatih telah diadakan di dalam Masjidil Haram guna menangani masalah darurat,” katanya. Sebanyak 30 tim pengintai telah didirikan untuk memeriksa keamanan di sejumlah hotel dan apartemen. Kesiapan itu bukan saja dilakukan lembagalembaga sipil, tetapi departemen keamanan pemerintah pun telah mulai melaksanakan berbagai rencana untuk memberikan keamanan dan keselamatan bagi para jamaah dan pengunjung. Para personil keamanan juga telah dipanggil dari berbagai kawasan untuk bekerja di Makkah selama Ramadan. Keamanan telah pun diperketat di kawasan Masjidil Haram dan jalan-jalan besar menuju ke arah sana. Polisi lalulintas juga menyiapkan dirinya guna dapat menjamin arus lalulintas dapat berjalan mulus di dalam Makkah dan jalanjalan menuju ke kota suci itu. Sebanyak 86 perwira dan 3.180 prajurit dibantu dengan 250 mobil dan sepedamotor akan bekerja sepanjang waktu. Halaman parkir khusus telah disediakan untuk para pengunjung yang datang dari luar Makkah sehingga mereka tidak perlu bersusah payah memarkir kendaraannya. Pemko Makkah juga telah menyelesaikan rencana untuk membersihkan kota suci itu, menetapkan standar tinggi bagi kesehatan lingkungan dan memantau toko-toko dan restoran-restoran. “Kami telah menyelesaikan semua sistem perlampuan dan pengaspalan. Kami telah membuat lagi toilet tambahan,” kata Dr. Osama bin Fadl Al-Baz, walikota Makkah. Perusahaan angkutan umum Saudi (Saudi Public Transport Company = SAPTCO) telah pula menyelesaikan berbagai penataan untuk menyediakan angkutan sepanjang waktu dari dan ke Masjidil Haram. (an/mujo)

Agenda

4

WASPADA, Jumat 21 Agustus 2009

Studi: Mozart Meninggal Akibat Infeksi Tenggorokan

Wolfgang Amadeus Mozart/topnews.in

Wolfgang Amadeus Mozart, komposer berusia 35 tahun, meninggal pada 5 Desember 1791, dan satu surat kabar Berlin, Jerman, memerlukan waktu satu pekan untuk mengumumkan bahwa ia telah diracuni. Penyebab sesungguhnya kematian Mozart, menurut satu studi baru, mungkin telah disebabkan sesuatuyanglebihsederhana: infeksi tenggorokan disebabkan bakteri streptokokus. Kini beberapa peneliti menulis di dalam “The Annals of InternalMedicine”,terbitanSelasa, telah melakukan analisis epidemiologi menyatakan ia adalah korban infeksi wabah strepto-

kokus. Kematian secara rutin dicatat di Wina pada Abad 18, tapi para dokter tak diharuskan menyebutkan penyebabnya, yang biasanyadiberikan keluargaataupenulis melakukan pekerjaan menulis. Semua catatan itu telah bertahan hingga sekarang, dan para peneliti memanfaatkannya untuk menyelidikipolakematianselama beberapa bulan seputar penyakit merenggut nyawa Mozart —November dan Desember 1791 dan Januari 1792— dan membandingkannya dengan pola pada masa yang sama beberapa tahun sebelum dan sesudahnya. Para ilmuwan menemukan

5.011 kematian orang berusia 18 tahun dan lebih selama sembilan bulan. Penyebab paling umum ialah tuberkulosis, kekurangan gizi, edema (pembengkakan ja-ringan di bawah kulit), penyakit gastrointestinal dan penyakit cerebrovascular, gangguan pembuluhdarahyangmengakibatkan stroke. Tetapi pada musim dingin 1791-92, edema adalah satusatunya penyebab memperlihatkan peningkatan peristiwa di kalanganpemudadibandingkandengan beberapa tahun lain, sehingga menunjukkan adanya wabah kecil penyakit menular. Ede-

ma juga berkaitan dengan penyakit jantung dan ginjal kronis tertentu, tapi penyakit yang diderita Mozart menyerang secara tiba-tiba. Selainedema,Mozartmengalami tidak enak badan, nyeri punggung dan bintik merah pada kulit, semua gejala infeksi streptokokus.Streptokokuskadangkala diikuti penyakit ginjal akut disebut glomerulonephritis, menjelaskan pembengkakan parah yang dialami saudari-ipar Mozart, kata Dr Richard H.C. Zegers, ahli ophthalmologi di University of Amsterdam, pemimpin penulis studi itu.(ant)

kanmu maupun Kau Masih Kekasihku. Sebelum membawa NAFF ke Tebingtinggi, Anak Medan Production bersama X Mild juga lebih dahulu menggetarkan penggemarnya di Medan, selanjutnya mereka meneruskan perjalanan ke Bagansiapi-api. Di Tebingtinggi, NAFF tampaknya memang sudah ditunggu penggemarnya, karena sejak lama Ady dan teman-teman sudah meracuni penggemarnya lewat lagu-lagu mereka. Terbukti sepanjangkonserberjalan,hampir semua lagu dibawakan NAFF mampu diikuti ribuan penggemarnya. Ady sendiri merasa bangga dan berkali-kali mengacungkan jempolnya terhadap apresiasi diberikan penggemarnya di Tebingtinggi. Dia sendiri tidak menyangka begitu besar animo

masyarakatTebingtinggiterutama anak mudanya menikmati suguhan musik mereka bawakan. Dan lagu paling ditunggu fans NAFF diTebingtinggi tak lain adalah Akhirnya Kumenemukanmu, Kau Masih Kekasihku sampai Terendap Laraku. Di konsernya di Stadion Durian Tebingtinggi, Ady layaknya memimpin lomba karaoke raksasa, karena sebait syair lagu dinyanyikan langsung diikuti para penggemarnya secara serentak. Ferry Budiman Sumbayak yang ikut menyaksikan konser NAFF diTebingtinggi tak bisa menyimpan rasa bangganya melihat antusias diberikan anak muda kota ini. Dia berharap di masa mendatang bisa mendatangkan band-band ternama lainnya agar lebih menyemarakkan lagi perkembangan musik di Tebingtinggi.(m09)

Konser Melly Goeslaw Sepi

Ady NAFF ‘Kau Masih Kekasihku’

Wanted, Ajang Salman Khan Unjuk Suara

Salman Khan

PERNAH dengar suara Salman Khan ketika sedang menyanyi? Sepuluh tahun setelah pertama kali membawakan sendiri sebuah lagu, Salman kembali memperdengarkan suara merdunya dengan menyanyikan Most Wanted Track untuk film terbarunya Wanted. “Tembang itu bagian khusus dari Wanted. Kami ingin membuat sesuatu yang istimewa bagi Salman dan idenya adalah menciptakan satu tembang sehingga para penonton merasakan itulah

Dicari Penari Moonwalker Mirip Michael Jackson Aksi tarian moonwalker diperagakan mendiang Michael Jackson memang mempesona. Walau banyak menirukannya, namun tak ada yang benar-benar identik. Kini sebuah program acara akan mencari penari moonwalker yang bisa benar-benar mirip dengan MJ. Adalah stasiun televisi Inggris, BBC Channel, akan menayangkan program tersebut. Belum diketahui nama program acaranya, namun pihak BBC memastikan akan menjadikan keluarga Michael Jackson sebagai salah satu jurinya. “Keluarga akan diberikan kesempatan menjadi bagian acara ini. Nama Jermaine Jackson dan La Toya Jackson sepertinya ideal,” jelas seorang sumber BBC enggan disebutkan namanya seperti dikutip dari Contact Music, Kamis (20/8). Acara itu disebut-sebut akan berformat mirip dengan American Idol. Ada proses audisi menjadi ‘reality show’ tersendiri. Juga ada acara konser penyisihan para finalis yang terpilih. Para peserta diaudisi sebagian besar diperkirakan berasal dari tanah Inggris Raya. Namun tak menutup kemungkinan warga di luar Inggris terlibat, hanya saja mereka harus rela merogoh koceknya untuk terbang ke Negeri Tiga Singa tersebut.(dth)

AMP Sukses Gelar Konser NAFF Di Tebingtinggi Anak Medan Production (AMP) bersama Club Mild sukses menggelar konser grup band NAFF di Stadion Durian Tebingtinggi Selasa (18/8) malam lalu. Ribuan penggemar mereka tampak larut dalam alunan musik dibawakan NAFF lewat tembang-tembang sudah tak asing lagi di telinga penggemarnya. NAFF digawangi Ady-vokal, Dedi-gitar, Odeu-bass, Hilaldrum dan Ade-gitar tergolong grup musik mampu menjaga keutuhannya lewat lirik lagunya sangat menyentuh. Ditengah gempuran bandband pendatang baru, namun NAFF band asal Bandung ini tetap berkibar setelah sempat vakum selama tiga tahun. Isyarat Hati (2006) menjadi tonggak kebangkitan mereka keatas panggung musik di tanah air lewat hitsnya Akhirnya Ku Menemu-

Jacko/dth/ist

inti film tersebut. Jadidengan menonton film itu, Anda tidak hanya mendengarkan dialog dari mulut Salman tapi juga menikmati tembang yang dinyanyikan sepenuh hati,” kata Sajid-Wajid, duo komposer tembang itu kepada IANS. Di tahun 90-an, tiga pemuda bermarga Khan mencoba kemampuan mereka dalam olah vokal. Aamir Khan sukses dengan tembang Aati kya Khandala dalam film Ghulam di tahun 1998, Shah

Rukh Khan pernah menyanyikan lagu -Apun bola untuk film Josh dan Salman muncul dengan tembang hit Chandi ki daal par dalam Hello Brother di tahun 1999. Most Wanted Track sudah mulai diputar dan jika tembang berdurasi 60 detik itu menjadi ukuran, maka film produksi Boney Kapoor itu diramalkan bakal jadi film sukses. “Salman Khan dikenal sebagai aktor yang bermain sepenuh hati. Wanted sepertinya menjadi film di

mana dia kembali ke filmfilm full action setelah lima tahun dirilisnya Garv – Pride And Honor,” kata seorang pelaku film. Diproduksi Boney Kapoor, Wanted disutradarai oleh Prabhu Deva dan menampilkan Ayesha Takia Azmi sebagai lawan main Salman Khan. Film itu juga dibintangi Mahesh Manjrekar, Asseem Merchant, Mahek Chhal dan Prakash Raj bersama Anil Kapoor yang muncul dalam tampilan khusus. Syafri.

Meski konsernya agak sepi, Melly Goeslaw tak ambil pusing. Melly lebih senang ditonton sepuluh orang tapi memiliki niat untuk menikmati penampilannya. Sebelumnya target penonton konser Melly sebanyak 3500 orang. Namun dalam konsernya pada Rabu Melly Goeslaw/dth (19/8) malam Tennis Indoor terasa lengang tak berdesakan. Begitu juga terlihat di VIP, masih banyak tempat duduk yang kosong. “Tadinya estimasi saya cuma ditonton sama dua orang, eh ternyata lebih,” canda Melly saat jumpa pers setelah konser di Tennis Indoor, Senayan, Jakarta Selatan, Rabu (19/8) malam. Pelantun ‘Gantung’ itu menganggap kesuksesan sebuah konser justru tak dilihat dari jumlah penontonnya. Menurutnya, kualitas konsep dan totalitas produksilah yang bisa dijadikan tolak ukur. “Saya lebih baik ditonton sama sepuluh orang tapi niat nonton saya, daripada dua ribu orang tapi drama semua nonton saya,” kata Melly yang saat itu didampingi Krisdayanti. Dalam konsernya bertajuk ‘Glow’ itu, Melly mengaku kurang puas dengan penampilannya. Hal itu dikarenakan ada ide-idenya yang tak terwujud, seperti menghadirkan harimau. (dth)

Gaung Cinta Positif Lovarian Band REPUTASI kota Malang sebagaigudangmusisibertalenta besar yang diringi atmosfir pertumbuhan pesat grup musik baru dari waktu ke waktu, kembali terbukti lewat geliat Lovarian. Band pop rock terbentuk di sebuah kampus kota Apel tahun 2003 digawangi Imunk [gitar], Rama [gitar], Abdee Ridho [drum], Ozzy [bass] dan Virgy [vokal] ini sepakat menggaungkan makna cinta posifit lewat debutalbummerekabertital“Generasi Cinta”. “Sesuai panji Lovarian berarti orang-orang selalu berkecim-pung dalam cinta, lewat debut album bernuansa pop rock kami berlima pun

07.30 Siapa Lebih Berani 11.00 Silet 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Hits 15.00 Cek & Ricek 15.30 OB Shift 2 16.00 Duit Kaget 16.30 Bedah Rumah 17.00 Seputar Indonesia 17.30 Boim Anak Sholeh 18.00 Manohara 19.00 Cinta Dan Anugerah 20.00 Grand Final The Master 00.00 Seputar Indonesia Malam 00.30 UEFA Champions League 02.00 Dahsyatnya Sahur 04.00 Tak Ada Yang Abadi Spesial Ramadhan

CATATAN

sepakat lebih meng-gaungkan tema cinta positif.Yakni cinta yang universal, mulai cinta kepada lawan jenis, cinta terhadap orangtua dan keluarga, teris-timewa kepadaYang Maha Kuasa,” papar Virgy, vokalis Lovarian band kepadaWaspada di Jakarta, barubaru ini. Diakuinya,takmudahmemadukan lagu bertema universal dengan musik pop rock. Namun, berkat kesamaan visi dan selera bermusiksemuapersonelnyadan jam terbang manggung - kendala tersebut pun berubah menjadi kekuatan dan daya tarik tersendiri bagi band kami. “Maklum, kami terinfluence sejumlah band besar kelas dunia

07.30 Musik : Inbox 09.30 Hot Shot 10.00 Sinema Pagi 12.00 Liputan 6 Siang 12.30 Luping 13.30 Kasak Kusuk 14.00 Playlist 16.00 Kepompong 17.00 Liputan 6 Petang 17.30 Uya Emang Kuya 18.00 Lemon Tea 19.00 Melati Untuk Marvel 20.30 Cinta Fitri 21.30 Terlanjur Cinta 22.30 Gala Sinema 01.00 Buser 02.30 Para Pencari Tuhan 04.00 Cinta Juga Kuya

semacam Matchbox Twenty, Maroon 5, Muse dan band-band pengusung genre British lainnya. Namun, untuk menjadi diri sendiri agar bisa eksis dan berkibar di blantika musik nasional, Lovarian pun melakukan penajaman sisi musikalitas. Lewat penggalian-penggalian secara otodidak sambil bertualang di pentas hiburan live,” terang Virgy. Pasca terbentuk enam tahun silam,segalausahakerasdangigih dilakukan Lovarian untuk menggapai cita-cita. Manggung dari kampus ke kampus, cafe to cafe, TV lokal, event-event radio hingga mengisi soundtrack di beberapa film independent produksi filmmaker asli Malang mulai

07.00 Masquerade 07.30 Layar Pagi 09.30 Cerita Pagi 10.30 Kribo 11.00 Sidik 12.00 Layar Kemilau 13.30 1001 Cerita 15.30 Casper 17.00 Ninja Warrior 18.00 Ben 7 19.00 Mukjizat Cinta 21.00 Sinema Asyik 22.00 Curhat Bareng Anjasmara 23.00 Republik Cinta 00.00 KehendakMU 01.00 Cerita Dinihari 02.00 Hur, Sahur! 04.00 Ngelaba

tahun 2005. Tawaran mengisi kompilasi pernah juga menyambangi Lovarian dan menjadikan mereka salah satu band terbaik di Malang. Dan berbekal jam terbang manggung di atas rata-rata band baru, langkahVirgy-Imunkdankawankawan menembusindustrimusik nasional pantas dicontoh bandband baru asal luar ibukota terutama asal Medan. “Sebagai musisi, kami tak hanya ingin menjadi jago kandang dan hanya dikenal di Malang saja. Kami juga ingin menjadi band yang dikenal secara nasional,” harap Imunk. Setelah sempat mengalami berbagai dinamika dalam tubuh band, titik terang pun mengiringi

07.00 Pororo 07.30 Dino Babies 08.00 Star Kids 09.00 Espresso 10.00 Heboh 11.30 Topik Siang 12.00 Musik : Klik 13.30 Transformer 14.30 Anak Alam 15.00 Topik Petang 15.30 Mantap 17.00 SBY 18.30 Lift Seru 19.00 Segeerrr.. 20.00 4 M Makin Malam Makin Mantap 21.30 Tawa Sutra 23.00 Fakta 00.00 Topik Malam 00.30 Lensa Olah Raga 01.00 Kungfu Komeng 02.00 Happy Sahur 04.00 Cahaya Hati

07.00 KiSS Vaganza 08.30 Halo Polisi 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 Intan 15.00 KiSS Sore 15.30 FS Boy Before Flowers 17.00 Kasih Dan Amara 18.00 Tangisan Isabella 19.00 Jiran 20.00 Inayah 22.00 Take Me Out Indonesia 00.00 FS The Hospital 01.00 Fokus Malam 01.30 Muslimah 02.30 Anak Membawa Berkah

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

langkah Lovarian menembus atmosfer musik nasional. Produser Goodfaith Production yang bermarkas di Jakarta dan sebelumnya sukses meluncurkan album “Rectoverso” Dewi Lestari, tertarik untuk memproduksi debut album mereka. Dengan semangat tinggi dipunyai, cuma butuh beberapa bulan untuk menyelesaikan 12 lagu berkualitas yang bergenre pop rock. “Kami memilih jalur pop rock dengan harapan, cinta yang ditebarkan lewat lagu-lagu kami, bisa diserap dengan cepat oleh para pendengar,” bilang Abdee, sang penggebuk drum. * (AgusT)

07.05 Indonesia This Morning 07.30 Metro Xin Wen 08.05 Climate Challenge’ 09.05 Archipelago 10.05 Dunia Kita 10.30 Chat Club 12.05 Metro Siang 13.30 Just Alvin 14.30 Metro Sore 15.05 Bisnis Hari Ini 16.05 Inside 16.30 Inspirasi Ramadhan 17.05 Ensiklopedia 19.05 Suara Anda 20.30 Special Dialogue 21.05 Top Nine News 21.30 Kick Andy 23.05 Secret Operation 23.30 Metro Sports 00.05 Metro Malam 03.05 Tafsir Al Mishbah 04.05 Sukses Syariah

07.30 Musik Derings 09.00 Jail 09.30 D Show 10.30 Jelang Siang 11.00 Insert 12.00 Reportase 12.30 Missing Lyrics 14.00 Bioskop Indonesia Siang 16.00 Insert Sore 16.30 Orang Ketiga 17.00 Reportase Sore 17.30 Kado Istimewa 18.00 Suami Suami Takut Istri 19.00 Bioskop Trans TV 21.30 Bioskop Trans TV 23.00 Bioskop Trans TV 02.00 Sketsa Ramadhan 02.30 Saatnya Kita Sahur

Lovarian Band

09.00 Kabar 9 09.30 Kabar Pasar 10.00 Pariwara 11.00 Opini 12.00 Kabar Siang 13.00 Keliling Indonesia 13.30 Expose 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Telusur 16.30 Kabar Warga 17.00 Kabar Pemilu 17.30 Kabar Petang 19.00 Catatan Hukum Bang One 19.30 Negeri Impian 22.00 Jalur 259 23.00 Di Balik Tragedi 23.30 Kabar Arena 00.00 Kabar Malam 03.30 Titian Kalbu

07.00 Avatar 08.00 Dora Explorer 09.00 Obsesi 10.00 MTV Gaya Bebas 11.00 MTV Ampuh 12.00 Abdel & Temon 13.00 Global Siang 14.00 Transformers 14.30 Kabayan Lip Lap 15.30 Bukan Sinetron 16.30 Berita Global 17.00 Spongebob 18.00 Bukan Sinetron 19.30 Lutuna 20.00 Big Movies 22.00 Big Movies 00.00 TBA 00.30 Global Malam 01.00 MTV Insomnia Ngajak Sahur 04.00 Jejak Sang Khalifah

07.30 I Gosip Pagi 08.00 Selamat Pagi 09.00 Ngelenong Nyok 10.00 TKP 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 14.00 Cita Cita 14.30 Dunia Air 15.30 Asal Usul Flora 16.00 Jejak Petualang 16.30 Redaksi Siang 17.30 Rahasia Sunnah 18.00 Jumatnya Wara Wiri 18.30 On The Spot 20.00 Opera Van Java 21.00 OKB 22.00 Mister Tukul 23.00 Black In News 23.30 Begadang 00.30 I Gosip

**m30/B

Nusantara

WASPADA Jumat 21 Agustus 2009

5

Pemilihan Gubernur Kembali Ke DPRD, Kemunduran JAKARTA (Waspada): Adanya usulan untuk mengembalikan pemilihan gubernur ke DPRD , jelas merupakan kemunduran dalam proses demokrasi di Indonesia sekaligus melemahkan ‘posisi politik’ gubernur, kata anggota Komisi II DPR-RI Ferry Mursydan Baldan. Menjawab Waspada,Kamis (20/8), di gedung DPR Jakarta, Ferry mengatakan, jika pelemahan itu terjadi. maka akan melahirkan suatu rentang pemerintahan yang terlalu luas, dan menjadikan pemerintahan yag tidak efektif. Tetapi hal yang harus dilakukan , menurut Ferry, bagaimana evaluasi terhadap pelaksanaan pemilihan gubernur sebagai bagian dari pemilihan kepala daerah (pilkada). Dia berpendapat, jika efisiensi kebutuhannya, maka diperlukan langkah untuk menyederhanakan jadwal pelaksanaan pilkada, misalnya tiap kurun waktu 5 tahun (2009-2014) hanya ada 2 hari untuk pelaksanaan pilkada. Jika untuk efektivitas pemerintahan (provisi dengan kabupaten/kota), jadwal pemilihan kepala daerah ( pilkada) untuk gubernur dan bupati/walikota diserentakkan seluruh Indonesia, dengan masa transisi untuk kurun waktu 2009-2014. Daripada mengubah pemilihan gubernur kembali ke DPRD, akan lebih baik mereformulasikan, bagaimana mengefisienkan proses pilkada, dan bagaimana mengefektifkan pemerintahan pasca pilkada, tanpa harus menimbulkan implikasi yang luas terhadap bentuk pemerintahan, ujar Ferry. Dari segi waktu, jika tidak mungkin melalui revisi UU, bisa ditempuh melalui Perppu dengan pembicaraan awal antara Presiden dengan DPR, khususnya yang berkaitan dengan pengangkatan pejabat sementara terhadap kepala daerah yang habis masa jabatannya. ‘’ Substansi pengaturan lebih lanjut tentu dengan revisi UU Pemda oleh DPR periode 2009-2014., ‘’tandas Ferry Musydan Baldan.(aya)

Pria Mengaku Noordin Diperiksa Densus 88 SAMARINDA (Antara): Roni Pranata, 18, pria yang ditangkap anggota Polsekta Sungai Kunjang, Samarinda, Rabu (19/8), karena mengaku sebagai teroris Noordin M Top, masih menjalani pemeriksaan intensif oleh Detasemen Khusus (Densus) 88 Polda Kaltim. “Kasus ini telah kami serahkan ke Densus 88,” ungkap Kapolsekta Sungai Kunjang, Ajun Komisaris Erlan Munaji kepada Antara di Samarinda, Kamis (20/8). Hingga Kamis sore, dua anggota Densus 88 terlihat masih terus melakukan pemeriksaan terhadap pemuda tanggung yang merupakan warga di Jl KH Harun Nafsi, Samarinda Seberang itu. Roni terlihat lesu saat menjalani pemeriksaan di salah satu ruang Mapolsekta Sungai Kunjang sejak pagi hingga sore. “Dia (Roni) mengaku sangat menyesali perbuatannya melakukan tindakan yang sangat meresahkan warga, khususnya kepada teman dekatnya yang ia kirimi pesan singkat,” ungkap seorang anggota Polsekta Sungai Kunjang. Terungkapnya kasus itu bermula dari laporan Septy Wiyana (17), warga Jl Flamboyan, Sungai Kunjang ke Polsekta Sungai Kunjang, Rabu (19/8) sore. Wanita yang menjadi teman dekat Roni Pranata itu mengaku menerima sebuah SMS dari seseorang yang mengaku sebagai buronan teroris yang paling dicari polisi, Noordin Moh Top. Dalam SMS tersebut, orang yang mengaku Noordin itu mengajak Septy Wiyana menjadi “pengantin” (pelaku bom bunuh diri) untuk meledakan Samarinda Central Plaza (SCP). SeptyWiyana kemudian melaporkannya ke Pos Polisi Loa Buah selanjutnya meneruskan laporan itu ke Polsekta Sungai Kunjang. “Pelaku (Roni) mengaku hanya iseng mengirimkan SMS itu kepada Septy Wiyana. Dia mengaku, telah menaruh hati kepada wanita itu sejak duduk di bangku SMU, namun sampai sekarang belum mendapat jawaban,” ungkap seorang anggota penyidik Polsekta Sungai Kunjang. Kepada polisi, Roni Pranata mengaku tidak menduga jika perbuatannya tersebut berakibat fatal. “Pelaku ditangkap setelah sempat dipancing untuk menemui Septy Wiyana. Dia diminta datang ke Pos Polisi Loa Buah dan ternyata selang beberapa menit kemudian Roni Pranata langsung kami tangkap,” ujar polisi tersebut.

Polisi Periksa 17 Warga Negara Filipina SOLO (Antara): Kapolda Jawa Tengah Irjen Polisi Alex Bambang Riatmodjo mengatakan, sebanyak 17 warga negara Filipina sedang menjalani pemeriksaan atas dugaan penyalahgunaan visa kunjungan. “Mereka masuk ke Indonesia dengan menggunakan kunjungan bebas visa atau kunjungan singkat yang sesungguhnya untuk wisata,” kata Alex Bambang Riatmodjo usai acara serah terima jabatan (sertijab) Kapolwil Surakarta di Solo, Kamis (20/8). Namun, ia mengatakan, warga Filipina itu di Solo melakukan kegiatan diskusi dan ceramah di masjid-masjid di wilayah itu. Padahal, visanya adalah untuk kunjungan wisata. Kapolda menjelaskan, sembilan orang warga negara Filipina ini datang dari Jakarta dengan menumpang kereta api menuju Banyumas. Sementara delapan orang lainnya ke Solo. “Mereka datang ke Indonesia tidak ada yang mengundang. Kami masih mendalami kegiatan apa yang dikerjakan mereka,” kata Kapolda. Pihaknya sudah meminta bantuan dengan menghubungi Kedutaan Besar Filipina di Jakarta untuk melakukan mengecekan kepada 17 orang itu. Menurut Kapolda, pada hakekatnya Negara Indonesia adalah negara hukum, jika warga asing yang masuk di Indonesia harus mematuhi hukum di negara ini. “Kita ada UU keimigrasian dan mereka harus mematuhi hukum di negara ini. Mereka baru kita dengar keterangannya,” katanya. Apalagi, kata dia, sekarang ini sedang hangatnya mencari daftar pencarian orang (DPO), terkait jaringan terorisme di wilayah Jawa Tengah. Sementara Kapoltabes Surakarta Kombes Pol Joko Irwanto mengatakan, delapan warga negara Philipina yang berada di Solo, sekarang sedang menjalani pemeriksaan di Polda. Mereka dijemput di Masjid Animah di Tanjunganom, Serengan Solo dan mengaku dari kelompok bernama “Jaullah” dan mereka melakukan kegiatan berdakwah ke masjid-masjid di wilayah Surakarta seperti, Solo, Karanganyar, Sragen, dan Boyolali, kata Joko.

Presiden Harus Sikapi Dugaan Pelanggaran Kode Etik Oleh Hakim Agung

Antara

RAZIA MAKANAN: Petugas menata sejumlah produk makanan bermasalah yang disita dalam razia gabungan di ruang data Direktorat Reserse Kriminal Khusus, Polda Metro Jaya, Jakarta, Kamis (20/8). Razia itu dilakukan di sejumlah pusat perbelanjaan modern ibukota guna memberi rasa aman bagi konsumen menjelang bulan puasa.

JAKARTA (Waspada) : Presiden Susilo Bambang Yudhoyono harus menyikapi dugaan adanya pelanggaran kode etik dilakukan Hakim Agung, karena menerima Peninjauan Kembali (PK) yang diajukan oleh jaksa dalam kasus cessie Bank Bali. “Solusinya presiden diminta memberi masukan kepada MA dan memanggil Jaksa Agung,” tegas mantan jaksa, John H. Waliry dalam diskusi yang digelar wartawan unit MPR/DPR dengan tajuk ‘Kontroversi PK Jaksa ‘ di gedung MPR/DPR, Jakarta, Kamis (20/8). Dia berpendapat, jika Presiden tidak turun tangan, tidak akan ada perubahan atau perbaikan terhadap putusan MA menerima PK jaksa tersebut yang dianggap telah menyalahi prosedur hukum. Sedangkan, anggota Tim Perumus RUU KUHAP, Tengku Nasrullah menyatakan setuju, jika presiden dilibatkan dalam kasus dugaan pelanggaran prosedur hukum oleh MA dengan memanggil hakim agung dan Jaksa Agung. Namun, dia menyarankan keterlibatan presiden kapasitasnya bukan sebagai kepala pemerintahan, tetapi sebagai kepala negara. “Kalau presiden dalam kapasitas sebagai kepala pemerintahan nanti dampaknya lebih parah lagi, nanti dibilang eksekutif telah ikut campur dalam tindakan-tindakan yudikatif, itu kan tidak boleh tapi kalau presiden kapasitasnya sebagai kepala negara di Indonesia ini tentunya membawahi eksekutif, legislatif dan yudikatif,” tuturnya. Secara terpisah, anggota Komisi III DPR dari Fraksi PDI Perjuangan, Eva Kusuma Sundari berpendapat keputusan Mahkamah Agung (MA) menerima usulan Peninjauan Kembali (PK) dari jaksa sarat muatan politis. Dia menduga motif pengajuan PK oleh kejaksaan ke MA didasari adanya kepentingan pihak tertentu. “Jaksa sudah berpolitik, ada pihak-pihak yang bermain dalam isu ini,” tandas Eva, dan menyarankan jika sudah ditemukan dugaan pelanggaran tersebut, sebaiknya KY segera membawa kasus ini ke dewan kehormatan.”Saya kira kalau sudah ditemukan ya dibawa saja,” ujarnya.(aya)

Mendagri Instruksikan Nama Baik Pembuatan KTP Diperketat Pencemaran Tak Perlu Hukuman Penjara BANDUNG (Antara): Menteri Dalam Negeri (Mendagri) Mardiyato menginstruksikan kepada jajarannya di daerah agar memperketat pembuatan Kartu Tanda Penduduk (KTP) sebagai langkah antisipasi penyusupan para pelaku terorisme.

KA Barang Anjlok, Ribuan Penumpang Terlantar LEBAK (Antara): Ribuan penumpang kereta api di Stasiun Rangkasbitung, Banten, menyusul terganggunya perjalanan kereta api akibat anjloknya kereta api pengangkut batu bara di kilometer 66+300 antara Stasiun Citeras-Maja. Kepala Stasiun KA Rangkasbitung, Kabupaten Lebak, Suwandi, Kamis, mengatakan, selama empat jam lebih penumpang KA RangkasbitungJakarta mengalami hambatan akibat anjloknya KA Barang yang mengangkut batu bara dari Cigading-Bekasi. Peristiwa anjlok KA barang tersebut, terjadi sekitar pukul 10:30 dan baru normal kembali pukul 14:30 setelah didatangkan petugas dari Depo Rangkasbitung. Menurut dia, anjloknya KA Barang itu maka dua Lokomotif B 872 jurusan RangkasbitungSenen dan Rangkasbitung-Jakarta dengan Lokomotif 872 terganggu keberangkatannya. Oleh karena itu, penumpang yang hendak menuju jurusan Stasiun Senen diharapkan naik angkutan kota di Sta-siun Maja. Sedangkan, KA Rangkasbitung-Jakarta terpaksa dibatalkan karena terhalang KA anjlok tersebut. Selain itu, pihaknya juga mengimbau penumpang yang batal dan sudah membeli tiket untuk menukarkan kembali atau menunggu normal kembali. Dia menyebutkan, akibat peristiwa itu dipekirakan ribuan penumpang KA di Stasiun Rangkasbitung menumpuk dan baru bisa diberangkatkan sekitar pukul 16:00. “Saat ini penumpang KA sudah diangkut menuju tujuan masing-masing,” katanya.

“Pemerintah daerah agar memperketat pembuatan KTP dan kartu keluarga, bila tidak dikenal harus dipastikan jelas asal usulnya dan jangan sampai kelemahan itu dimanfaatkan oleh teroris untuk mengganti jati dirinya,” kata Mandagri di sela-sela Rakor Kewaspadaan Dini Masyarakat dan Penanganan Terorisme tingkat Jabar, Kamis (20/8). Mendagri menyebutkan, sebelum berlakunya KTP nasional dengan sistem administrasi kependudukan yang tunggal dengan satu nomor induk kependudukan, ia berharap layanan pembuatan KTP di tingkat kecamatan lebih selektif, persyaratannya optimal dan jelas asal usulnya. Ia menyebutkan KTP nasional dengan satu nomor induk kependudukan baru bisa digulirkan pada 2011. Diakuinya KTP saat ini berbeda-beda di tingkat daerah dan nomor induk kependudukannya belum terhubung secara online. “Selagi KTP nasional belum berlaku, kami berharap pembuatan KTP diperketat, terutama bagi mereka yang tidak jelas asal-usulnya. Pastikan sampai lengkap dulu. Jangan sampai kasus yang sudah-sudah terulang lagi,” kata Mendagri. Ia berharap dari sisi pen-

dataan kependudukan, bisa melakukan deteksi dini terhadap orang-orang yang dicurigai baik gerak gerik maupun fotonya. Menurut Mendagri, dalam dua tahun ini Depdagri punya gawe besar untuk menuntaskan sistem administrasi kependudukan tunggal secara nasional. “Sistem pendataan penduduk di desa-desa hingga RT/RW perlu dioptimalkan lagi, sehingga penduduk datang dan keluar terdata secara cermat,” katanya. Terkait pemberlakuan KTP nasional denga satu nomor induk kependudukan, diharapkan sudah bisa diterapkan pada 2011. Sebagai tahap awal akan dilakukan uji coba KTP nasional di empat kota dan satu kabupaten. Sementara itu, dalam Rakor Kewaspadaan Dini dan Penanganan Terorisme itu, Mendagri menekankan koordinasi antara pemerintah, TNI, Polri dan masyarakat dalam melakukan deteksi dini terhadap gejala-gejala yang mencurigakan dan diindikasikan aksi teroris. “Jangan anggap remeh informasi awal, masyarakat diharapkan responsif bila mendapati hal-hal aneh di lingkunganya, laporkan kepada pemerinta dan aparat keamanan sesuai dengan tingkatannya,” kata Mendagri.

Mendagri mememinta agar informasi sekecil apapun untuk segera dilaporkan karena sangat penting dan berarti untuk melakukan langkah dan kebijakan yang akan diambil oleh pemerintah dan aparat keamanan. “Aktifkan sistem pelaporan tercepat berjenjang atas perkembangan situasi dan kondisi daerah masing-masing. Laporan cepat terkadang suka dilupakan. Dengan laporan cetpat justru kesiagaan akan lebih cepat, pencegahanpun bisa dilakukan segera,” kata Mendagri. Sementara itu Gubernur Jawa Barat, H Ahmad Heryawan mengaku setuju dengan pengetatan dalam pembuatan KTP. Meski demikian bukan berarti mengurangi akselerasi dan pelayanan KTP dan kartu keluarga. “Pengetatan pembuatan KTP bukan berarti mengurangi pelayanan, yang jelas tertib administrasi ditingkatkan. Tujuannya baik dan kita harus membantu pemerintah,” kata Heryawan. Ia pun mengaku telah mengimbau kepada pemerintah daerah untuk meningkatkan pengetatan dan optimalisasi sistem pendataan penduduk baru dalam rangka antisipasi dini dan penanganan terorisme.

MAKASAR (Antara): Mantan Ketua Dewan Pers, Atmakusumah Astraatmadja menyatakan sebaiknya perundang-undangan tentang pencemaran nama baik tidak usah mencantumkan hukuman badan atau kurungan penjara. “Hukuman penjara dapat mematikan masa depan tergugat pencemaran nama baik. Baik secara personal maupun institusi media,” katanya di depan peserta diskusi publik Kebebasan pers versus Pencemaran Nama Baik yang diselenggarakan Aliansi Jurnalis Independen (AJI) di Makassar, Kamis (20/8). Ia menjelaskan, selain hukuman penjara seperti yang tercantum di KUHP Pasal 310-311 serta Undang-Undang Informasi dan Transaksi Elektronik (ITE), pengenaan denda paling banyak Rp600 juta bagi tergugat dianggap tidak patut. Menurutnya, kedua jenis hukuman itu sebaiknya dihilangkan saja dan diganti dengan denda yang nilainya proporsional atau sesuai kemampuan ekonomi pelaku. Terlebih, saat ini kecenderungan hukum di beberapa negara maju sudah menghapuskan masalah pencemaran nama baik dalam perundang-undangannya. Bahkan beberapa negara miskin seperti Sri Lanka dan Kolombo juga menerapkan ketentuan hukum seperti itu dengan mengubahnya dari pidana ke perdata. Situasi yang sama terjadi juga di Timor Leste. Kendati tetap memberlakukan perundang-undangan Indonesia, namun Pasal 310 hingga 321 KUHP Pidana tentang penghinaan ditetapkan sebagai bukan tindak pidana. Ia menambahkan, jika tujuan pemenjaraan dan denda bernilai besar itu bisa membuat kebangkrutan bagi media, maka hal itu tak ubahnya dengan tindakan breidel atau penutupan usaha media yang dilakukan pemerintah pada era Orde Baru. Atmakusumah berpendapat, tak ada kerusakan permanen yang terjadi akibat pencemaran nama baik. Terlebih, ada mekanisme untuk menjawab sangkaan pemberitaan dengan hak jawab atau hak koreksi. “Menggunakan hak jawab sangat praktis dan bisa menyelesaikan persoalan hanya dalam satu hingga dua hari. Bayangkan jika harus menggunakan hukum, prosesnya bisa sangat lama,” katanya.

Sport

6

WASPADA Jumat, 21 Agustus 2009

Diagram I

Diagram II

Diagram III

Turnamen Catur Waspada Online Dan Menyimak Notasi Blackberry Laporan Jonny R Silalahi

Striker Atletico Diego Forlan menghindari tekel bek Panathinakos Kostas Katsouranis dalam duel di Athens Olympic Stadium, Kamis (20/8) dinihari WIB.

AP

Lyon,Atletico Makin Dekat Fulham 3 Tahun Ikat Duff FULHAM mengikat winger veteran Irlandia Damien Duff dari Newcastle United dengan kontrak tiga tahun tanpa menyebutkan harga transfernya. Dia langsung akan melakukan debut akhir pekan ini dalam derbi London melawan mantan klubnya, Chelsea. “Fulham tampil fantastik musim lalu dan saya paham dalam pembicaraan saya dengan pelatihnya beberapa waktu lalu dailymail bahwa klub itu berambisi meningkatkan peringkat mereka dan saya berada di dalamnya,” ucap Duff kepada AFP, Rabu (19/8). Duff disebut-sebut berharga sekitar empat juta pound dan manajer Fulham Roy Hodgson yakin uang itu akan terbayar dengan penampilan bagusnya. “Saya gembira mendapat pemain baru sekaliber Damien Duff. Saya sudah mengetahui Damien sejak dia masuk dalam tim inti Blackburn saat saya menjadi pelatih,” jelas Hodgson.

Liverpool Tes Medis Krygiakos LIVERPOOL menurut Reuters, Rabu (19/ 8), melakukan pemeriksaan medis terhadap pemain bertahan Yunani Sotiris Kyrgiakos dari AEK Athens. Bek yang sudah tampil dalam 49 laga internasional (caps) bagi Hellas itu, segera bergabung dengan The Reds sebagai klub keenamnya bila proses transfer berlangsung sportgate mulus sekaligus lolos tes medis. “Saya beritahukan kepada pendukung saya di AEK bahwa Senin malam saya menerima tawaran untuk bergabung dengan Liverpool. Tawaran itu saya terima,” beber bek berusia 30 tahun itu dalam laman www.kyrgiakos.gr.

LONDON (Waspada): Olympique Lyon semakin dekat ke babak grup Liga Champions untuk musim kesepuluh secara beruntun setelah melibas Anderlecht 51 pada leg pertama babak final playoff, Rabu (Kamis WIB). FC Zurich juga tampaknya akan bergabung dengan mereka setelah menang secara meyakinkan 3-0 dalam pertandingan tandang melawan juara Latvia Ventspils. Zurich sekarang tinggal menjalani90menitlagiuntukbisa kembali bermain di kompetisi elit Eropa ini untuk pertama kalinya sejak 28 tahun lalu. Atletico Madrid pun mendapat keberuntungan dalam pertandingan pertama dengan hasil menang 3-2 atas Panathinaikos di Athena. Begitu pula dengan juara Hongaria Debrecen yang mengalahkan Levski Sofia 2-1 dalam pertandingan tandangnya, serta Maccabi Haifa yang menang 2-1 dalam pertandingan tandang di Salzburg. Di Stade Gerland, Lyon yang

Hasil Rabu (Kamis WIB): FKVentspilsvsFCZurich 0-3 Levski Sofia vs Debrecen 1-2 OlympiqueLyonvsAnderlecht 5-1 PanathinaikosvsAtleticoMadrid 2-3 SalzburgvsMaccabiHaifa 1-2 Hasil Selasa (Rabu WIB): Glasgow Celtic vs Arsenal CopenhagenvsAPOEL Timisoara vsVfB Stuttgart Sheriff T vs Olympiakos Sporting vs Fiorentina

0-2 1-0 0-2 0-2 2-2

masuk babak kualifikasi Liga Champions untuk pertama kali sejak musim 2000-2001 dan dominasi mereka selama tujuh tahun di Liga Prancis berakhir Meilalu,tidakmembuang-buang waktu untuk mengontrol pertandingan dengan melesakkan gol-gol dari para pemain mereka yang baru dikontrak musim panas lalu. Pemainbeliadaritimnasional Bosnia, Miralem Pjanic, menyarangkan gol pertama Lyon lewat tendangan bebas yang mengejutkan pada menit kesepuluh sebelum striker baru asal Argentina Lisandro menggandakan keunggulan mereka lima menit kemudian lewat satu tembakan penalti. Michel Bastos mencetak gol

lewat tembakan kencang kaki kirinya sehingga membuat Lyon unggul 3-0 sebelum wajah baru lain, Bafetimbi Gomis, menambahkan gol keempar sesaat menjelang berakhirnya babak pertama.MatiasSuarezmencetak satu gol balasan bagi Anderlecht sebelum Gomis mencetak gol keduanya pada pertandingan malam itu untuk mengokohkan kemenangan Lyon. Zurich, lewat tembakantembakan akurat ke gawang lain dari Johan Vonlanthen, Silvan Aegerter dan Dusan Djuric, mengantarnya pada kemenangan yang sudah lama dinantikan 30 atasVentspils, sehingga mengakhiri harapan mereka untuk bisa menjadi klub pertama Latvia yang mencapai babak 32 besar. Di Athena berlangsung pertandingan terbaik dimana Maxi Rodriguez, Diego Forlan serta Sergio Aguero mencetak gol bagi Atletico, dengan Dimitrios Salpingidis dan Sebastian Leto melesakkan bola bagi Panathinaikos. Kemenangan Debrecen 21 atas Levski Sofia berarti mereka memilikipeluangyangbaikuntuk menjadi klub pertama Hongaria yang bisa mencapai babak 32 besar Liga Champions sejak Ferencvaros lolos ke babak itu pada 1995-1996. (h01/ant/rtr/uefa)

Bikey Rekrutan Ketujuh Burnley KLUB promosi Liga Premier, Burnley, mendatangkan bek Andre Bikey dari klub divisi satu Reading. Bek berusia 24 tahun itu menjalani tes medis, Rabu (19/8). Tanpa menyebutkan berapa nilai transfernya, Bikey rencananya akan meneken kontrak tiga tahun. Bikey merupakan rekrutan ketujuh Burnley, yang sebelumnya sudah memboyong Brian Easton, Richard Eckersley, David Edgar, Steven Fletcher, Fernando Guerrero dan Tyrone Mears.

Reuters

Van Der Vaart Pastikan Hengkang GELANDANG Belanda Rafael van der Vaart memastikan segera hengkang dari Real Madrid. “Pelatih mengatakan bahwa saya tidak lagi dibutuhkan, itu merupakan malam yang menyedihkan. Saya tidak pernah mengharapkannya dan saya sungguh kecewa,” ungkap Van der Vaart dalam Sportweek, Rabu (19/8). Van der Vaart diboyong Madrid dari realmadrid.com Hamburg tahun lalu, namun dia gagal menunjukkan kemampuan terbaiknya di Santiago Bernabeu. “Gabung Madrid pada musim panas 2008 seperti mimpi menjadi kenyataan bagi saya. Saya tidak ingin melewatkan itu, meski keadaan tidak pernah berjalan seperti yang saya harapkan. “Situasi di klub membuat saya tidak memiliki pilihan lain, namun saya tidak ingin gabung klub yang merekrut hanya karena saya target transfer yang murah. Saya ingin dibutuhkan lagi di klub baru saya,” tambah mantan bintang Ajax tersebut.

Barca, Real Rebutan Albert Riera BARCELONA dan Real Madrid dikabarkan, rebutan untuk membawa pulang winger Spanyol Albert Riera dari Liverpool. Menurut Daily Mirror, Rabu (19/8), Riera tidak lagi masuk dalam rencana manajer Liverpool Rafael Benitez. Itu yang membuatnya tidak dibawa The Reds ke markas Tottenham Hotspur, Sabtu lalu. Reuters El Barca dam El Real pun langsung menyambut kabar dimaksud dengan tawaran awal 8 juta euro atau sekitar Rp112 miliar. Selain kedua raksasa Spanyol tersebut, mantan pemain Espanyol dan Bordeaux itu juga diminati Atletico Madrid. (jonny/dari berbagai sumber)

DALAM permainan catur, banyak pemain membuat langkah-langkah blunder karena kurang konsentrasi atau suka buru-buru sehingga kurang teliti dalam defensif maupun ofensif. Langkah blunder itu terkadang tidak membahayakan pertahanan, tapi cukup sering berakibat pada pengorbanan pion atau perwira sia-sia dan akhirnya menjadi fatal. Demikianlahgambaranyang terjadi ketika berlangsungTurnamen Catur ‘Waspada Online; baru-baru ini di Hotel Garuda Plaza Medan, termasuk antara David Swayana dan Prabudi Said. David berhasil menjadi juara turnamen tersebut, sekaligus merebut trofi dan hadiah uang sebesar Rp1 juta. Untuk merebut hadiah yang lebih tinggi, yakni sebuah Blackberry, sang juara dipertandingkan dengan Pemred Waspada H Prabudi Said. Pemain yang disebut terakhir ini mengaku tidak selevel master

nasional Indonesia, tapi pernah menjadi juara catur antar mahasiswa universitas di tiga negara bagian Amerika Serikat diWashington pada era 80an. Prabudi pun pernah menjadi Ketua Umum Percasi Sumut tahun 80an dan redaktur yang mengasuh rubrik problem catur di hariannyaselamabeberapatahun sejak 2000an. “Saya tidak kuat-kuat kali,” kata Prabudi kepada panitia yang memintanya ikut bertanding memperebutkan Blackberry. Namun panitia ingin turnamen berlangsung semarak dengan tetap melibatkan Pemred dalam rangka peringatan HUT RI ke64. Memang, dalam pertandingan merebut handphone canggih seharga Rp5jutaan itu, duel antara Prabudi dan David tidak berakhir telak 2-0 untuk Prabudi seperti dugaan penonton. Skor sempat 1-1 karena Prabudi membuat blunder yang menggratis-

kan Kudanya pada babak kedua. Dalam penentuan set ketiga, Prabudi memegang buah Hitam, sementara David memainkan Putih. Berikutininotasipadalangkah ke 27 dimana Putih sudah kehilangan Kudanya tapi tetap mencoba untuk bertahan. Untuk mengurangi tekanan Hitam, maka Putih melangkahkan sbb: 27. Bd4xKd5 (lihat posisi pada diagram 1). Putih mengharapkan respons Hitam adalah Mb6xMf3, supaya Benteng Putih bisa diselamatkan dengan langkah B-d7+. Kenyataannya, Hitam tidak merespons hasrat Putih karena ada celah kelemahan posisi Putih pada bidak g2. Hitam kemudian melangkahkah 27...,M-c6. 28. M-d4, Bg-d8. 29. B-d1 (diagram 2), BxB. 30. GxB, MxG. 31. MxM, GxM. 32. f2-f4, B-c2 (diagram 3). Putih menyerah beberapa langkah setelah pion b2 dipreteli.

Burnley Permalukan MU Liverpool, Spurs Pesta Gol LONDON (Waspada): Burnley merayakan pertandingan kandang pertamanya di Liga Premier selama 33 tahun ini dengan meraih kemenangan mengejutkan 1-0 atas juara bertahan Manchester United di Stadion Turf Moor, Kamis (20/8) dinihariWIB. Robbie Blake menembakkan tendangan voli yang sangat bagus dari luar kotak penalti pada menit ke-19danUnitedmenyia-nyiakan peluang untuk menyamakan kedudukan ketika Michael Carrick menyaksikan tembakan penaltinya dapat diamankan dengan baik oleh kiper Burnley, Brian Jensen, sesaat menjelang waktu turun minum. United memikul tekanan yang besar di babak kedua, tetapi Jensenyanglincahdantembakan golyangtidakakuratmenghalangi mereka untuk mencetak gol. Di Stadion Anfield, Liverpool berusaha melupakan kekalahan dari Tottenham Hotspur pada pembukaan musim ini dengan

pesta gol 4-0 ke gawang Stoke City. Striker Fernando Torres mencetak gol pembukaan. Tottenham kini menjadi tim baru yang memimpin klasemen sementara setelah membabat HullCity5-1denganstrikerInggris Jermain Defoe mencetak suatu hatrik. Spurs unggul dari Chelsea karena adanya selisih gol setelah Chelsea asuhan Carlo Ancelotti membukukan dua kemenangan dari dua pertandingan dengan kemenangannya 3-0 pada Selasa saat melawan Sunderland. Arsenal menduduki posisi ketiga di klasemen dengan tiga poin walau hanya baru memainkan satu pertandingan. Burnley, yang menang untuk kedua kali dari dua kejuaraan liga merekapadatahun1960,kembali memasuki divisi utama lagi untuk pertama kali sejak 1976. “Banyak peluang yang kami miliki, kami mestinya bisa menang dalam pertandingan itu,” ujar pelatih

United Alex Ferguson kepada program berita Sky Sports. “Burnley mendapatkan kemenangandalamwaktu10menit pada babak pertama. Mereka memang bermain dengan sangat baik,” tambah Sir Fergie. Burnley mendapatkan gol mereka yang mengejutkan itu ketika tembakan voli Blake tepat memasuki sasaran dan berhasil menghindari gol untuk menyamakan kedudukan menjelang babak pertama berakhir ketika Blake menjegal Patrice Evra dan hukuman tendangan penalti atas pelanggaran itu tidak dimanfaatkan dengan baik oleh Carrick. Michael Owen, yang diganti di depan pelatih Inggris Fabio Capello dalam waktu sejam setelah tidak terjadi perubahan apa-apa pada skor United, memberi umpan kepada Berbatov yang meningkatkan serangan United namun Burnley dapat bertahan. (h01/ant/rtr/ap)

Hasil Rabu (Kamis WIB): BirminghamvsPortsmouth 1-0 Burnley vs Man United 1-0 Hull City vs Tottenham 1-5 Liverpool vs Stoke City 4-0 Klasemen Liga Premier: Tottenham 2 2 0 0 7-2 6 Chelsea 2 2 0 0 5-2 6 Arsenal 1 1 0 0 6-1 3 Liverpool 2 1 0 1 5-2 3 Man City 1 1 0 0 2-0 3 West Ham 1 1 0 0 2-0 3 Wigan Ath 2 1 0 1 2-1 3 Fulham 1 1 0 0 1-0 3 Birmingham 2 1 0 1 1-1 3 Man United 2 1 0 1 1-1 3 Sunderland 2 1 0 1 2-3 3 Burnley 2 1 0 1 1-2 3 Wolves 2 1 0 1 1-2 3 Stoke City 2 1 0 1 2-4 3 Bolton 1 0 0 1 0-1 0 Aston Villa 1 0 0 1 0-2 0 Blackburn 1 0 0 1 0-2 0 Portsmouth 2 0 0 2 0-2 0 Hull City 2 0 0 2 2-7 0 Everton 1 0 0 1 1-6 0 AP

Duet bomber Michael Owen (kanan) dan Wayne Rooney kecewa dengan kekalahan MU atas Burnley.

AP

Ricardo Kaka (kiri) merayakan golnya ke gawang Dortmund dengan Cristiano Ronaldo (kanan) dengan disaksikan Marcelo di Signa Iduna Park, Dortmund, Kamis (20/8) dinihari WIB.

Real Rusak HUT Dortmund DORTMUND, Je rman (Antara/AFP) - Klub raksasa Spanyol Real Madrid membantai klub Bundesliga Borussia Dortmund 5-0 dalam pertandingan persahabatan sebagai bagian dari perayaanulangtahunke-100klub Jerman itu, Rabu (Kamis WIB). Ada suasana kegembiraan di kalangan 75.000 penonton. TetapiElRealbenar-benarsedang tidak ingin memberi hadiah kendati klub Jerman itu sedang berulang tahun dan mereka melibas tim tuan rumah itu dengan hujan gol di babak kedua. Esteban Granero membuka gol bagi klub Spnayol saat pertan-

dingan baru berlangsung tiga menit dan baru tiga menit pula setelah babak kedua dimulai bintang Belanda Arjen Robben kembali membobol gawang tuan rumah bagi gol kedua Real. Gonzalo Higuain menyarangkan gol ketiga di menit ke73 sebelum pemain Brazil Kaka mencetak gol keempat di menit ke-76lewattendanganpenaltinya dan Raul menambahkan gol kelimaRealpadasisawaktutinggal semenit lagi. MantanpemaintengahManchester United Cristiano Ronaldo memainkan peranannya bagi klub barunya itu, tetapi ia men-

dapatkan ejekan dari para penonton Jerman kapan pun ia mendapatkan bola. Kendati tim tuan rumah kalah, bek Real Madrid Christoph Metzelder dari Jerman, yang bergabung di Real dari Dortmund tahun 2007, memuji klub lamanya itu. “Kamihariinimenangkarena kelas individu para pemain kami, Dortmund benar-benar tipe klub yang sangat berbeda,” ujarnya. “Saya harap klub ini akan kembali ke jalur kemenangannya di Bundesliga akhir pekan ini,” katanya.

Nadal Sukses Susul FedEx CINCINNATI, AS (Waspada): Unggulan kedua, Rafael Nadal (foto), mengikuti hasil yang diperoleh Roger Federer dengan melangkah ke babak ketiga Turnamen Cincinnati, Kamis (20/ 8). Namun, tiket babak ketiga harus diperoleh Nadal dalam penampilan yang tak konsisten saat melawan petenis Italia Andreas Seppi. Dalam laga itu, Nadal menang 7-6 (4), 7-6 (3) untuk kemudian melawan PaulHenri Mathieu (Perancis) yang menumbangkan petenis Kroasia Ivo Karlovic 9-7, 6-4. “Rasanya berat untuk bermainsebaikmungkinpadapekan kedua penampilan saya. Saya harus bermain lebih agresif,” kata Nadal yang pekan lalu tampil kembali di Montreal, setelah absen dua bulan karena cedera lutut.

Reuters

Pesaing Nadal, Roger Federer, sebelumnya tampil prima melawan Jose Acasuso. Tak pernah kehilangan servis, FedEx menyudahi perlawanan petenis Spanyol itu 6-3, 7-5. Kemenangan di lapangan utama juga diperoleh

peteniSerbiaNovakDjokovicyang unggulatasIvanLjubicic(Kroasia) 7-6 (5), 6-4. Juara bertahan Andy Murray juga tak ingin tinggal diam. MealwanpetenisSpanyolNicolas Almagro, Murray tanpa kesulitan menang 7-6 (3), 6-2. Nasib sial justru dialami unggulan ketujuh Jo-Wilfried Tsonga dan Andy Roddick. Tsonga kali ini tak berdaya saat berhadapan dengan petenis kualifikasi Chris Guccione (Australia) 10-12, 2-6. Roddick, unggulan keempat, dibuat tidak berkutik di tangan rekan senegaranya, Sam Querrey. Dalam dua tiebreak, Querrey menundukkan peringkat lima duniaitu7-6(11),7-6(3).Takdapat menerima kekalahan, Roddick melampiaskan amarahnya dengan membanting raket keraskeras. (m33/ap)

Sport

WASPADA Jumat, 21 Agustus 2009

7

PIMNAD Jr Juru Kunci SALATIGA (Waspada): PIMNAD Junior akhirnya harus rela menjadi juru kunci di Turnamen Basket Piala Kemerdekaan yang digelar Pusdiklat Basket FTI UKSW Salatiga, setelah Rabu (19/8) dipaksa mengakui keunggulan Halim Kediri 7191. Sebagaimana dilaporkan

pelatih Jekky LB Sagala, pemainpemain PIMNAD Jr kalah segalagalanya dari Halim Kediri. Tidak hanya kalah postur, anak-anak PIMNAD Jr juga kalah kompak dan pengalaman dari klub basket yang sudah cukup lama malang melintang di jagat perbasketan nasional tersebut. Maka tak heran, jika sepanjang permainan para pemain Halim Kediri mampu mendikte pemain-pemain PIMNAD Junior dan terus mendominasi perolehan angka. Begitu pun, tak lantas di laga ini skuad muda Aceh itu cuma jadi bulan-bulanan lawan. Di kuarter I, Surliyadin cs

masih mampu mengimbangi permainan dan hanya kalah tipis 18-20 dari Halim. Namun, dua kuarter berikutnya mulai keteteran dan kalah 16-24 dan 13-26. Meski berhasil memenangkan kuarter terakhir melalui perjuangan yang cukup berat, Akbar Aulia dan kawan-kawan tetap tak mampu mengejar ketertinggalannyadanharusmengakui keunggulan Halim Kediri. Dengan kekalahan tersebut, PIMNAD Jr yang bermaterikan calon pemain-pemain muda yang bakal diterjunkan ke arena Pra PON 2011 mendatang harus puas dengan posisi jurukunci dengan berada di bawah Halim,

Pasific Caesar Surabaya dan tuan rumah Pusdiklat Basket FTI UKSW Salatiga. Secara terpisah, Ketua Umum Pengprov. Perbasi Aceh, dr Lukman Hasibuan yang menghubungi Waspada dari Medan, mengaku sangat puas dengan performa anak-anak PIMNADJunior,meskibelumbisa meraih kesuksesan di turnamen ini. “Saya sangat puas dengan penampilan anak-anak. Walau masih banyak yang perlu diperbaiki di sisi defense, secara umumpermainanmerekasudah menunjukkan grafik meningkat,” ungkapnya.

Juara Catur Sumatera Harus Menuju Kejurnas BANDA ACEH (Waspada): Para pecatur pelajar Aceh yang meraih juara pada Kejuaraan Catur Terbuka Antar Pelajar seSumatera yang digelar SIWO PWI Aceh bekerjasama dengan Dinas PendidikanAcehbeberapawaktu lalu, layak dikirim dan bertanding di kejuaraan nasional. “Para pecatur pelajar Aceh yang meraih juara dan yang menempati peringkat 1 sampai

10 di kejuaraan tersebut harus dikirim mengikuti Kejurnas Catur yang akan digelar November mendatang di Palangkaraya, Kalimantan Tengah,” kata pengurus Percasi Kota Banda Aceh, T Ardiansyah, Kamis (20/8). Pada kejuaraan itu, tiga pecatur Aceh menduduki posisi teratas kelompok SD putri serta peringkat IV di kelompok putra. Begitu juga di kelompok SMP/

SMA, pecatur-pecatur Aceh menempati posisi teratas, yaitu Rizky Syahrul (SMKN Jeumpa Bireuen) di kelompok putra serta Afifah (SMP Negeri I Takengon). “Secara keseluruhan ada 14 pecatur junior Aceh yang telah berprestasi. Mereka tidak hanya layak, akan tetapi harus dikirim dan pantas bermain di Kejurnas. Apalagi, dengan prestasi itu mereka bisa dikatakan pecatur

Telkomsel Dukung Rio Haryanto Ke F-1

MACAU (Waspada): Taufik Hidayat belum mendapat hambatan besar di turnamen Macau Grand Prix Gold. Pada babak kedua,Rabu(19/8),Taufikkembali meraih kemenangan mudah setelah menyingkirkan pemain ThailandSuppanyuAvihingsanon 21-14, 21-13 sekaligus memperoleh tiket perdelapanfinal. Menghadapi lawannya yang memang kalah kelas itu, Taufik sangatmendominasipertandingan. Selama duel yang menghabiskan waktu 25 menit tersebut, Taufikyangmerupakanunggulan ketiga selalu memimpin perolehan poin. Di set pertama, Suppanyu hanya bisa mengimbangi permainan Taufik di dua angka pertama saat skor 1-1 dan 2-2. Setelah itu,Taufik yang pekan lalu menjadi semifinalis Kejuaraan Dunia Bulu Tangkis 2009 di Hyderabad, melaju dengan cepat sampai meraih kemenangan set pertama tersebut. Pada game kedua, Suppanyu sempat membuat kejutan karena selepas skor 1-1, dia bisa memimpin sampai 3-1. (m33/ant)

7

5 8 1 9 6 4 3 2 7

Taufik Belum Dapat Hambatan

9 3 6 4 1

9 4 2 8 3 7 1 5 6

4

9 5 7 4 6 8 1 5

2

3 7 6 1 5 2 8 4 9

5 7 9 1 2

5

2 5 8 6 4 9 7 1 3

5

4 3 6 5 8 9 7 6

4 6 7 2 1 3 9 8 5

8

1 3 9 7 8 5 4 6 2

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di kolom 8.

6 9 4 3 2 8 5 7 1

Sudoku

cukup ketik REG RIO, kirim ke 8088. Pelanggan akan dikenakan tarif Rp 2.000/SMS.(m09) 7 1 5 4 9 6 2 3 8

Adhyaksa menambahkan, semogadukunganuntukRioterus mengalir, karena Rio sangat potensial untuk dapat tampil di F-1 dan mengharumkan nama Indonesia di kancah internasional. Saya berharap langkah Telkomselinijugadiikutiperusahaanperusahaan lain demi kemajuan olahraga nasional, tuturnya. Telkomsel memberikan dukungan penuh untuk seluruh persiapan race serta menyediakan aksesbagipelangganyang ingin mendukung Rio Haryanto, dimanaseluruhbantuantersebut akan dialokasikan langsung kepada Rio untuk mendukung kemajuan prestasinya di arena balap mobil internasional. Untuk mendukung Rio Haryanto, pelanggan Telkomsel cukup mengirimkan SMS, ketik RIO <kata-kata dukunganmu>, contoh: RIO Kamu pasti bisa! Ayo semangat! dan kirim ke 8088. Pelanggan juga dapat menikmati info terbaru serta wallpaper Rio,

8 2 3 5 7 1 6 9 4

MEDAN(Waspada):Telkomsel menghadirkan layanan bagi pelanggan untuk mendukung pembalap muda nasional Rio Haryanto berkiprah di ajang balap mobil internasional Formula Satu (F-1). SiaranpersTelkomselditerima Waspada Kamis (20/8) menyebutkan, acara turut dihadiri MenegporaAdhyaksaDault,Direktur Utama Telkomsel Sarwoto Atmosutarno mengatakan,beberapa tahun terakhir ini prestasi olahraga nasional kita kurang menggembirakan.Padahalbanyak atlet muda potensial yang dapat berprestasi di ajang internasional, namun kekurangan dana. Padamomenperingatanhari kemerdekaanini,Telkomselsecara khusus berkomitmen mendukung pembalap muda Rio Haryanto untuk mengharumkan nama bangsa di pentas internasionalsampaikeajangbalapmobil paling bergengsi di dunia, yakni F-1.

junior yang sudah jadi,” kata Ardiansyah.. Karena itu, ia meminta PengprovPercasiAcehmengirimkan para pecatur tersebut ke Kejurnas, sebagai tindak lanjut pembinaan atlet berprestasi. Meskipun tidak dikirim semua, mungkin kesulitan dana, minimaljuaraIsampaiIIIharusdikirim ke Kejurnas. “Jika provinsi lain mengirim atlet yang hanya juara Kejurda ke Kejurnas, kenapa Aceh yang sudah memiliki juara catur seSumatera, tidak mengirim? Artinya, adalah kerugian besar bagi Aceh jika tidak mengirim mereka,” tegasnya. Hal senada juga disampaikan seorang wasit catur Aceh, Sudirman MansyurWNP. Menurut dia, saat ini Aceh telah memiliki prestasi yang cukup membanggakan dalam olahraga catur. Selain 14 peca-tur junior yang berprestasi, Aceh juga me-miliki pecatur putri Anisa Faraliana yang berhasil men-duduki peringkat 10 kejuarnas mahasiswa, Juni lalu. (b07)

Secara keseluruhan, dia menyebutkan para pemain mengalami banyak kemajuan dan ajang sepertiinisangatbaikbagimereka untuk pembentukan mental dan visi bermain. “Saya akan terus mencari kejuaraan-kejuaraan yang bisa diikuti anak-anak ini, walaupun biaya tidak akan sedikit,” tukas Lukman. Saat ini, kata Lukman, delapan pemain sudah hampir pasti mengisi skuad tim Pra PON Aceh dan tujuh pemain masih bisa berubah tergantung dari pantauan pada Porda dan Popda 2010. (b07) Waspada/Zafrullah

Ketua PWI Aceh Drs A Dahlan TH menyerahkan hadiah kepada juara kelompok SMP/SMA putri pada Kejuaraan Catur Terbuka Pelajar se-Sumatera di Banda Aceh, belum lama ini.

Sport

8

Pasang Iklan � 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id

Pemerintah Kota Subulussalam Beserta Jajarannya Mengucapkan Selamat dan Sukses

Kepada: 1. Fajri, 2. Siti Ansari Bancin, SE dan 3.Teuku Maswarli (Golkar), 4. Pianti Mala, 5. Ir. Netap Ginting dan 6. Jamasa Cibro (PKPI), 7. Hj. Mariani Harahap dan 8. H. Mukmin (Hanura), 9. Ir. H.M Sugito dan 10. Syarifuddin (PAN), 11. Supriadi Boang Manalu dan 12. Karlinus (PBB), 13. Marzuki dan 14. Darwinsyah (Partai Kedaulatan), 15. Dedi (PKB), 16. H. Ansari Idrus Sambo, SH (PPP), 17. Bakhtiar (PDIP), 18. Syarifuddin Padang (PBR),19. Sultan Bagindo (PKPB) serta 20. Erlinawati (PD).

Atas Pengucapan Sumpah/Janji Menjadi Anggota DPRK Subulussalam Periode 2009-2014 Yang Dipandu Oleh Dwi Purwadi, SH, MH

AP

Lewis Hamilton (kiri) mulai percaya diri sejak kemenangannya di GP Hungaria.

Hamilton Tebar Ancaman VALENCIA, Spanyol (Waspada): Lewis Hamilton memberi peringatan kepada rival-rivalnya di sirkuit Formula One (F1). Juara dunia tahun 2008 itu menegaskan kemenangan McLaren Mercedes di GP Hungaria akan kembali terulang. Kepercayaan diri Hamilton meningkat karena mobil McLaren MP4-24 terus dikembangkan oleh para kru dan mekanik di markas McLaren, di Woking, Inggris. Menurutnya, keberadaan Kinetic Energy Regenerative System (KERS) sangat membantu performa mobil yang dikemudikannya. “Kami tahu kami dalam jalur untuk bersaing merebut kemenangan-kemenangan lainnya san tentunya bersaing di barisan depan lebih sering lagi. Tujuan kami sekarang adalah memenangi balapan sebanyak-banyaknya,” ujar Hamilton, Kamis (20/8). “KERS menjadi benar-benar berguna. Saya pikir jika kita melepas KERS maka kita tidak akan secepat, katakanlah, Red Bulls. Tetapi dengan KERS saya pikir kami akan secepat mereka. Semoga ini akan memberi keuntungan,” jelas Hamilton. Selain masalah teknis, berdasarkan pada pengalamannya di musim lalu, Hamilton juga menilai sirkuit yang akan dilintasinya sesuai dengan gaya membalapnya. “Valencia berjalan baik bagi saya di tahun lalu. Saya berada di urutan kedua tahun lalu dan bersaing ketat dengan (Felipe) Massa. Semoga dengan mobil yang lebih baik, kami mampu berkompetisi untuk merebut podium,” tuturnya lagi. Satu-satunya hal yang disayangkan oleh Hamilton pada GP Valencia akhir pekan nanti adalah batalnya Michael Schumacher kembali terjun ke lintasan F1. (m33/ini)

PELABUHAN INDONESIA I

UNIT TERMINAL PETI KEMAS BELAWAN PENGUMUMAN PELELANGAN Nomor : UM.57/29/13/UTPK-09 Unit Terminal Peti Kemas Belawan akan mengadakan Pelelangan Umum dengan metode Pascakualifikasi sesuai dengan ketentuan yang berlaku di PT Pelabuhan Indonesia I (Persero) untuk : 1. Pekerjaan persewaan 2 (dua) unit Harbour Mobile Crane (HMC). 2. Persyaratan pendaftaran : a. Peserta adalah Perusahaan berbadan hukum Indonesia yang bergerak dalam bidang Bongkar Muat atau Persewaan Alat Berat. b. Pada saat pendaftaran harus menyerahkan foto copy dan menunjukkan asli yang masih berlaku : 1) Surat Izin Usaha Perdagangan (SIUP), Akte Pendirian Perusahaan dan Perubahannya (apabila ada) yang sudah disyahkan oleh Departemen Hukum dan HAM RI. 2) Nomor Pokok Wajib Pajak (NPWP). 3) Bukti SPT dan SSP pajak tahun 2008 untuk PPh Badan dan PPh Psl 21 serta memiliki laporan bulanan tahun 2009 untuk PPh pasal 25 atau pasal 21/pasal 23 atau PPN sekurang-kurangnya 3 (tiga) bulan terakhir; 4) Bukti hak kepemilikan alat dan atau akte jual beli. 5) Bukti pengalaman kerja 5 (lima) tahun terakhir dalam bidang pekerjaan Bongkar Muat atau Persewaan Alat Berat. 6) Pendaftaran harus dilakukan sendiri oleh pimpinan perusahaan atau yang namanya tercantum dalam akte pendirian perusahaan/daftar susunan pengurus perusahaan, dengan menyerahkan copy KTP dan menunjukkan KTP asli yang masih berlaku. c. Pakta Integritas wajib ditandatangani pada saat pendaftaran oleh Direktur Utama atau penerima kuasa yang namanya tercantum dalam akte pendirian perusahaan atau perubahannya/daftar susunan pengurus perusahaan. 3. Jangka waktu persewaan selama 12 (dua belas) bulan. 4. Spesifikasi Harbour Mobile Crane (HMC) : a. Kondisi baru atau minimal pembuatan 10 tahun terakhir yang dibuktikan dengan Certificate of Origin dari manufacture/ principal. b. Beban maksimum terhadap dermaga 9 Ton/M2. c. SWL minimal 35 ton pada Row ke 13. 5. Pendaftaran dan pengambilan dokumen pelelangan pada : Hari : Senin s.d Rabu Tanggal : 24 s.d 26 Agustus 2009 Pukul : 10.00 s.d 16.00 WIB Tempat : Unit Terminal Peti Kemas Belawan Jl. Raya Pelabuhan Gabion Belawan, 20414 6. Membayar biaya pendaftaran sebesar Rp. 1.000.000,- (satu juta rupiah). 7. Panitia tidak melayani pendaftaran jika tidak memenuhi ketentuan tersebut di atas. 8. Hal – hal yang belum jelas dapat ditanyakan langsung pada saat pendaftaran. Belawan, 21 Agustus 2009

PANITIA PENGADAAN BARANG/JASA

Ketua Pengadilan Negeri Aceh Singkil/ Kota Subulussalam Pada Hari Rabu, 19 Agustus 2009 di Gedung Pertemuan DPRK Subulussalam “Semoga Senantiasa Mendapat Lindungan Allah Swt Dalam Melaksanakan Amanah Rakyat Untuk Membangun Pemko Subulussalam”

Dan Mengucapkan Penghargaan Serta Terima Kasih Kepada Anggota DPRK Subulussalam Periode 2007-2009 Atas Darma Bhaktinya Selama Ini Dari :

MERAH SAKTI, SH

H. AFFAN ALFIAN BINTANG, SE

Walikota

Wakil Walikota

Drs. H. ANHARUDDIN, SE, MM Sekdako

WASPADA

Jumat 21 Agustus 2009

Medan Metropolitan

WASPADA

Jumat 21 Agustus 2009

Gubsu Ingatkan PLN

Listrik Tidak Boleh Padam Selama Ramadhan MEDAN (Waspada): Gubsu Syamsul Arifin mengingatkan kembali PT PLN agar memenuhi janjinya tidak melakukan pemadaman listrik pada bulan suci Ramadhan. Hal itu disampaikan Gubsu kepada wartawan di ruang kerjanya, kemarin, sehubungan menjelangmasuknyaRamadhan1430 H. Gubsu dalam kesempatan itu didampingi Kakanwil Depag

Sumut Syariful Mahya Bandar, Asisten Hukkesos Asrin Naim dan Kadis Kominfo Sumut Eddy Syofian. “PTPLNagarmemenuhijanjinya berupaya semaksimal

Kawasan Bandara Polonia Rawan Macat MEDAN (Waspada) : Pengguna jasa Bandara Polonia Medan mengeluh, kawasan Bandara tersebut rawan macat lalu lintas (lalin), malahan saat-saat tertentu sering macat total mencapai lamanya 30 menit bahkan lebih. Jika beberapa penerbangan rute dalam negeri dan luar negeri mendarat hampir bersamaan waktu, macat total sering sekali terjadi di Bandara itu, akibatnya ada penumpang yang berangkat ketinggalan pesawat. Yang biasanya terjadi macat kawasan jalan menuju domestik di persimpangan jalan keluar depan Vip room Bandara hingga ke pintu keluar, khususnya tempat memungut biaya parkir kendaraan. Seperti dituturkan Aisah, warga Kp. Baru Medan, penumpang Lion Air saat mendarat di Bandara Polonia Medan dari Penang, Selasa (18/8), yang meminta pengelola Bandara agar memikirkan kelancaran arus keluar masuk kenderaan melalu Bandara itu. “SebelumBandaraPoloniaMedanpindahkeBandaraKwalanamu, sebaiknya ada penambahan jalan masuk maupun keluar dari Bandara mencegah kemacetan arus lalu lintas,” ujarnya. Kepala Personalia/umum AP-II Bandara Polonia Medan, H. Firdaus,SEketikadikonfirmasimembenarkan.Diaakanmenyampaikan keluhan pengguna jasa Bandara kepada GM.AP-II Bandara Polonia Medan, Endang A. Sumiarsa. Begitupun dia tidak membantah, pertumbuhan arus penumpang melalui Bandara Polonia Medan dari hari ke hari meningkat, sehingga kenderaan pengantar maupun penjemput juga meningkat. (m32)

RM Al Muttaqin Adakan Lomba Dan Bazar HAMPARAN PERAK (Waspada): Remaja Masjid Al Muttaqin, Jalan Klambir Lima Gang Pendidikan, Kecamatan Hamparan Perak, Deli Serdang, bekerjasama dengan PT Indofood mengadakan sejumlah perlombaan dan bazar dalam rangka HUT RI ke 64 di lapangan bola kaki, Senin (17/8). Sejumlah perlombaan yang dilaksanakan itu diantaranya lomba memasukkan paku ke dalam botol, lomba mewarnai tingkat SD dan tidak ketinggalan perlombaan panjat pinang dan hiburan. Perlombaan tidak hanya diikuti oleh ratusan anak-anak usia sekolah, namun sejumlah ibu-ibu yang tinggal di sekitar lokasi acara turut serta dalam perlombaan memasak nasi goreng yang di sediakan. Irsan Yazid, Wakil Dirut PT Indolakto melalui Admiral Tunoven, Pimpinan Regional Manager I PT Lakso salah satu anak perusahaan PT Indofood yang ditemui saat pagelaran acara mengatakan, panitia pelaksana acara itu adalah RM Al Muttaqin sedangkan pihaknya hanya pendukung. “Sebagai rasa syukur atas kemerdekaan yang telah kita capai. Jadi, kegiatan ini bukan hanya milik kami, melainkan dari masyarakat untuk masyarakat dan oleh masyarakat bersama Indomilk,” katanya. Acara yang digelar dengan mengusung istilah “Kampoeng Merdeka” Indomilk itu dilaksanakansecaraserentakdi350lokasi pada empat kota besar di Indonesia diantarnya Jakarta, Bandung, Medan dan Makasar. Kegiatan seperti ini telah dimulai sejak tahun 2006 dan ratusan masyarakat selalu antusias mengikuti acara yang digelar di lapangan terbuka itu. Hiburan musik dan nyayian gembira serta bazar menambah semarak acara Kampoeng Merdeka tersebut. (cre)

MUI Akan Salurkan Al Quran Ke Masjid-masjid MEDAN (Waspada): Majelis Ulama Indonesia Kota Medan mendapatkan bantuan 630 eksemplar kitab suci Al Quran dari PDAM Tirtanadi yang diserahkan langsung oleh dirutnya, Syahril Effendi Pasaribu. Al Quran itu akan disalurkan kepada 63 masjid/musalla oleh tim safari Ramadhan MUI tahun ini. Ketua Umum MUI Kota Medan H.M. Hatta yang menerima bantuanitudikantorMUIMedan, Sabtu (15/8), menyambut baik sumbangan itu dan MUI segera menyalurkannya ke masjidmasjid yang telah terdata. Ketika itu hadir Ketua Komisi Hukum & Perundang-undangan MUI Medan Pagar Hasibuan, Ketua Komisi Dakwah KH Zulfiqar Hajar, Ketua Komisi Pendidikan Hasan Mansur Nasution, Ketua Komisi Infokom Agus Thahir Nasution dan Sekretaris Umum, Hasan Maksum. Syahril Effendi Pasaribu mengatakan,pemberianbantuan ini diharapkan dapat dimanfaatkan, terutama dalam mengisi hari-hari selama bulan suci Ramadhan dengan bacaan-bacaan ayat-ayat suci Al-Qur’an. Tim Safari Ramadhan 1430 H MUI Medan akan mulai turun ke lapangan pada 2 Ramadhan 1430 H (23 Agustus) dengan jumlah personel 22 orang mencakup 21kecamatanyangadadiMedan. Tim Safari Ramadhan ini, akan mengunjungi63masjid/mushalla ditambah 10 masjid/mushalla yang ada di instansi pemerintah dan swasta serta perusahaanperusahaan, termasuk di PDAM Tirtanadi. (m36)

mungkin menghindari pemadaman listrik bergilir,” ujarnya. Sementara itu, PT PLN Regional Sumatera Utara optimis pasokan listrik pada Ramadhan dalamkondisirelatifaman.Waktu beban puncak (WBP) PLN memiliki cadangan yang mampu mengisi kekurangan daya. General Manager PT PLN Regional Sumut, Manarep Pasaribu, di Medan, menyatakan,

selama Ramadhan dan Idul Fitri 1430 H, PLN berkomitmen untuk tidak melakukan pemeliharaan mesinpembangkit,jaringantransmisi maupun jaringan distribusi. Sementara itu, Manager Perencanaan Pembangkitan Sumatera Utara, Fahmi Lubis, menyatakan, pembangkitan dan energi primer pada Ramadhan nanti tetap aman. “Kita juga berharap, curah

hujan menjelang Ramadhan yang cukup tinggi di Reunun dapat menyuplai energi listrik sehinggaperkiraandaya1300MW dapat mengamankan kelistrikan di Sumut,” ujarnya. Fahmi Lubis menerangkan, daya mampu sistem sekitar 1391 MW dengan beban puncak 1.330 MW hal ini tidak akan menjadi permasalahan bagi kondisi kelistrikan di Sumut. (m38/m19)

Buronan Teroris Berpotensi Di Sumut MEDAN (Waspada): Kapoldasu Irjen Pol Badrodin Haiti menegaskan, keberadaan teroris Noordin M.Top tidak mungkin bersembunyi di komunitas nonmuslim ataupun kejawen, tetapi dia bersembunyi di komunitas muslim juga. “Karena itu dalam pemberantasan teroris di Indonesia tidak bisa hanya melalui penegakan hukum saja, tetapi harus diajak berdialoguntukmengetahuijalan pikir mereka. Sebab, masalah ini menyangkut keyakinan seseorang,”kataKapoldasu,Rabu(19/ 8), dalam acara silaturahim dengan Majelis Ulama Indonesia (MUI) Kabupaten/Kota seSumatera Utara di Kantor MUI

Sumut dalam rangka menciptakan suasana bulan suci Ramadhan1430Hyangkondusif.Hadir juga antara lain Ketua Dewan Penasihat MUI Sumut Maslin Batubara, Ketua Umum MUI Sumut Abdullah Syah, mantan Sekretaris Umum MUI Sumut A. Muin Isma, Kakanwil Depagsu Syariful Mahya Bandar dan pimpinan Ormas Islam. Kapoldasu mengatakan, terorisme bisa terjadi dimana saja dan siapa saja, tergantung siapa yang akan menjadi tujuan. Kasus ini bukan hal baru. Bahkan, di Medan pernah ada namanya Komando Jihad sewaktu dia menjabat sebagai Kapoltabes Medan sekitar tahun 2000. “Ini

berarti, sel-sel terorisme hampir semua tempat ada. Satu saat buronan teroris bisa sampai ke Sumut yang berpura-pura mengajar di satu tempat. Bisa saja ke Medan, Binjai, Deliserdang atau ke Labuhanbatu,” ujarnya. Menurut Kapoldasu, peranan ulama, tokoh agama dan pimpinan Ormas-ormas Islam sangat penting untuk memberikan penjelasan kepada mereka agar mau kembali kepada ajaran Islam yang sebenarnya. Perlu dibentuk forum dialog ulama dan pondok pesantren dalam mengatasi masalah ini. Apakah mereka harus diperangi tetapi cara terbaik mereka diajak berdialog. (m36)

Kijang Innova Terbakar MEDAN (Waspada): Mobil Kijang Innova BK 1450 JG milik Aipin, 30, yang sedang melintas di Jalan Asrama tiba-tiba terbakar persisnyadidepanrukoPutraProduksi,KelurahanHelvetia,Medan Helvetia, Rabu (19/8) malam. Dalam peristiwa itu tidak ada korban jiwa, namun sempat menimbulkan kemacetan arus lalu lintas. Saksi mata kepada Waspada mengatakan, peristiwa ituterjadisekirapukul23:30,mobil dikemudikan Fahrul Rozi, 26,

bersama rekannya Budi Kurnia, 26, montir SP Motor, keduanya pendudukJalanKarya,Kelurahan Karang Berombak, Kecamatan Medan, hendak mengantarkan tamu bos mereka, Aipin, penduduk Jalan Brigjen Katamso belakangRamayana,darikawasan Sunggal menuju Medan. Setiba di Jalan Asrama, tibatiba asap terlihat dari kabin depan diiringi suara ledakan langsung mobil itu terbakar. Fahrul Rozi bersama rekannya langsung

menyelamatkan diri keluar dari dalam mobil tersebut. Petugas Polsekta Medan Helvetia mendapat informasi kejadian itu langsung mengamankan lokasi. Sedangkan petugas Satlantas Poltabes terlihat mengatur arus lalin yang macat. Dalam kasus ini, mobil yang terbakar langsung dievakuasi ke Mapolsekta Medan Helvetia dan polisi telah mengambil keterangan tiga saksi. Sedangkan kerugian mencapai Rp200 juta. (m31)

9

Jenazah Pasien HIV/AIDS Ditelantarkan Keluarga MEDAN (Waspada): Meski sudahtigahariberadadiRuangan Instalasi Jenazah RSUP H. Adam Malik Medan, mayat Soloan Daulay, 32, pasien HIV/AIDS, warga Jambi, hingga Kamis (20/ 8) sore belum juga diambil oleh pihak keluarganya. Pantauan Waspada di ruangan instalasi jenazah, agar tidak menimbulkan bau, mayat Soloan tersebut dimasukkan ke dalam mesin pendingin. Mayat berbaju biru tersebut terlihat sudah kaku dan tubuhnya kurus. Kasubbag Humas RSUP HAM, Sairi M. Saragih, DCN, M.Kes mengatakan, sampai sekarang belum satu pun anggota keluarga almarhum datang ke rumah sakit ini untuk mengambil mayatnya.“Tidaksatupundarikeluarga korban yang datang menjenguk dan bertanggung jawab untuk mengambil dan membayar uang perawatannya hingga menghembus nafas terakhir,” ujarnya, Kamis (20/8). Sairi menuturkan, Soloan masuk ke RSUP HAM, Rabu (12/ 8), dan meninggal Selasa (18/8) kemarin.SaatmasukkeRS.Adam Malik kondisi tubuhnya sudah lemah dan sudah mengalami infeksi opurtunistik. “Waktu pertama dia datang ke Adam Malik ini,

Waspada/Mursal AI

DIMASUKKAN: Karena belum diambil pihak keluarga, jenazah pasien HIV/AIDS Soloan Daulay, 32, terpaksa dimasukkan ke mesin pendingin di Ruangan Instalasi Jenazah RSUP HAM. Soloan ditemani seorang wanita. Wanita tersebut, hanya menjenguk dia sampai tiga hari saja, terhitung pertama dia masuk. Setelah hari keempat Soloan di RS. Adam Malik, perempuan itu tak lagi menampakkan batang hidungnya” kata Sairi sembari mengatakan tidak tahu identitas wanita itu, hanya meninggalkan alamat Jl. Rawa II Medan Denai. Sairi menambahkan, selama

satu minggu di rawat RS. Adam Malik biaya perawatan Soloan mencapai Rp. 1,5 juta. “Soloan ini pasien umum.” Sairi menghimbau pihak keluarganya agar segera menjemput jenazahnya di Ruangan Instalasi Jenazah RSUP HAM. Jika dalam waktu seminggu belum juga diambil, pihak rumah sakit akan menguburkannya di pemakaman Delitua. (cmai)

10 Marelan Butuh Pasar Tradisional MEDAN (Waspada): Kecamatan Medan Marelan hingga saat ini belum memiliki pasar tradisional yang dikelola oleh Pemko Medan. Hal itu dikatakan Camat Medan Marelan, S Armansyah Lubis, SHketikamemberikankatasambutanpadaacarapelantikanPimpinan CabangAngkatanMudaMelayuIndonesia(PCAMMI)MedanMarelan priode 2009- 2012 di lapangan bola kaki Pasar Lima Marelan, Jumat (14/8). Dijelaskan Armansyah, pajak yang ada saat ini merupakan milik pengusaha swasta. Lokasi pasar yang sangat terbatas sering menimbulkan kemacetan. Hal itu terjadi akibat semakin banyaknya jumlah pedagang yang menjajakan dagangannya menggunakan badan jalan. “Sesuai perintah Walikota, kita tidak diperbolehkan mengusirpedagangkakilima,tapiharusditataagartidakmenimbulkan masalah,” katanya. Mewakili masyarakat, Camat berharap Pemko Medan segera merealisasikan rencana pembangunan pasar tradisional Marelan yang sudah pernah dimohonkan zaman Abdillah, Ak MBA masih Walikota Medan. ”Marelan telah menjadi lokasi pertemuan petani dan pedagang grosir tanaman hasil bumi dan jumlah mereka setiap tahun bertambah,” ujar Armansyah. Sebelumnnya, Ketua PD AMMI Kota Medan, H AbdullahWahab dalam sambutannya meminta seluruh anggota dan pengurus AMMI yang baru dilantik bisa bekerja sama dengan seluruh etnis masyarakat yang ada. “Pemuda Melayu Marelan harus bisa berbuat dalam rangka menguatkan paji- panji organisasi dan pembangunan Marelan, agar tidak ketinggalan dengan suku lain,” katanya. Setelah dilantik Ketua AMMI Marelan priode 2009- 2012, Jamaluddin mengatakan, dalam waktu dekat ini pihaknya akan melakukan konsolidasi internal guna menguatkan barisan. “Setelah kita melakukan penguatan barisan, maka pembahasan program kerja kedepan akan bisa dilaksanakan,” katanya didampingi sekretaris Danial, SE dan bendahara, Zainul. (cre)

Grand Angkasa Meriahkan Ramadhan MEDAN (Waspada): Untuk menyambut bulan suci Ramadhan 1430 Hijriyah, Grand Angkasa Internasional Hotel menyediakan 1430 buah cokelat dan memberikan 10 butir berlian kepada pembeli yang beruntung. Hal itu disampaikan Asst. Public Relations Manager, Idawati Onggo, dalam jumpa pers pihak hotel itu di Jalan Perintis Kemerdekaan Medan, Rabu (19/8). Menurut Idawati, cokelat berbentuk bulan dan bintang diperkirakan telah diluncurkan 18 Agustus 2009. Setiap cokelat dijual dengan harga Rp20.000/buah. Sebagai bentuk bakti sosial seluruh hasil penjualan cokelat akan disumbangkan ke Rumah Zakat Sumut untuk dibagi kepada fakir dan miskin. Dana yang terkumpul dari penjualan cokelat mencapai Rp28.600.000. Sebagai apresiasi terhadap pembeli, Grand Angkasa menggandeng Gordon Max Diamond untuk menyediakan 10 butir berlian kepada pembeli yang beruntung. (m25)

Hikma Sambut Ramadhan MEDAN (Waspada): Himpunan Keluarga Mandailing (Hikma) Kota Medan memperingati Israk Mikraj sekaligus menyambut datangnya bulan suci Ramadhan 1430 H di Aula Taman Budaya Medan Jalan Perintis Kemerdekaan, Minggu (16/8). Acara itu dihadiri PjWalikota Medan Rahudman Harahap, mantan Pj Walikota Medan Afifuddin, pengurus Hikma Sumut, tokoh masyarakat kota Medan, alim ulama, pengurus parpol, Persadaan Mandailing Tapsel dan lainnya. Ketua Umum PD Hikma Kota Medan Zulhanuddin Nasution dalam sambutannya mengatakan, Ramadhan sudah di depan pintu. Hikma mengajak segenap umat Islam agar melaksanakan ibadah puasa lebih berkualitas. Sementara itu, Pj Walikota Medan Rahudman Harahap mengharapkan Hikma Medan melibatkan Pemko dalam segala kegiatan. (m39)

Dinas Bina Marga Sambut Ramadhan MEDAN (Waspada): Panitia Hari Besar Islam (PHBI) Dinas Bina Marga Provsu mengadakan peringatan Israk Mikraj Nabi Besar Muhammad SAW 1430 H di aula kantor itu Jalan Sakti Lubis Medan, Rabu (19/8). Israk Mikraj sekaligus menyambut Ramadhan ini dihadiri seluruh pegawai di jajaran dan UPT se Sumut dan staf. Penceramah Azhari Akmal Tarigan mengutarakan, Ramadhan adalah bulan penuh berkah. Di dalamnya menumbuhkan kasih sayang sesama kaum muslim.Tarigan mengatakan, hal itu dibuktikan adanya pemberian zakat fitrah, santunan kepada anak yatim dan fakir miskin. Di bulan Ramadhan banyak orang lebih mudah untuk mengeluarkan infaq sedekahnya karena pada bulan itu semua amal ibadahnya dilipat gandakan pahalanya oleh Allah SWT. “Mari kita sambutbulanRamadhandenganhatiyanglapangdanikhlas,”ujarnya. Kadis Bina Marga Provsu Umar Zunaidi Hasibuan mengatakan, puasa untuk memotivasi menjadi taqwa Hadiah HUT RI Sementara itu, terkait peringatan HUT Ke-64 RI, Dinas Bina Marga menyerahkan hadiah bagi unit kerja masing-masing yang memenangkan perlombaan. Kadis Bina Marga Provsu, Umar Zunaidi Hasibuan, didampingi KTU, Johan Samose Harahap, dan ketua tim penilai M. Riduan seusai acara di halaman kantor itu, Senin (17/ 8), mengatakan, tampil sebagai juara umum adalah bidang sekretariat. Pemenang mendapat hadiah bingkisan serta uang tunai diserahkan Kadis Bina Marga Provsu dan KTU Johan Somase Harahap. (m25)

Syukuran Kamal Sofyan Sebagai JAM Pidum MEDAN (Waspada): Jabatan adalah cobaan, amanah dan fitrah yang sangat berat. Maka, jangan dikotori kepercayaan atas jabatan yang diberi Allah SWT kepada kita. Gubsu Syamsul Arifin mengatakan hal itu pada malam penyambutan bulan suci Ramadhan 1430 Hijriyah dan syukuran atas dilantiknya Kamal Sofyan Nasution sebagai Jaksa Agung Muda Pidana Umum (JAM Pidum) di kediamannya semasa kecil di Jalan AR Hakim Gg. Pertama Medan, Sabtu (15/8). Gubsu mengatakan dirinya sangat bangga karena orang Medan dipercaya untuk menduduki jabatan JAM Pidum di Kejaksaan Agung RI. Kepercayaan itu hendaknya dijaga dan jangan kita bebani beliau dalam melaksanakan tugasnya. Gubsu dalam sambutannya penuh humor memuji sosok Kamal Sofyan yang dia nilai sebagai figur pejabat yang jujur dan Tak banyak bicara, tetapi sekali bicara bisa membuat kita “pingsan,” katanya. Acara syukuran yang diisi tausiyah oleh rektor IAIN Sumut dan dihadiri Kapoldasu Irjen Pol Badrodin Haiti, Pj. Walikota Medan Rahudman Harahap, Kajati NAD H Yafizham SH, Asisten Pidana Umum Agus Sutaso, Ketua Kwartir Daerah Sumut (Kwardasu) Gerakan Pramuka, Amansyah Nasution dan pejabat serta paguyuban lainnya. Sementara itu, Kapoldasu Badrodin Haiti yang juga alumni Lemhanas bersama Kamal Sofyan berharap dengan dilantiknya Sofyan sebagai JAM Pidum, hubungan antara kejaksaan dan kepolisian semakin lancar. Asisten Pidana Umum Kejatisu Agus Sutaso berjanji akan mendukung segala tugas yang diperintahkan JAM Pidum Kalam Sofyan secara sungguh-sunggu dalam menangani berbagai perkara. (rel/m07)

Medan Metropolitan

Jumat 21 Agustus 2009

Umat Islam Diminta Makmurkan Masjid MEDAN (Waspada): Dewan Masjid Indonesia (DMI) Sumatera Utara mengimbau masyarakat memakmurkan masjid dan mushalla bersamaan datangnya bulan suci Ramadhan. “Saat Ramadhan agar umat Islam dapat melaksanakan puasa dengan penuh ikhlas dan serta berusaha secara bersama-sama memakmurkan masjid dan mushalla di lingkungan tempat tinggalnya seperti shalat tarawih, zikir, membaca dan memperdalam Al Quran serta dakwah dan pengajian,” kata Ketua Umum H.M. Imran Daulay dan Sekretaris Umum H. Hasan Mansur Nasution, Kamis (20/8). Selain itu, lanjutnya, cara lain memakmurkan masjid yakni, mempercantik dan meningkatkan kebersihan masjid.Terhadap para mubalig dalam ceramahnya diharapkan dapat menitikberatkan pada penguatan iman, akhlakulkarimah, peningkatan kualitas dan kuantitas ibadah, kesederhanaan, kesejukan dan ajakan untuk memperbanyak sedekah sebagai wujud rasa kepedulian pada sesamanya. Sedangkan penggunaan pengeras suara di masjid atau mushalla dapat disesuaikan dengan kebutuhan jamaah dan tidak mengganggu masyarakat di sekitar masjid yang sudah saatnya istirahat. Tutup Hiburan Malam Sementara itu, Majelis Ulama Indonesia (MUI) Kota Medan mengimbau para pengusaha hiburan malam seperti pub, bar, diskotek, rumah biliar dan yang lainnya menutup usahanya saat bulan suci Ramadhan. “Kita sangatberharapmerekamelakukan hal ini demi menjaga kesucian

bulan Ramadhan. Demikian pula terhadap media massa agar memberikan informasi yang mampu menambah kualitas amalan ibadah kaum muslimin dan menjauhkan bacaan atau tampilan yang bisa membatalkan puasa,” kata Ketua Umum MUI Kota Medan H. M. Hatta bersama Sekretaris Umum Hasan Matsum, kemarin. MUI Medan juga mengimbau umat Islam semakin memperbanyak amalan-amalan dan memilihmakanandanminuman yang terjamin kehalalannya. Hindarimakananyangtidakhalal baik di rumah makan, hotel, rumah sakit dan lain sebagainya. MUI juga mengharapkan muballig menyampaikan materi ceramahnya berkaitan dengan keutamaan Ramadhan. Sedangkan para nazir masjid untuk mempersiapkan tempat ibadah yang baik, bersih dan nyaman. Demikian pula masjid maupun mushalla yang berada di perhotelan, pusat perbelanjaan, rumah sakit maupun tempat umum lainnya. Siarkan Ramadhan Gubsu Syamsul Arifin juga menyerukan seluruh umat Islam di daerah ini agar menyiarkan bulan suci Ramadhan 1430 H dengansungguh-sungguhsekaligus memperkokoh komitmen dan menggiatkan kepedulian sosial. Seruan itu disampaikan Gubsu kepada wartawan di ruang kerjanya, Rabu (19/8) sore, sehubu-

ngan menjelang masuknya Ramadhan. Gubsu pada kesempatan itu didampingi Kakanwil Depag Sumut Syariful Mahya Bandar, Asisten Hukkesos Asrin Naim dan Kadis Kominfo Sumut Eddy Syofian. Gubsu juga mengingatkan para bupati/walikota memantau kondisi keamanan dan kondusivitas di daerahnya masingmasing agar terjaga baik, termasuk menertibkan tempat-tempat hiburan malam yang dapat mengganggu umat Islam melaksanakanibadahRamadhansesuai ketentuan dan peraturan berlaku. “Marilah kita sambut bulan yang penuh berkah dan maghfirah ini dengan kesucian hati, kelapangan rezeki dan kekuatan iman, marilah kita satukan niat untuk saling memaafkan agar ibadah kita dapat diterima-Nya,” ujarnya. Gubsu juga mengimbau seluruh umat Islam untuk menyiarkan masjid, mushalla dengan mengisinya selain sebagai tempat untuk shalat berjamaah juga dengan kegiatan tadarus, majelis ta’lim, zikir, dialog bahkan dapat dijadikan sebagai pusat peningkatan ekonomi umat seperti yang pernah dipraktikkan Rasulullah SAW. Umat Islam juga diimbau untuk meningkatkan kepedulian sosial melalui penyaluran zakat, infakdansedekahsertadapatmenyalurkannya kepada yang mustahaq. Kepada masyarakat yang tidakmelaksanakanibadah puasa, Gubsumengharapkanagar dapat menghormati umat Islam yang sedangberpuasasehinggakerukunan umat beragama dapat tetap berjalan harmonis. (m36/m19)

Hubungan Pemerintah-Pejuang Harus Dipererat MEDAN (Waspada): Hubungan pemerintah dengan para pejuang dan perintis kemerdekaan saat ini serta ke depan, harus lebih dipererat dan dipertahankan harmonisasinya. Berkat jasa dan pengorbanan para pejuang yang tanpa pamrih, saat ini, generasi penerus bangsa bisa menikmati alam kemerdekaan. Gubsu Syamsul Arifin dan Wagubsu Gatot Pujonugroho didampingisejumlahstaf,pengurus DHD 45 Sumut dan pengurus LVRI Sumut mengatakan hal itu dalam silaturahim di rumah lima bekaspejuangdanperintiskemerdekaan Sumut di seputar Kota Medan terkait peringatan HUT KemerdekaanRIke64,Selasa(18/ 8). Dalam kunjungan itu, baik Syamsul maupun Gatot samasamamemberikaningot-ingotatau semacam uang tali asih kepada para pejuang yang dikunjungi. KunjunganpertamaSyamsul

dan rombongan dilakukan ke rumah Tengku Nurdin, 86, di JalanHayamWurukMedan.Kunjungan ke rumah ayah kandung dari almarhum Gubernur Sumut, HT Tengku Rizal Nurdin, yang gugur dalam kecelakaan pesawat Mandala Airlines di ujung landasan pacu Bandara Polonia Medan, September 2005 lalu itu, disambut penuh suka cita oleh seluruh keluarga. Gubsu kepada T. Nurdin didampingi istri dan anakanaknya mengaku, dia bersama generasi penerus bangsa yang adasaatinisangatberterimakasih dengan pengorbanan, dan jasa para pejuang kemerdekaan yang tak mengenal pamrih. Tengku Nurdin yang masih terlihat cukup sehat, walau untuk berjalan sudah harus dibantu dengan tongkat, mengaku, kunjungan ini membuat kondisi fisiknya bertambah segar.

Berikutnya, rombongan Gubsu mengunjungi rumah pejuang Brussel Sianipar, 77, di Jalan Sei Serayu Nomor 39 Medan. Di sini, rombongan juga mendapat sambutan hangat dari anak dan cucu salah satu pejuang kemerdekaan Sumut itu. Terakhir, rombongan mengunjungi rumah Djafar Masa, 83, di Jalan M Yakup Medan. Di tempat ini, Gubsu kembali menegaskan bahwa hubungan antara pemerintah dengan para pejuangnyatidakbolehputusoleh sebab apapun. Sementara itu,Wagub Sumut Gatot Pujonugroho melakukan kunjungankerumahduapejuang kemerdekaan Sumut lainnya yakni, rumah Setianna brTarigan di Jalan Merbau Nomor 3-A Medan dan rumah Firman Maruli Tua di Jalan Flamboyan VI Nomor 208 Blok 17 Perumnas Mandala Medan. (m19)

Ribuan Warga Ziarah Jelang Ramadhan MEDAN (Waspada): Menjelang tibanya bulan suci Ramadhan 1430 H, ribuan warga terlihat melakukan ziarah ke makam sanak keluarganya di komplek pekuburan yang ada di kota Medan. Pantauan Waspada, di bebepara lokasi pekuburan yang berada di kawasan inti kota seperti Jalan Sei Deli, Guru Patimpus, JalanBrigjenKatamso,JalanHalat, Thamrin, Kamis (20/8), dipadati peziarah mulai sejak pukul 10:00. Para peziarah terlihat mengunjungi pekuburan sejak pagi tersebut mencapai puncaknya pada pukul 17:30, yang mengakibatkantimbulnyakemacatanarus lalu lintas disekitar lokasi. Di antaranya di lokasi pekuburan Jalan Halat Medan yang telah menimbulkan kemacatan arus lalu lintas sejak pukul 15.00 hingga pukul 18.00. Ramainya para peziarah ke luar masuk lokasi pekuburan hinggapadatnyakenderaanparkir membuat volume arus kenderaan yang melintas tidak tertam-

pung badan jalan, kondisi itu diperparahbanyaknyaparapenjual asongan berebut konsumen. Di antaranya penjual bunga, jasa pembersih kuburan dan lainnya yang umumnya dilakukan anak-anak usia sekolah, sementara ada juga yang menawarkan jasa pencari letak kuburan bagi parakeluargayangkesulitanmencari lokasi makam kerabatnya. “Namun, ramainya pemberi jasa di lokasi pekuburan dengan mengharapkan sedikit upah membuat para peziarah tidak terlalu repot menyediakan keperluannya karena dari bunga rampai hingga air jeruk telah ada disediakan,” kata Kamaludin penjual bunga di Jalan Halat Medan. Sedangkan untuk pembersih kuburan juga telah ada mulai anak-anak hingga orang dewasa yang menyediakan jasa dari mencari letak lokasi makam hingga membersihkannya dari semak ilalang setelah hampir setahun ditinggalkan. “Hanya jasa pembacaan doa saja yang belum ada dilakukan

Waspada/Anum Saskia

TEKUN : Pelajar Perguruan Eria dari tingkatan TK, SD dan SMP tampak tekun mendengarkan materi yang disampaikan penceramah saat berlangsungnya perayaan Israk Mikraj dan menyambut Ramadhan di sekolah itu.

Pelajar Eria Cikal Bakal Generasi Islam Cerdas Dan Kuat MEDAN (Waspada) : Pelajar Perguruan Eria merupakan cikal bakal generasi Islam yang cerdas dan kuat sebab di sekolah ini ada pendidikanilmuduniadanakhirat. Penerapannya secara langsung dan bimbingan terus menerus dari para guru dan perhatian pihak yayasan. “Siapa mau cedrdas? Siapa mau kuat dan siapa mau jadi pemimpin masa depan,” tanya Ustadz H. Hamdan Yazid di hadapan ratusan para pelajar Sekolah Swasta Eria dari tingkatan TK, SD dan SMP saat perayaan Israk Mikraj serta menyambut bulan suciRamadhan1430HSabtulalu. Kemudian, semua siswa dari berbagai tingkatan itu unjuk jari ke atas dan ramai-ramai meyakinkanustadzdenganmelapalkan bacaanshalatdandoayangsetiap hari mereka lakukan. Tentu saja, ustadz Hamdan mendengarkan secara seksama dan menantikan bacaan seluruh siswa hingga selesai. Hadir Kepala SD, Rukzaidan; Kepala SMP, Nampati Ginting; Kabid Pendidikan, Sabar; Kepala TK, Sri Hidayat serta ketua panitia, M. Yusuf. Menurut Hamdan, kecerdasan siswa dapat dibentuk apabila

mereka menyadari kecerdasan itu harus diasah terus menerus dan menyerahkan diri kepada sang pencipta akal pikiran yakni, Allah SWT. “Harus yakin bahwa segala sesuatu di alam ini ada penciptanya. Terhadap pencipta harus patuh dan taat atas perintahnya,” paparnya. Hamdan mengatakan, sebelum mengawali shalat ada yang harus dilakukan yakni, membersihkan diri terutama berwudhu. Dengan wudhu seseorang akan bersih dan pikiranya akan jernih karenakeningnyadihapusdengan airpadasaatmerekalelahberpikir. Rasulullah juga mengingatkan bagi orang yang sedang marah hendaklah dia berwudhu karena wudhu itu akan menentramkan jiawanya. “Umat Islam melakukan cuci tangan sedikitnya 5 kali sehari semalam bersamaan dengan mengambil wudhu, ditambah saatakanmakan.Jadi,umatIslam insyaallah akan tetap sehat. Di sela ceramahnya, Hamdan meminta kepada para guru di sekolah ini untuk terus memberikan motivasi dan pengetahuan yang seimbang antara pengetahuan umum dan agama,

terutama praktik yang harus dilaksanakan di sekolah. Bagaimanapun, lanjutnya, siswa yang cerdas dengan pengetahuan duniawi harus diimbangi dengan kemauan untuk melaksanakan amal ibadah. Sekolah ini, katanya, telah mempunyai sarana dan prasarana yang cukup untuk mendukung proses belajar mengajar serta praktik ibadah. Seiring menyongsong datangnyaRamadhan,diaberpesan agar para pelajar dan para guru semakinmempereratsilaturahim dansalingmemaafkan.Sebelumnya, Kepala SD Eria, Rukzaidan, mengatakan, kegiatan ini sengaja dilangsungkan dengan mengandalkan tiga tingkatan (TK, SD dan SMP). Harapannya mereka saling memahamibahwadalamjenjang pendidikan yang berbeda, mereka bisa disatukan untuk mendapatkan pengetahuan. Di samping itu, menjadi bukti pelajar di sekolah ini dari tingkatan termuda sampai jenjang menengah mampu menyerap berbagai pengetahuan yang disampaikan oleh pembicara.Acaradiawalipembacaan kitab suci Al Quran oleh Munawarah Nst dan sari tilawah oleh Melati Kesuma Wardani. (m36)

Waspada/Sugiarto

DITANGKAP: Beberapa petugas keamanan kampus USU menangkap beberapa orang yang mengaku sebagai mahasiswa USU saat melakukan aksi unjuk rasa di kampus tersebut, Kamis (20/8). orang untuk keperluan peziarah ini,” lanjutnya. Sementara Samsudin, warga Delitua,yangmerupakanpegawai kantor Dinas Perindustrian dan Perdagangan Medan saat melakukan ziarah membenarkan disamping membersihkan makam pihaknya bersama keluarga juga memanjatkan doa. Makam di areal pekuburan tersebut merupakan salah seorang anaknya yang wafat beberapa tahun lalu saat bertempat tinggal di sekitar kecamatan Medan Area. Sedangkan omset penjual bunga yang telah berdagang sejak dua hari sebelumnya pada hari Minggu mendadak naik 100 persen lebih. “Penjualan bunga keperluan ziarahmeningkat,biasanyahanya laku Rp25 ribu kini penjualan sudahRp55ribu,sementaraharga bunga mulai dari Rp1000 untuk dua bungkus hingga Rp3000 per bungkus,” kata Ismah. penjual bunga musiman di pekuburan Jalan Halat Medan.(m40)

Petugas Keamanan USU Bentrok Dengan Mahasiswa MEDAN (Waspada): Petugas keamanan Universitas Sumatera Utara (USU) bentrok dengan belasan orang yang mengaku mahasiswa kampus tersebut saat melakukan aksi unjuk rasa yang menolakUndangUndangBadan Hukum Pendidikan (UU-BHP). Peristiwa tersebut diawali dengan aksi belasan mahasiswa yang tergabung dalam Aliansi PerjuanganMahasiswa(Alpamas) USU bertepatan dengan berlangsungnya pelaksanaan acara puncak Peringatan Dies Natalis USUyangke-57,digedungAuditorium, Kamis (20/8), yang berjarak sekitar 50 meter dari samping gedung tersebut. Pantauan di lokasi, awalnya aksi tersebut berlangsung damai dan diawasi para petugas keamanan kampus. Para pengunjuk rasa membentang spanduk penolakanUUBHPsambilmembawa alat musik dan bernyanyi. Kemudian petugas keamanan mencoba membubarkan aksi, karena hal tersebut dinilai dapat mengganggu pelaksanaan acara dies natalis tersebut yang dihadiri Gubsu dan para pejabat baik dari

Sumut maupun kedutaan asing. Pada saat itu, para mahasiswa menolak untuk dibubarkan, namun saat ditanya identitas tanda pengenal mahasiswa USU, sebagian pengunjuk rasa tidak bisa memperlihatkannya dan secara tiba-tiba salah seorang dari mereka melarikan diri dan langsung dikejar petugas keamanan dan menangkapnya. Kepala securiti kampus USU, Wara Sinuhadji, yang ada di lokasi padasaatitu,mengatakan,bahwa mereka bukan mahasiswa USU yang akan merusak citra kampus USU karena tidak memiliki kartu tanda mahasiswa USU. “Kalau mereka memang benar mahasiswa USU, seharusnya mereka menjaga nama baik USU dan menjaga agar acara yang sakral, Dies Natalis USU ini berlangsung dengan aman dan lancar,” tutur Wara. Padasaatditangkapdanakan dibawauntukdiintrogasi,petugas keamanan kampus mendapat perlawanan dari pengunjuk rasa, sehinggabentrokanpuntidakbisa dihindarkan. Bahkan, beberapa mahasiswa USU yang tidak ikut

unjuk rasa, ikut membantu petugaskeamananuntukmembubarkan aksi tersebut, karena merasa dicemarkan nama baiknya sebagai mahasiswa USU. Tidak berapa lama kemudian, para pengunjuk rasa pun menyerah dan membubarkan diri, setelah beberapa staf pengajar dan dosen turun untuk memberikan nasehat kepada para pengunjuk rasa, begitu juga dengan oknum yang mengaku sebagai mahasiswa USU juga dilepaskan. Kabag Ketertiban dan Keamanan Sekretaris Eksekutif USU, Drs. Muchtar, saat dimintai keterangannya mengatakan, pihaknya tidak pernah melarang mahasiswa melakukan aksi demonstrasi asalkan tidak sampai menggangu aktivitas kampus lainnya. “Namun, sekarang kan lagi ada prosesi peringatan Dies Natalisdanbanyakdihadiritamutamu dari luar, seharusnya mereka tidak melakukan pada saat seperti ini. Ini tentunya dapat memberi citra yang tidak baik kepadamasyarakattentangUSU,” katanya. (m41)

Sistem Perhubungan Perlu Dirapikan

Konseling Penting Bagi Siswa MEDAN (Waspada): Setiap konselor perlu memahami prinsipprinsip konseling bagi siswa sehingga bimbingan konseling bisa menormalkan kembali prilaku siswa yang terkena narkotika, alkohol, psikotropika dan zat adiktif (NAPZA), Pakar psikologi asal Universitas Gajah Mada (UGM), M. Noor Rochman Hadjam mengungkapkan hal itu dalam seminar yang diselenggarakan Program Pascasarjana (PPs) Magister Psikologi UMA di kampus II UMA Jalan Sei Serayu Medan, Rabu (19/8). Prinsip konseling bagi siswa, lanjutnya, merupakan tatap muka antara konselor dengan siswa.Tatap muka dilakukan secara terencana guna mencari solusi alternatif pemecahan masalah yang dihadapi.Namun diakuinya konseling bukan kotak ajaib yang memberikan sejumlah pemecahan masalah tetapi konseling mengandung unsur pembelajaran, pengenalan diri serta pengembangan diri bagi siswa. (m29)

WASPADA

Waspada/Sahrizal

ZIARAH: Ribuan peziarah mendatangi lokasi pekuburan Jalan Halat Medan menjelang tibanya bulan suci Ramadhan 1430 H.

MEDAN (Waspada): Sistem perhubungan di Sumatera Utara ke depan perlu lebih dirapikan agarbisaberjalanlebihtertibmendukung program dan kelancaran arus wisata. Di samping itu mencegah percepatan kerusakan badan jalan. Hal itu disampaikan anggota DPRDSU, Syukran Tanjung, menyikapi kinerja Kadishub Naruddin Dalimunthe, yang dinilainya sudah berada di rel yang benar. “SejauhinikinerjaKadishubProvsu sudah cukup maksimal,” katanya kepada wartawan, Rabu

(19/8). Langkah merapikan Sistem Perhubungan ini misalnya, telah dimulai dilakukan Dishub Sumut di Berastagi berupa larangan masuk truk-truk besar khususnya pada Sabtu-Minggu dan hari-hari besar. Tujuan kebijakan itu agar tidak terjadi arus kemacetan yang sangat parah seperti sering terjadi selama ini sehingga warga masyarakat dan turis yang ingin menikmati liburan ke salah satu daerah tujuan wisata Sumut itu tidak terganggu. Syukran mengapresiasi dan

menyambut baik kinerja positif yang telah diperlihatkan NaruddinDalimunthe.Iamengingatkan semuakalanganhendaknyatidak mudah menuding seorang pejabat tidak becus bekerja dan ingin agar yang bersangkutan dicopot. Atas dasar itu pula Wakil Ketua Fraksi Partai Golkar ini menyatakan dukungan sepenuhnya kepadaKadishubagarmelakukan reposisi di jajarannya mengacu pada prinsip right man on the right place, agar semua program kerja telah dicanangkan bisa berjalan optimal.(h11)

Medan Metropolitan

WASPADA

Jumat 21 Agustus 2009

11

Warkop Harapan Dibongkar Di Jl. Selayang, Ringroad Dirazia MEDAN (Waspada): Pj Walikota Medan Rahudman Harahap memimpin pembongkaran warung kopi (warkop) yang terletak di belakang kampus Yayasan Pendidikan Harapan Medan yakni Jalan Samanhudi dan Jalan Misbah. Warkop itu saat ini sudah menjadi multi fungsi sehingga tidak tertata lagi dengan baik. Pembongkaran itu dikatakan Rahudman Harahap bersama Sekda Kota Medan Dzulmi Eldin saat melakukan razia di lokasi itu dan sejumlah cafe remang-remang di Jalan Selayang dan Ringroad, Kamis (20/8) dinihari bersama Kapoltabes Medan

Kombes Pol Imam Margono dan unsur muspida lainnya. “Mulai hari ini (kemarin-red) semua warkop yang ada di kawasan Jalan Sudirman khususnya Jalan Samanhudi dan Misbah harus dibongkar karena sudah melanggar estetika Kota Medan.

Polisi Diminta Tangkap Pelaku Penikaman MEDAN(Waspada):HotmauliSiburian,33,wargaJalanPertahanan 20, Desa Sigaragara, Kec. Patumbak, meminta Kapolsekta Patumbak menangkap lima lagi pelaku penikaman terhadap dirinya. “Satu orang sudah ditangkap, namun lima lagi pelakunya masih bebas berkeliaran,” kata sopir Angkot‘Rajawali’ ini didampingi istrinya Frida Kristiani Manik di kediamannya, Senin (17/8). Siburian menyebutkan, akibat tikaman tiga liang yang bersarang di badannya itu, dirinya harus menjalani 2 kali operasi dengan menghabiskan biaya Rp30 juta. Belum termasuk biaya tebus resep obat. Siburian menuturkan peristiwa penikaman itu terjadi pada 5 Agustus lalu di Jalan Pertahanan Patumbak ketika dirinya membawa angkot. Tiba-tiba angkot ‘Rajawali’ lain yang dikemudikan Erwin menyelip dari belakang hingga mengenai kaca spion angkotnya. Siburian mengejar angkot Erwin dan menanyakan permasalahannya. Erwin menyalahkan Siburian mencuri sewanya di pinggir jalan dan tidak memutar ke Terminal Amplas. Meski perdebatan mereka sempat mereda, namun beberapa jam kemudian Erwin dan lima temannya menyetop angkot Siburian dan langsung menikam korban 3 liang. Istri korban Frida Kristiani ManikmelaporkanperistiwakePolsektaPatumbak.Petugasmenangkap Erwin namun lima lagi belum tertangkap. (cat)

Walikota Dukung Lomba Rakit MEDAN (Waspada): PjWalikota Medan membuka perlombaan dayung rakit tradisional memperebutkan piala Walikota Medan I di bantaran Sungai Deli, Lingkungan XXX, Kelurahan Rengas Pulau, Kecamatan Medan Marelan, Minggu (16/8). Ketua panitia lomba, Darussalam Pohan, mengatakan, sebanyak 91timasalKotaMedandanBinjaiikutsertadalamrangkamemeriahkan HUT RI ini. Pemenang lomba mendapatkan hadiah berupa piala bergilir dan piala tetap serta sejumlah uang pembinaan. Sementara itu, Pj Walikota Medan, Rahudman Harahap, mengatakan empat sungai yang mengitari Kota Medan, termasuk Sungai Deli, bisa dijadikan lokasi perlombaan olah raga tradisional seperti lomba rakit dan arung jeram. “Saya mendukung lomba dayung rakit tradisional Sungai Deli itu menjadi titik awal berkembangnya olah raga tradisional di kota ini,” ujarnya. Namun, persiapan yang tidak maksimal lomba rakit ini membuat sejumlah peserta kecewa. (cre)

Untuk itu, kepada Satpol PP segeralaksanakanpembongkaran,” kata Rahudman. Dikatakannya, sebenarnya Pemko Medan tidak ingin menggusur para pedagang yang ada di kawasan tersebut, namun harus sesuai dengan ketentuan dan peraturan yang ada. Jadi, pedagang boleh berjualan tapi harus ditata dengan baik agar terlihat rapi dan tidak kumuh. “Kita ketahui warkop Harapan sangat populer sebagai lokasi tongkrongan warga Medan. Untuk itu perlu penataan yang lebih baik, sehingga terlihat asri dan tidak melanggar Perda,” tegasnya. Tapi kalau melanggar peraturan, lanjutnya, harus dibongkar dengan segera. Mana ada tendatenda jualan berdiri di atas jalan. Itu suatu kesalahan besar, karena dapatmenggangguaruslalulintas. Apalagi,tambahnyadengankesal, cafe itu bukan lagi tempat jual makanan saja, namun sudah

multi fungsi dengan lampu remang-remang,” ujarnya. Untukitu,tambahnya,pihaknya meminta kepada Satpol PP bersama muspika kecamatan Medan Maimon membongkar semua tenda-tenda tersebut, dan melakukan pengawasan ketat agar tidak berdiri lagi kalau tidak ditata dengan baik. “Sayasikathabissemuapedagang yang melanggar peraturan. Kita ingin menegakkan peraturan dan menginginkan Kota Medan menjadi kota metropolitan, madani dan religius,” imbuhnya. Dirazia Dari warkop Harapan, rombongan begerak ke cafe remangremang di Jalan Selayang dan Ringroad untuk melakukan kegiatan serupa. Melihat kehadiran tim terpadu Pemko Medan para tamu cafe berlarian menghindar. Ada juga pengunjung bernasib sial, dan ditangkap tim saat asyik di dalam kamar yang tersedia di cafe itu. Namun, setelah

diberikan pengarahan dan nasehat mereka dilepas. Sedangkan kepada pengusaha cafe, Rahudman mengimbau untuk mengurus izinnya. “Mereka bisa membuka usaha dengan ketentuan tidak melanggar Perda. Namun, untuk sementarainimerekaharustutup karena izinnya tidak ada, dan melanggar peraturan,” pungkasnya. Dari pantauan Waspada, razia yang dilakukan Pemko Medan sudah terlebih dahulu bocor dan terkesan tidak serius. Pasalnya, sejumlah cafe di kawasan itu sudah tutup dan banyak cafe hanya dilewati. Tim sempat singgah di karoke M City Jalan GatotSubrotosimpangbundaran Majestik. Di tempat itu, Rahudman dan rombongan hanya bertemu dengan manager M City di ruang lobi tanpa melakukan razia ke kamar-kamar. Sekitar 30 menit pertemuan, rombongan keluar meninggalkan tempat. (h10)

Honda Sukses Launching Matik Terbaru MEDAN (Waspada): Acara Dunia Matik Honda, di halaman Istana Maimoon, Sabtu (15/8), berlangsungsukses.Kegiatanyang bertujuan untuk memperkenalkan tiga matik terbaru Honda yakni Honda BeAT new Hit, Honda Vario dan Honda Vario Techno ini memberikan hiburan berkualitas bagi pengunjung. Kehadiran tiga matik terbaru yang mengambil Honda Matik pilihan semua ini mampu menarik minat beli masyarakat. Vario Techno yang dirancang dengan konsep Hi-Grade & Hi-Tech’ menarik perhatian pengunjung. Pengunjung tampak bersemangatmencaritahukeunggulan system pengereman yang dinamakanCombi Brake pada Honda Vario Techno tersebut. Di lokasi test ride dan zona presentasi

produk antrian pengunjung silih berganti mencoba dan melihat keunggulansystemyangpertama dan satu-satunya tersebut. “Combi Brake pada Honda Vario sebagai fitur pertama dan satu-satunya di Indonesia dapat diterima dengan sangat baik oleh pengunjung acara ini. Combi Brake menjadi jawaban kenyamanan pengereman sepeda motor matik karena pengendara dapat sekaligus melakukan pengereman roda depan dan belakang dengan hanya menarik rem di tangan kiri. Dan yang tidak kalah menarik adalah kehadiran Honda Vario dan BeAT terbaru,” ungkap Leo Wijaya, marketing manager CV. Indako Trading Co. Selain itu, keberhasilan penjualan ini juga tidak terlepas

dari konsep acara yang mampu menyedot keinginan masyarakat Kota Medan mengunjungi acara ini.Acaradimulaidengankegiatan FunRallyterbesarnasional.Jelajah Kota yang diikuti oleh 668 peserta. Di sore hari, pengunjung dihibur dengan kehadiran artis ibukota Cinta Laura dan hiburan puncak dimeriahkan oleh kehadiran Deddy Corbuzier selain festivalfestival remaja antara lain model festival, cheersleader festival dan festival pertama terbesar di Sumatera yakni Honda Magic festival. “Meriah sekali, banyak hiburan dan hadiahnya seperti pasar malam saja. Benar-benar menarik. Combi Brake pada Honda Vario Techno juga sangat menarik,” ungkap Jimmy, pengunjung acara. (Adv)

PP Bagi Daging Punggahan MEDAN(Waspada):MenyambutdatangnyabulansuciRamadhan 1430 H yang jatuh pada 22 Agustus 2009, sekaligus momentum memperingati HUT Kemerdekaan Ke-64 RI, Majelis PimpinanWilayah Pemuda Pancasila (MPW PP) Sumut melakukan pemotongan lembu untuk dibagi-bagikan (punggahan, red) kepada kader PP serta masyarakat, Kamis (20/8). Ketua MPW PP, Sumut, Anuar Shah, mengatakan kegiatan pemotongan dan bagi2 daging sapi ini adalah agenda rutin yang dilakukansetiaptahunnyamenjelangdatangnyabulansuciRamadhan. Tokoh pemuda yang akrab disapa Aweng ini menjelaskan kegiatan ini merupakan bentuk kepedulian Pemuda Pancasila terhadap kader dan keluarga besar Pemuda Pancasila menjelang masuknya bulan suci Ramadhan. “Kegiatan ini telah berlangsung dua tahun sejak kepemimpin kami. Kegiatan ini rutin kita lakukan setiap tahunnya menjelang puasa, sebagai bentuk kepedulian Pemuda Pancasila terhadap para kader dan warga sekitar yang kurang mampu,” ujar Aweng. Tokohyangdikenalmemilikitingkatkepedulianyangtinggikepada anggota PP dan masyarakat kurang mampu ini menjelaskan, empat ekor lembu disembelih pada tahun ini. “Tiga ekor disembelih di Sekretariat MPW PP Sumut, dan seekor lagi disembelih di kediaman saya,” ujarnya. Aweng berharap semua kader Pemuda Pancasila dapat merasakan kebersamaan dari apa yang sudah Pemuda Pancasila lakukan saat ini.“Danmenjadikanpuasatahuninilebihbaikdaritahunsebelumnya,” ujar Aweng. Hadir saat pemotongan, Wakil Ketua MPW PP Sumut, Boyke Turangan dan Firdaus Nasution, Sekretaris Dahroel Thamin, Wakil Sekretaris, Sastra, dan unsur pengurus MPW PP Sumut, H. Ismail, M. Iqbal, Rudi Sudjadi serta Kordinator Pokja Humas MPW PP Sumut, H. Idrus Djunaidi. (m08)

Waspada/Ist

SEMBELIH LEMBU: Ketua MPW PP Sumut, Anuar Shah, terlihat menyembelih lembu untuk ‘punggahan’ menyambut Ramadhan 1430 H, Kamis (20/8). Daging tersebut dibagikan kepada kader PP dan masyarakat kurang mampu.

Dosen FKIP UMSU Raih Prestasi MEDAN (Waspada): Koordinator Kopertis Wilayah I SumutNAD menetapkan Syamsuyurnita, ketua program studi (Prodi) Pendidikan Bahasa & Sastra Indonesia pada Fakultas Keguruan dan Ilmu Pendidikan Universitas Muhammadiyah Sumatera Utara sebagai juara I pada pemilihan Ketua Prodi Berprestasi bagi Ketua Program Studi PTS se-Kopertis Wilayah I tahun 2009. GelarjuaraIitudiraihnyapadapenyelenggaraanlomba,sayembara dan festival untuk pembinaan akademik dan kemahasiswaan. Kopertis menilainya berdasarkan beberapa kriteria, antara lain, kemampuan mengelola program studi dan melaksanakan Tri Dharma Perguruan Tinggi. Kepala Humas UMSU, Anwar Bakti, di ruang kerjanya, Rabu (18/8), mengatakan, Syamsuyurnita pada 2007 juga berhasil meraih gelardosenberprestasidilingkunganUMSUdanmeraihjuaraharapan II dosen terbaik se-Kopertis Wilayah I Sumut-NAD. Bahdin Nur Tanjung, rektor UMSU melalui Humas, baru-baru ini, mengatakan keberhasilan ini menjadi motivasi bagi ketua-ketua Prodi lainnya agar menjadi yang terbaik. (m29)

Waspada/ist

MERIAH: Acara Dunia Matik Honda di halaman Istana Maimoon yang dimeriahkan artis ibukota dan daerah, berlangsung sukses beberapa hari yang lalu.

Waspada/ME Ginting

RAZIA: Pj Walikota Medan Rahudman Harahap didampingi Kepala Inspektorat Pemko Medan HM Fitrius ikut razia dan memergoki sepasang insan yang tertangkap dalam kamar oleh tim terpadu Pemko Medan, Kamis (20/8) dinihari.

Poltabes Diadukan Ke Kapolri MEDAN (Waspada): Pengacara dari Lembaga Bantuan Hukum (LBH) Medan selaku kuasa hukum dari H. Usman Ahmad Balatif, 63, melayangkan surat pengaduan kepada Kapolri dan Ketua Komisi Kepolisian RI terkait penangkapan dan penahanan yangdilakukanPoltabesterhadap kliennya. Penangkapan itu dinilai bentuk kriminalisasi perkara perdata. Surat pengaduan itu dikirim pada 11 Agustus 2009 dengan tembusan Komisi III DPR RI, Kapoldasu, Ketua DPRD Sumut, danKapoltabesMedan.Demikian disampaikan Ali Rahmansyah P Piliang,SHdariLBHMedankepada Waspada, Kamis malam lalu. Menurut Piliang, kliennya H. Usman Ahmad Balatif pada 11 Juli 2009 telah ditangkap dan ditahan oleh Poltabes karena dituduh melakukan tindak pidana pemalsuan surat atas laporan Ir. AliUmarpada10Desember2001. Disebutkan, Poltabes dalam melakukan penangkapan dan penahanan terhadap kliennya tidakterlebihdahulumenganalisis

dan mengkaji secara mendalam surat yang mana dipalsukan atau dugaan tindak pidana yang dituduhkan kepada kliennya, tidak berdasarkan bukti permulaan. Kata Piliang, semestinya Poltabes mengkaji apa kepentingan hukum dari Ir Ali Umar terhadap keberadaan SPPMAI dan kerugian apa dialaminya tetapi hal itu tidak dilakukan dan malah terkesan arogan dalam penanganan perkarainiyangtidakmemahami posisi kasus dan keliru dalam menjalankan proses hukumnya. Kasus tanah Dalam kasus berbeda, Poltabes juga dilaporkan ke Kapolri Jenderal Bambang Hendarso DanuriolehFadlanZuchri,korban yang juga ahli waris. Pasalnya, selama 8 tahun dia tidak mendapatkan kepastian hukum dari pihakpenyidikUnitReserseUmum (Resum) Poltabes terkait kasus surat tanah dengan Surat KeteranganNo.048/SKT/MBRT/1981 tanggal31Oktober1981atasnama Fachrudin Lubis. “Laporan ini didasarkan karena pihak Poltabes Medan

mengatakan dari hasil penyidikannya tidak cukup bukti dalam perkara pidana. Namun, Poltabes tidak bisa mengeluarkan Surat Pemberitahuan Penghentian Penyidikan (SP3) secara resmi atas tanah di Jalan Amir Hamzah seluas816m2sesuaidengansurat tanah,” kata kuasa hukum ahli waris, Febris, SH, Selasa (18/8). Disebutkan, Poltabes melalui pemberitahuan perkembangan hasil penyidikan yang ditandatangani Kasat Reskrim, Kompol Gidion Arif Setyawan, menyebutkan, apabila surat keterangan tanah nomor 048/SKT/MBRT/ 1981 tanggal 31 Oktober 1981 atas nama Fachrudin Lubis dari pemenang lelang, Fenny Leng, ditemukan akan dilakukan pemeriksaan ke Laboratorium Forensik Polri cabang Medan dengansuratyangsamadipegang oleh korban (pelapor). Setelah dilakukan penggeledahan tidak ditemukan Surat Keterangan No 048 itu di kediaman saksi, Selamat Thema alias Liong Seng, di Jalan Jambi No 12 A Medan pada 25 Juli 2009. (m31/m39)

148 Tersangka Narkoba, Togel Dan Premanisme Diciduk MEDAN (Waspada): Dalam sebelas hari Operasi Pekat (OP) II Toba 2009, Polsekta Medan Baru mengamankan 148 tersangka kasus narkoba, togel, premanisme, miras dan penyakit masyarakat secara terpisah. Demikian dikatakan KapolsektaMedanBaru,AKPMAdenan AS, SH,SIK didampingi Kanit Reskrim, Iptu M Faruk Rozi, kepada Waspada, Selasa (18/8) sore. Menurutnya, narkoba ada 2 kasus dengan 4 tersangka dan barang bukti 12 amplop ganja, 8 butir pil ekstasi. Judi toto gelap 12 kasus dengan 18 tersangka dan barang bukti uang Rp560.000, 7 pulpen, 7 HP merek Nokia, 19 lembar potongan kertas berisikan rekapan nomor togel, 1 buku tafsir mimpi. Premanisme55orangdanbarang bukti 2 blok karcis parkir, 15

lembar kertas karcis parkir, uang Rp98.500, 11 lembar bed parkir yang habis masa berlakunya. 15 tersangka kasus miras dan barang bukti, 610 botol minuman keras terdiri dari Topi Miring, Asoka, Mansion, Scot, Mutiara, Grove House, Wisky, Anggur Merah, Jhon Robet. Berikut 27 PSK, 9 waria, tiga pasang pria, waria lagi asyik, 8 kasus pencurian sepeda motor dan perampokan. Menurut Adenan, tersangka yang resmi ditahan adalah kasus narkoba, togel, pencurian sepeda motor dan perampokan. Sedangkan, 27 PSK kini dibina di tempat penampungan di Parawarsa di Berastagi. Sementara, kasus miras, pramanisme dan waria diamankan 1x24 jam, selesai menjalani pemeriksaan mereka dibenarkan pulang dan sebelum-

nya membuat surat pernyataan agar tidak terulang kembali. Operasi Pekat II Toba 2009 terusdilakukanagarumatmuslim menjalankan ibadah puasa Ramadhan aman dan tenteram serta kamtibmas tetap kondusif. Selainitu,kataAdenan,pihaknyatelahmenurunkantimsusnya yangdipimpinKanitReskrimIptu M Faruk Rozi mengumpulkan informasi di lapangan masalah peredar mercon di wilayah hukumnya. “Kita tidak mau umat Islam yang melaksanakan sholat tarawih terusik karena ledakan mercon,”tegasKapolsektaMedan Baru. Dia juga mengatakan, pihaknyaakanmelakukanraziatempat kos,hotel,pantipijat,ukup,karaoke,diskotik,salonkecantikanyang berubah fungsi jadi lokasi karaoke, prostitusi dan lainnya. (m31)

12

WASPADA Jumat 21 Agustus 2009

Tarawih 11 Rakaat Dari Nabi SAW 23, 26, 36, 40 Rakaat Dari Ulama

Oleh Dr. Arifin S. Siregar

S TAJUK RENCANA

Puasa; Khidmat Dan Berkah

I

nsya Allah, Jumat (21/8) malam ini umat Islam memulai shalat tarawih bersama di masjid, mushalla, ataupun rumah sebagai pertanda tibanya 1 Ramadhan 1430 Hijriah. Suasana Ramadhan tahun ini diharapkan bisa lebih kondusif, khidmat, dan bernaung berkah melimpah, jika semua pihak bisa menyadari, memahami, dan mendukungnya dengan cara saling menghormati. Sudah barang tentu, yang paling beruntung adalah umat Islam, mengapa? Sebab, puasa Ramadhan hanya milik kaum Muslimin yang beriman. Jika umat Islam menjalankan puasa dengan penuh keimanan dan mengharapkan ridha Allah SWT maka imbalan pahalanya berlipat ganda. Bahkan, Allah SWT menjanjikan amalan puasa Ramadhan ini surga, di mana Dia sendiri yang menilainya kelak. Oleh karena itu, sangat merugilah umat Islam bila sampai mengabaikan datangnya bulan suci Ramadhan tahun ini, dengan tidak berpuasa, tidak pula menjalankan ibadah serta amalan-amalan lainnya. Lebih parah lagi, bila di bulan baik ini amal perbuatannya semakin menurun. Apalagi semakin jauh dari ajaran Islam. Hemat kita, bulan ini merupakan momentum yang pas untuk kita (umat Islam) untuk merenung, introspeksi diri, bertafakkur —apakah amal ibadah dan perbuatan yang kita lakukan setahun lalu benar-benar sudah sesuai dengan syariat Islam, seperti tuntunan Al-Quran dan hadits Rasulullah. Jika belum, saatnya kita memohon ampunan Allah SWT, dan mengubah kebiasaan buruk yang masih melekat, sehingga di masa mendatang kita menjadi hamba Allah yang beruntung. Tentu saja puasa Ramadhan bisa menjadi menyenangkan, membuat jiwa tenang, dan menimbulkan menggembirakan bagi umat Islam dan orang-orang Mukmin yang mengerti kebesaran Ramadhan. Sebaliknya, datangnya Ramadhan ini bisa sebaliknya, menggelisahkan, merasa suntuk, bahkan merasa tersiksa, terutama bagi orang-orang yang ingkar terhadap Allah SWT. Mereka merasa tidak leluasa makan, minum, merokok, bahkan berbuat asusila (maksiat). Bagi umat Islam yang kaffah datangnya Intisari bulan Ramadhan layaknya disambut dengan sukacita. Sebab, belum tentu tahun Selamat menjalankan depan kita masih bisa bertemu dengan lagi. Oleh karena itu, mari kita ibadah puasa. Mari kita Ramadhan isi bulan baik ini dengan melaksanakan jalani dengan penuh ke- puasa di siang hari dengan penuh keimanmengerjakan shalat lima waktu dengan imanan, meskipun berat an, lebih khusu’ dan melaksanakan amalan cobaan menghadang. lainnya, seperti bersedekah, tolong-menolong, membaca tadarus Al-Quran, mengkaji kandungan Al-Quran, berzikir, memperbanyak amalan di malam hari; shalat sunah tarawih, witir dll. Terkait dengan maraknya peristiwa bom dan aksi terorisme di tanah air, di mana umat Islam sampai ‘’ternoda’’ karena selalu dikaitkan dengan aksi-aksi kekerasan yang terjadi di muka bumi ini, sudah semestinya mendapat perhatian kita semua, terutama kalangan ulama, ustad, dai, guru mengaji dll. Justru itu, di Ramadhan ini mari kita perbanyak belajar mendalami isi kandungan Al-Quran sehingga dapat menjelaskan arti dan makna ayat-ayat yang terkandung di dalamnya. Jangan sampai ayat Al-Quran dibaca sepotong-potong sehingga melenceng dari arti sebenarnya. Makna ‘’jihad’’ dan ‘’fisabilillah’’ misalnya, jangan sampai disalahgunakan oleh sementara pihak dengan menghalalkan kekerasan dan kerusakan terhadap alam dan sesama manusia. Ingat! Islam adalah agama yang anti-kekerasan. ‘’Islam rahmatan lil-alamin’’. Oleh karena itu, pengertian jihad harus benar-benar dimengerti sesuai konteksnya. Tidak satu ulama pun yang membenarkan aksi teror seperti dilakukan gembong teroris dr Azhari dan Noordin M. Top. Kedua gembong teroris asal Malaysia itu sudah salah mengartikan jihad. Apalagi memilih Indonesia sebagai gelanggangnya berjihad. Sebab, Indonesia bukan daerah perang antaragama, konflik yang terjadi selalu dapat didamaikan, tanpa kekerasan. Lain halnya, kalau jihad dilakukan di Afghanistan, Palestina dan negara-negara lain, di mata umat Islam dizalimi oleh penguasa diktator. Mudah-mudahan puasa Ramadhan tahun ini berjalan penuh khidmat dan berkah. Dan peningkatan beribadah itu tidak hanya di awal Ramadhan saja; masjidmasjid ramai dengan jamaah, tetapi setelah memasuki separuh Ramadhan kelihatan grafik penurunan. Makin ke penghujung Ramadhan kita harus lebih khusu’ karena di sana terdapat malam seribu bulan (‘’lailatul qadar’’). Tak pelak lagi, Ramadhan wajib kita jalankan dengan sebaik-baiknya meskipun banyak cobaannya. Dan kita berharap, suasana yang baik ini dapat dimengerti oleh pihak-pihak lain juga menghormati orang-orang yang berpuasa. Sebab, Ramadhan memberikan berkah buat semua orang. Tidak hanya kepada saudara kita yang miskin, tetapi juga non-Muslim. Biasanya pengeluaran umat Islam meningkat di bulan puasa dan hari raya Idul Fitri. Selamat menjalankan ibadah puasa dengan jiwa bersih. Semoga amal ibadah kita diterima-Nya. Amin.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksiwaspada@gmail.com KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

halatul lail/qiyamul lail/qiyamul Ramadhan/shalat tarawih/shalat tahajjud adalah nama lain dari shalat malam yang dilakukan Nabi SAW atau sahabat. Disebut qiyamul Ramadhan karena shalat malam itu di bulan Ramadhan. Disebut shalat tahajjud karena dilakukan setelah tidur malam. Disebut shalat tarawih karena dilakukan secara santai (istirahatistirahat, santai-santai). (Kitab “Sekitar Masaalah Taraweh” oleh KHE Abdurrahman, Penerbit Bandung, hal : 1-28). Adalah lucu kita ini, meskipun Nabi SAW melakukan qiyamul Ramadhan dengan santai, tidak buru-buru, namun tidak menamakannya shalat tarawih, tapi kita menamakan shalat tarawih (= santai) dari qiyamul Ramadhan itu, justru kita tidak melakukannya dengan santai, tapi terburu-buru (“express“). Jadi jangan harap anda bisa jumpa kata “shalat tarawih“ pada hadist atau atsar yang menjelaskan shalat malam. Semua menggunakan kata shalatul lail atau qiyamul Ramadhan. Nah, kalau ada ustad mengatakan Nabi SAW tak pernah melakukan shalat tarawih, itu ustad “ngelamun“. Padahal qiyamul Ramadhan Nabi SAW, itulah shalat tarawih Nabi SAW seperti yang kita namakan. Cuma masalahnya apakah 11 rakaat atau 21, 23, 26, 36, 40 rakaat yang dilakukan Nabi SAW ? Pada judul “Tarawih 11 Rakaat dari Nabi SAW dan 21, 23, 26, 36, 40 rakaat dari pendapat kalangan ulama“ mari kita kaji buktinya ! Tarawih 11 Rakaat Shalat tarawih 11 rakaat, rujukannya (sandaran hukumnya) adalah : 1. HR Bukhari dan HR Muslim: Dari Abi Salamah bin Abdurrahman bahwasanya ia bertanya pada Aisyah RA tentang shalat Rasulullah SAW di bulan Ramadhan. Maka ia menjawab: “Tidak pernah Rasulullah SAW kerjakan di bulan Ramadhan dan di luar Ramadhan lebih dari 11 rakaat. Ia shalat 4 (rakaat) jangan engkau tanya tentang bagus dan panjangnya, kemudian ia shalat 4 (rakaat) jangan engkau tanya panjang dan

bagusnya, kemudian ia shalat 3 rakaat“. 2. HR Thabarani dan Ibnu Nashr : Dari Jabir bin Abdullah RA ia berkata: Rasusullah SAW pernah shalat bersama kami di bulan Ramadhan 8 rakaat dan witir (3 malam berturut-turut). Maka pada hari berikutnya (hari ke empat) kami berkumpul di masjid dan mengharap beliau ke luar (untuk shalat), tapi ia tidak keluar hingga kami masuk waktu pagi, kemudian kami masuk kepadanya (datang ke kamarnya), lalu kami berkata : Ya Rasulullah ! Tadi malam kami telah berkumpul di masjid dan kami harapkan orang mau shalat bersama kami, maka sabdanya : “Sesungguhnya aku kawatir (shalat itu) akan diwajibkan atas kamu sekalian“. (Kitab “Kelemahan Riwayat Tarawih 20 Rakaat“ oleh Syeikh Nashiruddin Albani, hal.17). 3. HR Malik-al Muwath-tha’I : 137,138 : Dari Muhammad binYusuf dari as-Saaib bin Yazid bahwasanya ia berkata: UmarRAtelahmemerintahkanUbay bin Ka’ab dan Tamim ad-Daary mengimami orang-orang dengan 11 rakaat. Ia berkata : “Imam pada waktu baca ratusan ayat, sehingga kami bersandar dengan tongkat karena lamanya berdiri dan kami tidak selesai kecuali menjelang fajar“. Maka jelaslah bagi kita dengan hadist pertama dan hadist kedua menunjukkan Nabi SAW dan sahabat melakukan shalat malam (tarawih) tidak lebih dari 11 rakaat. Inilah contoh atau pedoman jumlah rakaat shalat malam (Qiyamul Ramadhan)/shalattarawihyangdikerjakanNabi SAW dan shalat Umar bin Khtattab RA. Catatan : Ada yang menuduh tarawih yang 11 rakaat itu adalah shalat witir. Tuduhan ini pembohongan atau pembodohan pada umat. Sebab, witir itu artinya ganjil. Yang 11 rakaat itu bukan dibentuk oleh 1 shalat ganjil. Tapi dibentuk oleh 2 shalat genap (4 rakaat, 4 rakaat) dan 1 shalat ganjil (3 rakaat). Apakah 4 rakaat itu shalat ganjil ? Dan bila rujuk pada sunnah, tidak pernah (tidak ada) petunjuk Nabi SAW

shalat witir dengan 2 salam, apakah witir dengan 3 rakaat, apakah 5 rakaat apakah 7 rakaat atau 9 rakaat. Jadi untuk shalat witir, apakah anda mencontoh Nabi SAW, di mana 3 rakaat dengan 1 salam atau buatan (rekayasa) sebagian ulama di mana 3 rakaat dengan 2 salam ? HR Bukhari & Muslim : Dari Qosim bin Muhammad, katanya :“Saya mendengar Aisyah RA berkata :“Rasulullah SAW shalat malam sebanyak 10 rakaat dan berwitir 1 rakaat. Tarawih 23 Rakaat Sedangkan shalat tarawih 23 rakaat rujukannya : 1. Atsar Riwayat Malik : Yazid bin Rummah berkata : “Adalah orang-orang shalat malam (tarawih) pada zaman Umar RA sebanyak 23 rakaat”. Oleh ahli Hadist Syeikh Nashiruddin Albani peneliti Hadist terkenal di Timur Tengah menyatakan hadist itu palsu karena sanadnyaYazid bin Rummah tidak pernah ketemu Umar RA (Umar wafat, Yazid bin Rummah baru lahir). Jadi HR Malik ini tak dapat digunakan sebagai rujukan (sandaran hukum), karena Riwayat itu palsu. Kemudian bila kita cermati bunyinya, tidak menyebut Umar RA turut melakukan 23 rakaat. Bila Umar RA turut, tentu bunyinya : “Umar RA dan orangorang di zamannya melakukan shalat tarawih 23 rakaat”. Hadist atau atsar adalah merupakan hukum, jadi setiap katanya menjadi pedoman. 2. Tarawih 23 rakaat berdasarkan rekayasa ulama. Buktinya, timbulnya 23 rakaat, penyebabnya serupa dengan yang 21, 26, 36, 40 rakaat, adalah hasil rekayasa sebagian ulama, di mana mengatasi kejenuhan jamaah shalat malam (tarawih) kalau mengikut bacaan seperti Nabi SAW setiap 1 rakaat + 2 s/ d 4 surat, maka oleh ulama belakangan membuat (merekayasa) jumlah rakaat diperbanyak 21, 23, 26, 36, 40 rakaat, agar cukup atau 1 surat setiap rakaat yang dibaca, tidak meletihkan berdiri lama. Kemudian shalawat dan doa (yang dibacakan kuat) setelah selesai salam setiap 2 rakaat juga tidak ada petunjuk NabiSAW,kecualiiturekayasaulama.(lihat kitab “KESAHIHAN DALIL SHALAT

TARAWIH 20 RAKAAT“ oleh K.H M.Hanif Muslim, Lc. hal. 33, 35, 36, 52, 53, 54). Kesimpulan 1. Tuduhan Umar RA melakukan 23 rakaat itu fitnah, karena tidak masuk akal Umar RA sahabat Nabi SAW yang begitu setia, mau melanggar ketetapan/ petunjuk Nabi SAW dalam ibadah, di mana Nabi SAW melakukan 11 rakaat. Terbukti dari penjelasan HR (Atsar) Malik di atas, di mana Umar RA pernah menyuruh Ubay bin Ka’ab mengimami orang-orang dengan 11 rakaat (shalat makam/tarawih). Jadi terbukti Umar RA tetap mengamalkan 11 rakaat, tidak pernah 23 rakaat. 2. Shalat malam (tarawih) yang 11 rakaat adalah shalat malam (tarawih) dari Nabi SAW. Dan ini adalah atas petunjuk Allah SWT. Karena : “Tidaklah Muhammad SAW itu berbuat kecuali atas petunjuk Allah SWT“ Berarti 11 rakaat adalah yang Ridho Allah SWT. Shalat malam (tarawih) yang 23 rakaat terbukti itu adalah rekayasa ulama, bukan petunjuk Nabi SAW. 3. Kemudian kita mempunyai rukun iman : Pertama : percaya pada Allah, ke-dua : percaya pada Rasul-Nya, ketiga: percaya pada kitab-Nya .....dst. Berarti petunjuk Nabi SAW lebih mulia di sisi Allah SWT dibanding petunjuk ulama. Kemudian sesuai sabda Nabi SAW: “Sebenar-benarnya perkataan adalah Kitabullah, semulia-mulia petunjuk adalah petunjuk Muhammad SAW ......dst“. 4. Timbul tantangan, apakah kita mendahulukan mengamalkan petunjuk Nabi SAW (petunjuk Allah SWT) daripada mendahulukan mengamalkan petunjukulamademiuntuktidaktercemar rukun iman? Tentu pedomannya adalah : QS.AnNisa’ 59 :“Hai orang-orang yang beriman .......dst, jika kamu berbeda pendapat maka kembalilah pada Allah dan Rasul, jika kamu benar beriman pada Allah dan (percaya) hari kiamat“. Jadi kita dituntut untuk kembali pada petunjuk Allah dan Rasul jika berbeda pendapat. Kembali pada Allah dan Rasul maka kita wajib mengamalkan yang 11, rakaat demi rukun iman. Penulis adalah pengamat sospol dan keagamaan

Selamat Datang Bulan Ramadhan... Oleh Ahmad Taufik Nasution

M

asih berbekas dalam ingatan saya kegiatan di bulan Ramadhan tahun lalu (1429 H), berupa: sahur bersama, berbuka bersama, shalat berjamaah, tilawah Alqur’an di masjid. Alangkah indahnya ingatan itu, menggetarkan memori di dalam otak, tak sadar saya meneteskan air mata— air mata yang terasa dingin yang membasahi pipi. Konon air mata yang terasa dingin adalah air mata kegembiraan. Betapa tidak terharu diri orang beriman, sepanjang tahun disiapkan satu bulan yang penuh dengan kenikmatan. Kenikmatan dalam bulan mulia itu, tidak pernah ada di bulan lain. Orang yang tidak pernah berpuasa di Ramadhan, dia tidak akan pernah merasakan betapa nikmatnya, misalnya meneguk segelas air putih. Pada bulan selain Ramadhan, orang yang tidak berpuasa akan meminum air putih hanya sekadar menghilangkan haus, namun orang yang berbuka puasa di bulan mulia itu, meminum air putih, tidak hanya sekadar untuk menghilangkan haus, tapi dia akan merasakan suatu “nikmat” tertentu sebagai rasa syukur yang tidak akan pernah dirasakan bagi orang yang tidak berpuasa. Di tengah-tengah peristiwa yang terjadi seperti: bom bunuh diri, kekerasan, hiruk pikuk perselisihan pilpres dan calon legislatif. Datang satu bulan yang seolah-olah ingin mengingatkan kita: “Hentikanlah perlakuan-perlakuan buruk kalian, siapa pun kalian aku (bulan mulia) akan memberikan keberkahan dan rahmat bagi semua orang yang menyambutku penuh kegembiraan. Hentikanlah semua perbuatan maksiat yang hanya akan mendatangkan malapetaka dan bencana yang besar; hentikanlah korupsi yang merupakan bentuk teroris yang sama dengan teror bom bunuh diri, karena kalian para koruptor mengambil hak orang banyak sehingga mereka teraniaya dan kelaparan.” Bulan Ramadhan adalah bulan yang tepat untuk melakukan evaluasi menyeluruh terhadap apa yang sudah dilakukan anak bangsa ini. Bulan Ramadhan adalah bulan untuk beramal yang akan menjadi perekat bagi semua anak bangsa yang bertikai. Di bulan ini segala kepentingan dikendalikan, karena bulan ini tidak akan memberi celah kepada siapa pun melakukan sesuatu yang dimurkahi Allah. Pada bulan ini, rahmat

dari langit turun, ampunan dari langit turun, perlindungan dari langit turun, sehingga kebaikan dan kemuliaan muncul melenyapkan kedengkian dan kesombongan manusia. Ramadhan adalah bulan yang menggiring semua orang beriman untuk mengendalikan diri (self countroling). Selama satu bulan dilatih untuk menjaga ucapan dari kata-kata yang buruk, mengontrol nafsu dari perbuatan maksiat dan serakah, memelihara mata memandang sesuatu yang bukan haknya, menjaga tangan untuk tidak mengambil milik orang lain,menahan kaki untuk tidak melangkah ke tempat-tempat maksiat, menutup telinga dari orang yang menggunjing. Ini artinya, di bulan Ramadhan semua pihak diminta untuk menjaga kesucian bulan mulia ini yang segera datang. Dengan hadirnya bulan penuh berkah ini, debat-debat di media massa dan di warung kopi diharapkan tidak lagi berapologi (“mau menang sendiri”) untuk mempertahankan pendapatnya; para tunawisma dan lelaki “buaya” menjauhi tempat-tempat maksiat; acara-acara telivisi untuk tidak menayangkan acara berbaur mistis, seks dan kekerasan; aparat keamanan dan para demonstran menghindari bentrokan dan pukulan; tempat-tempat hiburan malam yang menawarkan maksiat segera ditutup; tempat-tempat penjualan makanan dan minuman yang tidak sesuai dengan syariah kita hindari. Ramadhan adalah momen yang tepat dijadikan sebagai pencanangan untuk bangkit meningkatkan harga diri bangsa dan citra bangsa Indonesia di mata internasional. Karena di bulan Ramadhan tidak membiarkan adanya kegiatan-kegiatan bom bunuh diri dan berbagai kericuhan yang akan mempengaruhi citra Indonesia dimata dunia. Dengan jumlah penduduk muslim yang besar di Negara Pancasila ini, orang Islam Indonesia harus menunjukkan bahwa Islam dapat mewarnai negeri ini dengan nilai-nilai mulia dan tinggi. Saya yakin bahwa Ramadhan akan menempah kita menjadi alumni-alumni training Ramadhan yang akan menebarkan sifat mulia itu. Betapa tidak, dengan pengendalian diri untuk tidak makan dan minum, orang Islam di Indonesia diajarkan agar selalu bersabar; dengan keikhlasan memberi perbukaan dan me-

ngeluarkan sedekah; orang Islam di Indonesia diajarkan agar dapat membantu orang miskin; dengan shalat berjamaah di masjid, orang Islam di Indonesia diajarkan supaya mampu membangun kerja sama dengan berbagai pihak. Sehingga diharapkan dengan nilai-nilai prinsip ajaran puasa: sabar, memberi dan bekerja sama, umat Islam Indonesia akan dapat menjadi model dalam membangun bangsa yang beradab dan modern sebagaimana dicitakan para ulama besar pendiri bangsa ini. Saya yakin, setiap muslim akan menyambut bulan Ramadhan dengan hati lapang, karena bulan yang akan tiba membawa sesuatu “yang menentukan” bagi masa depan banyak orang. Bulan ini datang membawa keberkahan dan kemuliaan yang demikian tinggi, untuk mengangkat derajat orang yang menantinya, dan menyambutnya dengan penuh kegembiraan. Andai kata kita tahu apa rahasia besar di bulan Ramadhan ini, kata Nabi Muhammad saw.: “Kamu akan meminta sepanjang tahun bulan Ramadhan”. Sebab dalam bulan ini banyak keberkahan, salah satu keberkahan yang sangat tinggi adalah mendapatkan malam “al-lail al-qadr” (malam “penentuan”). Betapa tidak disebut malam mulia, karena siapa yang beramal di malam itu akan mendapat nilai tambah yang lebih baik dari seribu bulan (sekitar delapan puluh tahun beramal). Akan tetapi jangan lupa, tamu agung ini akan datang kepada manusia yang istimewa, tamu ini tidak akan mendatangi setiap orang, tamu ini akan memilih siapa hamba Allah yang layak untuk ditemui. Tamu ini tidak akan mendatangi orang munafik yang hanya beramal di bulan Ramadhan, tapi tidak beramal diluar Ramadhan; malam mulia ini juga tidak akan mengunjungi orang-orang yang senantiasa bangga dengan perbuatan maksiat dan memamerkan hasil korupsi; malam mulia ini juga tidak akan singgah di rumah orang-orang yang membangun rumah mewah untuk menunjukkan hartanya di depan rumah-rumah orang miskin. Bulan mulia ini, akan hadir dalam jiwa manusia yang menantinya sepanjang tahun, menunggunya setiap malam dengan tahajudnya, menggerakkan bibirnya dengan zikir pada setiap waktu, dan menjaga hatinya. Malam mulia itu juga akan berkenan hadir pada setiap orang yang “termehek-mehek” memohon ampunan dari-Nya dengan sepenuh hati. Ramadhan adalah bulan “perbaik-

an” karena di bulan ini seluruh jiwa orang yang beriman ada yang “di-up grade” dan ada yang “di-install” karena penuh dengan berbagai “virus” maksiat yang dilakukan dalam satu tahun ini. Salah satu soft ware yang tepat adalah dipro-gram dengan aplikasi Ramadhan: puasa, tilawah, shalat dan memberi kepada yang membutuhkan. Bagi orang yang beramai-ramai menziarahi kubur, bulan mulia ini tidak akan memberi perubahan, jika ziarah kubur hanya sekadar menabur bunga, dan air. Janganlah ziarah hanya sekadar untuk melihat seonggok tanah dan melihat batu nisan saudaranya. Ziarah kubur yang benar semestinya mampu mengetarkan hati kita untuk menyiapkan amalan yang lebih baik. Insya Allah, kita berharap Ramadhan tahun ini memberi bekas yang mendalam kepada orang banyak di negeri ini, agar peningkatan harkat dan martabat bangsa kita. Meningkat, karena bumi pertiwi ini dipenuhi manusia-manusia pari purna yaitu manusia yang bertaqwa kepada Allah swt. Manusia seperti ini, dapat dibentuk dengan ibadah puasa, sebagaimana ditegaskan dalam Kitab Suci Umat Islam, yaitu: “Wahai orangorang beriman diwajibkan atas kamu berpuasa, sebagaimana telah diwajibkan atas orang-orang sebelum kamu, agar kamu menjadi orang yang bertaqwa.” (QS Al-Baqarah: 183). Pengamat Sosial Keagamaan. Email: atnasution@yahoo.com.

SUDUT BATUAH * APBD 2010 tidak sesuai visi misi Gubsu - Ini namanya lari dari jalur * Gubsu minta Tirtanadi cepat atasi air - Jangan pula air keruh, lampu pun padam * Kerusakan lingkungan hidup diatas ambang batas - Salah siapa, dosa siapa?

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Mimbar Jumat

WASPADA

Jumat 21 Agustus 2009

13

Bisnis Syariah Jangan Menyimpang PERKEMBANGAN lembaga keuangan syariah di Indonesia cukup menjanjikan, hal ini terlihat dari perkembangan bank syariah, asuransi syariah dan pasar modal syariah (capital market). Ketiga lembaga tersebut terus menunjukkan perkembangan yang signifikan. Meski demikian, perkembanganbisnissyariahperludimonitoring terusagarnilai-nilaisyariahyangselama ini menjadi“roh” terus dipertahankan. Muamalat Salah Ketua Badan Pengawas Pasar Modal dan Lembaga Keuangan(BapepamLK)FuadRahmany dalammengembangkanbisnissyariah, khususnya Dewan Syariah Nasional (DSN) harus jeli dalam memonitoring bisnis tersebut. Diamengatakandalambisniscapital marketsyariahsudahmulaimuncultanda-tandapenyelewenganterhadapnilai syariah. Dalam aturan semestinya jika adaperusahaanyangterlistingdiJakarta IslamicIndex(JII),perusahaantersebut harusmampumemunculkanperforma syariahnya. “Jangansampaiketikaemiten tersebut tidak mampu memberikan keuntunganlantasperusahaanmelakukanperubahandalambentukmengubah komposisinyayangtidakdibenardalam bisnis syariah,”ujarnya. Maka dari itu, diperlukan kejelian dalammemantauperkembanganbisnis syariahtersebut,sementarainiBapepam LKterusberkerjasamadenganDSNbagaimana terus membuat formula pengembangancapitalmarketsyariahyang baiktanpamenguranginilai-nilaisyariah. KetuaBapemanLKtersebutmenegaskanselamaini dalampengembangan instrumen keuangan syariah, sisi yang paling penting adalah SDM. Pasalnya, ujarFuad,jikaSDMyangsecarakhusus mengertidanpahamtentanginstrumen keuangan syariah itu luput, hal tersebut akan menjadi hambatan bagi perkembangan ekonomi syariah. “Hal yang dikhawatirkan, nanti yang membuat terhambatnyaperkembanganekonomi syariahbukankarenatidakadapermintaan,tapiterhambatkarenakekurangan SDM,”kataFuad.UntukituFuadmeminta semua pihak untuk mendukung ketersediaanSDMdibidangsyariahitu. Fuad menambahkan, pemerintah telahmendoronginstrumenkeuangan

syariah melalui penerbitan sukuk. Sejumlahperusahaansahampuntelah mengeluarkanprodukkeuangansyariah. Menurut dia, dengan kian banyaknya perusahaan yang mengeluarkan produktersebut,harusdipastikanbahwa produk-produktersebutmemangsesuai denganprinsipsyariah.“Untukituharus diperkuat landasan hukum dan peraturan, untuk memastikan kesesuaian suatu produk dengan syariah benarbenar terjamin,” kata Fuad. Selainitudalamindustriperbankan syariah juga dituntut agar terus melakukaninovasiprodukdanmemberikan pelayananberkualitasuntukmenggaet nasabah. Namun itu akan sangat sulit untuk dicapai tanpa dukungan SDM (sumberdaya manusia) berkualitas. Direktur Direktorat Perbankan Syariah Bank Indonesia Ramzi A Zuhdi merujuk pada hasil riset MarkPlus&Co

yang menyebutkan selain terdapat nasabahyangloyalpadasalahsatusistem, konvensional atau syariah, ada pula nasabahyanglebihmemilihsuatusistem berdasar pelayanan atau yang disebut dengannasabahmengambang(floating mass). PelakuindustrikataRamzidituntut untuk dapat menggaet nasabah baru dari kalangan massa mengambang. “Untukmenarikminatfloatingmassinilah industri perbankan syariah harus dapat melakukan inovasi produk dan memberikan pelayanan berkualitas dengan didukung SDM profesional,” ujarnya. Ramziberharapperbankansyariah bisa mendapat suplai SDM berkualitas agar dapat bersaing di perbankan nasionaldantargetpangsapasar15persen di 2015 dapat tercapai. Saatiniasetperbankansyariahhampir mencapaiRp60triliundenganrata-rata

pertumbuhanindustriperbankansyariah 30 persen per tahun. “Dengan pertumbuhan relatif tinggi dibanding konvensional,disatusisitimbulrasaoptimis, tetapidisisilainadatantanganmengenai kekurangan SDM,” ujarnya. Berdasar data publikasi BI per Juni 2009 terdapat sekitar 13.500 SDM yang bekerja di industri perbankan syariah. Jumlahtersebutdiantaranya8.486orang di bank umum syariah, 2.223 orang di unit usaha syariah dan 2.811 orang di bankpembiayaanrakyat(BPR)syariah. Di sisi lain pakar ekonomi Islam AdiwarmanAzwarKarimberpandangan sistem ekonomi kapitalisme atau sosialismesesungguhnyatakmasalahasalkan semuaberbasissyariahatausesuaisyariat Islam. Pasalnya, secara teori, kedua sistem ekonomi tersebut sama menghendaki keadilan dan kesejahteraan rakyat. “Maka,apapunsistemekonominya, kapitalisme atau sosialisme, asalkan berdasarkansyariah,bagus-bagussaja,” ujar Adiwarman. Namun, sambung Adiwarman, dalam praktiknya kedua sistem besar tersebut seringkali mengalami banyak masalah.(m13)

M-Life Festival Perluas Segmen Syariah JAKARTA (Waspada): M-Life Festival (Muslim Lifestyle Festival) bakal digelar pada Ramadhan tahun ini. Perhelatan akbar yang diselenggarakanasosiasidankomunitasekonomi syariah ini berupa pameran, bazaar, edutainment, TV program, dan festival musik, kata Agustianto, Sekjen IAEI yang menjadi panitia pelaksana event tersebut. PamerandiselenggarakandiGrand Indonesia Shopping Town, pusat perbelanjaan terbesar di AsiaTenggara, 16 September 2009. Selain menampilkan produkdanjasakeuangansyariah,produk halal, dan sajian seni Islami, juga akan dimeriahkan selebritis dan public figurantaralain:MarissaHaque,Cheche Kirani,UstadYusufMansur,AryGinanjar, bintangfilmKetikaCintaBertasbih,dan lainnya.JugabakaldigelarIslamicFashion Show. Berbeda dengan event yang diselenggarakansebelumnyaM-LifeFestival menyasarkomunitasmuslimdannon-

muslim kalangan menengah ke atas untuk memanfaatkan produk dan jasa keuangan Islami. Produk perbankan syariah, asuransi syariah, reksadana syariah, dan instrumen keuangan syariah lainnya merupakan produk universal dengan prinsip bagi hasil dan saling menguntungkan, kata dia. Denganpendekatan gayahidupdanmasukkemall(ekonomi syariah goes to mall), diharapkan dapat mening-katkan pangsa pasar ekonomi syariahdanmenciptakansegmenpasar baru,kalanganmenengahatasyangboleh jadi saat ini belum menggunakan dan memanfaatkan produk dan jasa keuangan/ekonomi syariah. M-Life Festival tidak hanya berupa pamerandiGrandIndonesia.Tetapijuga memiliki program on-air: TV Program Edutainment “Sakina”. Agustianto menambahkanuntukkalanganmuda, digelar M-Life Music Festival. Inimerupakanajangkreativitasdan penyaluran talenta remaja dan pemu-

da dalam bermusik, khususnya musik islami. Festival diselenggarakan selama pameran M-Life festival di Grand Indonesia,denganhadiahtabungansyariah, netbook, dan sejumlah bingkisan. Menurut Agustianto panitia pelaksana acara tersebut, M-Life Festival diselenggarakanbersamaoleh12asosiasi dan organisasi ekonomi syariah: Ikatan Ahli Ekonomi Islam (IAEI), Pusat Komunikasi Ekonomi Syariah (PKES), Masyarakat Ekonomi Syariah (MES), AsosiasiPerbankanSyariah(Asbisindo), AsosiasiAsuransiSyariah(AASI),Asosiasi BMT Indonesia (Absindo), Asosiasi Akuntansi Syariah Indoensia (AAKSI), Forum Studi Ekonomi Islam (Fossei), BAZNAS,dll.Pelaksanaprogramadalah Indonesia News Network (INN) dan portal IslamicFinance.co.id Dalamsilaturahmidanpeluncuran M-Life Festival diTheTaste Cafe, Grand IndonesiaShoppingTown,Jakarta,Selasa (18/8), dihadiriparapimpinanorganisasi dan asosiasi.(m13)

PT Pelindo I Belawan Gelar Tablig Akbar PTPelindoI(Persero)CabangBelawandan BelawanInternationalContainer Terminal(BICT)menggelaracara ‘Tablig Akbar dan Haflah Al- Qur,an Internasional’dihalamanMasjidSalam, Kampung Salam Belawan belum lama ini. Acara dihadiri para Qori nasional juaraduniadanQoriInternasionalyang mendengungkanlantunanayatsuciAlQur’an di hadapan ribuan masyarakat Belawandansekitarnyayangmemadati halaman Masjid. Salah satu Qori Internasional dari MesirSyeikhMahmoudSyahatMuhammad Anwar. Acara juga diisi tausiah agama dan hiburan qasidah, tawasyi, shalawat dari IPQOH Sumatera Utara. Pagelaran‘TabligAkbardanHaflah Al-Qur’an Internasional’ digelar dalam rangka memperingati Israk ’Mikraj dan menyambut BulanSuciRamadhan1430 HinisebagaiwujudkepedulianPTPelindo I Cabang Belawan mengaktualisasikan nilai-nilai Islam kepada masyarakat Belawan khususnya. Dalammenjalankanbisnisnya, PT Pelindo I berlandaskan asas 5 C + 1 S, yaitu, Competence, Clean, Competitive, Customer focus, Community friendly, Safety and secure. Kegiatan ini bagiandariprogramcommunity friendly. ‘’SebagaiBUMN diberitanggungjawab mengelola pelabuhan, Pelindo tidak semata-matamemikirkankepentingan bisnis semata. Kita juga harus memiliki kepeduliansosial,’’ujarDirutPTPelindo I (Persero) Harry Sutanto. General Manager Pelindo I (Persero) Cabang Belawan Ir Syahputra S,MSM menambahkan, kegiatan ini diharapkan berdampak positif dalam penyampaian dakwah Islam sekaligus memberi motivasi khusus kepada

Qori internasional saat mengumandangkan ayat-ayat suci Al Quran dalam acara Tablik Akbar PT Pelindo I Belawan belum lama berselang. (foto: ist) generasi muda yang mempunyai potensi sebagai cikal bakal qori/qoriah masadepansertamemupukukhuwah di antara umat Islam. Acara mengusungtema‘PeduliAgama, Lingkungan dan Masyarakat Belawan’ini,dihadiriPj WalikotaMedanDrs HRahudmanHarahapMM,SekdaKota

MedanDrsHDzulmiEldinMAP,jajaran lengkapDireksiPT.PelindoI, KetuaMUI Kota Medan, Kapolres KP3 Belawan, unsur muspida Tk I dan II, tokoh masyarakat dan alim ulama kota Medan dan Belawan. Dalam kesempatan ini, Walikota mengajak PT. Pelindo I bersama-sama

dengan warga menggerakkan segala potensi yang dimiliki agar berbagai persoalan seperti infrastruktur bisa diatasi bersama. UstadH.SyamsulArifinNababan, Lcsaatmenyampaikantausiahmemberi apresiasi kepada PT. Pelindo I Cabang Belawan sebagai BUMN pertama menyelenggarakanacarasepertiini.Dalam limatahunrombonganberjalanmelakukan dakwah dalam acara seperti ini, ujarnya baru kali ini dikemas spektakuler dengan tata panggung dan lighting yang megah. Acara diprakarsai GM Cabang Belawan dan didukung penuh Direksi PT.PelindoIinimemangdirancangmegah sebagai suguhan istimewa kepada masyarakat.‘’Kitainginmemberikansesuatu yang lebih kepada masyarakat Belawan,’’ujar Sri Suyono Manajer Umum Pelindo I Cabang Belawan yang dipercaya sebagai Ketua Panitia didampingi konseptor acaraM.TaufikFadillah (Ass. Manajer Personalia ) dan Design Stage dan Lighting M Eriansyah (Ass Manager Datin). (rel/m09)

Karo Muslim Desa Tigaberingin Sambut Ramadhan Menyambut bulan Ramadhan tahun ini, kaum muslimin Karo Desa Tigaberingin, Kec. Tigabinanga, Kab. Karo,Minggu(9/8)mengadakankenduri danziarahkuburdansalingbermaafan menjelang bulan baraqoh ini. Keunikan desa ini adalah seluruh penduduknyaberagamaIslam.Karena di desa yang kecil ini dulunya hidup seorang Karo pemeluk Islam pertama bernamaJuanTarigandansalahseorang putranyakemudianmenjadiulamabesar dantokohpergerakanyakni Almarhum

Tuan Guru H. Sulaiman Tarigan, serta beberapa cucu dan cicit Juan Tarigan menjadi ustaz . Acara kenduri dan ziarah kubur diprakarsai oleh salah seorang putranya yangmenjadipengusahadiJakarta,HKP. MalikTarigan.Acara diawali ziarah ke makam keluarga diikuti seratusan anggota keluarga dan para santri dari pesantren Sirajul Huda, yang dibangun oleh Sulaiman Tarigan. Sehabis shalat Maghrib dilanjutkan dengan kenduri doa untuk para

arwah keluarga besar Alm. Juan Tariganyang beberapa di antaranya berprofesi sebagai ustad, yakni Alm. H. Abdul Manaf Tarigan, Alm. H. Raja Shaf Tarigan, HA. Halim Tarigan, H A AzisTarigan,Lc,eksguruagama/mantan komandan lasykarHizbullah/Sabilillah T. Karo, Alm. H. Abdul Razak Tarigan (lasykartersebutjugadidirikanolehTuan Guru Sulaiman Tarigan), mantan anggota MPR RI, Alm. H Jamaluddin Tarigan. (Achmad Pasundan Tarigan/salah seorang cicit tugas di Bank Sumut).

Ustadz Amhar: Masjid Lambang Keberkahan (ukhuwah Islamiyah), 3. Membangun perekonomianumatmelaluiBaitulMal. Amhar mengingatkan pula, bahwa akhir dalam hitungan tahun umat Islam kembali menguasai Makkah dan dideklarasikanlahpiagamMadinah,jika mereka kafir masuk ke wilayah Masjidil Haram mereka jangan dibunuh, hartanya jangan dirampas, akhirnya mereka dengan ikhlas memeluk Islam. Masjid merupakan lambang jihad dan keberkahan, makanya dasar orang memakmurkanMasjidmenurutsuratAlBaqarahyaitu,BerimankepadaAllah,Berimankepadaharikemudiandengancara takut berbuat dosa, dan mempersiapkan diri dengan taqwa, Menegakkan shalat, Mengeluarkan zakat dan Tidak pernah merasa takut kepada siapapun Waspada/H. Suyono

kecuali Allah SWT. “Mereka itulah orang-orang yang mendapatkan lindungan dan rahmat bagi Allah SWT, maka mari kita pelihara masjid jangan kotori dengan gerakan terorisdangerakananarkisapalagiberbau politis dunia untuk kepentingan sesaat maka dilarang. OlehRasulullahSAWjanganlakukan di Masjid untuk : Berdagang, Mencuri harta Masjid, Membuang najis, Berkata porno(mengandungsyahwat),Berteriak mencari barang yang hilang, Bertengkar dan berpukul-pukulan, Tidur sampai meninggalkan najis, berebut kekuasaan atau kedudukan dunia untuk dipuji dan diagungkan , Berpacaran, Masuk kedalamnya berhadas atau diri yang kafir,” ujar Amhar.(m25)

Ustadz Drs.H. Amhar Nasution,MA (pakai lobe putih), Walikota Binjai mendampingi Kapoldasu Irjen Pol. Drs.H. Badrodin Haiti, dan Kapolresta Binjai AKBP Robert Kennedy,SH ketika meresmikan Masjid Al-Ikhlas Mapolresta Binjai belum lama ini. SebagaiumatIslamkitaharussamasama memiliki tanggungjawab untuk memeliharaMasjiddarigangguanorang kafir,karenaMasjidmerupakanlambang jihad dan keberkahan, kata Ustadz Drs. H.AmharNasution,MAkepadaWaspada belumlamainisekaitanMasjid dijadikan sasaranpenggusuranakibatadanyapembangunan sepertiterjadidi kotaMedan. “Tudingan miring terhadap rumah ibadahmerupakan tantanganbagiumat Islamuntukdihadapidanmembelanya demiukhuwahIslamiyah,”tegasAmhar yang juga dosen di 4 Universitas Kota Medan tersebut. Amhar menegaskan, sebagai umat Islam kita harus bisa menjaga bahkan memelihara Masjid

karenarumahAllahyangdibangunoleh kaum muslim merupakan sarana dan prasarana umat Islam dari berbagai kegiatan religius, kata Amhar. Seperti hadis Rasulullah berkata : Majunya Iman dan di suatu daerah ditandaidenganMasjidlebihcantikdari rumah mereka. DijelaskanAmhar,abadkebangkitan IslamberangkatdariMasjid,baikituperistiwa Isra’ Mi’raj dari Masjidil Haram ke MasjidilAqsadanketikaRasulullahhijrah keMadinahdibangunlahMasjidQuba, MasjidNabawimakadisusunlahstrategi dari3kekuatandiMasjidyaitu,1.Keimanan kepada Allah dengan Istiqamah, 2.Rasapersaudaraanyangkuatdengan

Puasa

Dalam satu hadis diceritakan,— dan doamu bersihkan jasmani dan Satu hari rasul Muhammad Saw naik rohanimu saat memasuki bulan yang ke mimbar untuk berkhutbah,-tibasuci ini dengan Istghfar mengakui tiba saja dia (Rasul) mengucapkan besarnya kesalahanmu dihadapan Oleh H. Syarifuddin Elhayat amin-amin-amin (sampai tiga kali). besarnyaampunanTuhan,hinggaandai Usai solat sahabat bertanya,”Ya Rasul saja engkau mati maka matimu mati , tadi ketika tuan naik sebelum beryang sudah suci.—Cocok tak ncek,khutbah sempat mengucapkan amin kalau begian.— Istighfarlah sampai tiga kali,—ada apaYa Rasul?. Biarlah suara meriam bamboo Rasul menjawab, tadi Jibril datang dan mercon tinggal dalam pajangakepadaku dan dia berkata,”Ya Munan,—kitagantikandengan gemuruh hammad siapa saja menjumpai Raberzikir, mengaji dan mengkaji Almadhan (ketika Ramadhan datang) quran dengan tadarus sebagai sarana dan dia tidak meminta ampun istiughfar kita kepada Allah. kepada Allah, pada saat itu dia mati, Orang tua adalah bagaikan maka dia akan masuk neraka,-(Mo‘tuhan’ yang mengutus kita keatas ga) Allah menjauhkan-mu dari hal dunia,— Seorang sahabat pernah itu.“KatakanYa Muhammadamin,— bertanya,—Ya Rasul terbalaskah jasa maka akupun mengucapkan amin. orangtuasayakarenasayasudahlebih Siapasajayangmasihmempunyai banyak memberikan buatnya dan dua orang tua atau masih ada salah memberikan kesenangan dengan satu diantara mereka masih hidup, fasilitasyangmembahagiakannya.Kata dandia(anak)tidakberbuatbaikkepadakeduanya(meminta Rasul“tidak”.—TapiYaRasulsayatekahberbuatbaikpadanya ampun kepadanya),-lantas anaknya tersebut meninggal, hingga diapun kadang-kadang saya gendong dan saya makadiaakanmasukneraka,-(Moga)Allahmenjauhkanmu nyanyikanuntukmemgembirakannya.Rasul,-menyebutkan dari hal itu dan katakanlah (Muhammad) Amin,—maka tetap tidak.—Setetas air susu ibu yang mengantar kehiduaku ucapkan amin.panmu tak akan bisa tergantikan dengan air apapun,— Siapa saja yang menyebut namam (Rasul Muhammad bahkansaatibuayahmumengendongmu,adasatu;lantunan Saw),sedangkan orangyangmendengarnyatidakbersholawat laguidoayangbisamenembusarasynyaAllah,”Diabernyanyi kepadamu- jika dia mati (saatitu) maka dia akan masuk seuntaidoa,—YaAllahpanjangkanumuranakku,murahkan neraka,—(moga) Allah menjauhkanmu dari hal itu dan rezakinyadanjadikanlahanak-anaknyamenjadianakyang Katakanlah amin,— maka Aku katakan amiin. soleh,— sedangkan engkau (anak yang menggendong Nukilanhadis diatassedikitagakpanjang,namunketika ibunya, kata Rasul saat mengendong ibumu akan berkata,” dibaca renung-renung dengan baik, air matapun mungkin YaRooobb,-harusberapalamalagiakumengendongiobuku tidak akan bisa tertahan kita. Kenapa.— hadis di atas sarat yang sudah renta ini.—Allaah-Allaah,—hanya air mata dengan pesan menceritakan tentang persiapan kita me- sembahsujudku ibu menebus ridhomu. nyambut Ramadhan yang disebut rasul sebagai bulan yang Solawat merupakan hubungan antara seorang ummat Adziiim bulan yang mulia yang di dalamnya ada malam dengan pemimpinnya Rasul Muhammad saw. Tak ada seribubulan‘sarat’dengannilaiibadahyanghinggamampu pembatas (hujab) seorang ummat berhubungan dengan mengantar kita ke jannah Allah. sang rasulnya ketika dia berkata,”Assalamu Alaika Ya Ramadhan dan Puasa adalah bulan yang suci,-amat Rasullallah,—AllahummaSholliAla(Sayyidina)Muhammad sangat wajarlah kita harus mensucikan diri ketika masuk –Ya Allah sampaikan solawat dan salamku pada nabi ke dalam sesuatu yang suci. Bagaimana mungkin kita akan Muhammad. Solawat,katata Rasul, meripalah ,’tiket’ bagi mendapatkan kesucian Ramadhan sedangkan kita yang kita ummat ini untuk mendapatkan syafaatnya rasul dan akandikunjungiRamadhanyangsuciitubelumjugasuci,— dengan solawat permohonan kita kepada Allah akan lebih Ibaratnya bagaimana kita akan membersihkan sesuatu terijabah dan menambah cinta padanya. sedangkan sapu yang kita pergunakan masih kotor.terlalu Mari kita sambut Ramadhan dengan yang maghfirah banyaksalahkitakepadaAllah,amatjarangingatkitatertuju dengan istighfar, bermohon ampun kepada dua orang kepadaNyapadahaldiatetaptaklupamencatatsegalaamal tua dan berhubung diri dan jiwa pada rasul Muhammad yangkitalakukan.—BanyaknikmatyangAllahanugerahkan dengan solawat.Ramadhan ini,—Ampunkan hambaYa buat kita tapi,— mungkin,— amat sedikit syukur yang kita Allah,—Maafkankan aku bundaku,— Aku rindu Dia,— lantunkankehaderatNya.—DalamRadahaniniJibrildatang Rasulku ItuyangambesebutNcekjadilinanganairmataku. membawa khabar,— seakan berkata,”Hapus segala salah Marhaba Ya Ramadhan.

Mewujudkan Kemerdekaan Ekonomi Oleh Mustafa Kamal Rokan TELAHenampuluhempattahunbangsakitamerdeka daripenjajahan.Taktanggung-tanggung,bangsainidijajah selama berabad-abad lamanya. Masa yang cukup lama dalam keterbelengguan dan ketertindasan. Sungguh, pengertian kemerdekaan bukan hanya terbatas pada kata bebas,maknakemerdekaansungguhluas,merdekadapat berarti “keterbebasan dari belenggu”, “bebas dalam menentukan pilihan dan nasib sendiri” dan lebih penting dari itu “bebas dari kemiskinan dan kemelaratan”. Alihalih kita merdeka pada tanggal 17 Agustus 1945 hingga saat ini, apakah kita telah mendapatkan makna “kemerdekaan” yang disebutkan di atas?. Pertanyaaninimunculketikamembandingkansejarah atau cerita “kakek-nenek” kita yang ikut merasakan masa penjajahan masa lalu itu, hampir tidak berbeda dengan zamansekarangyangkatanyamerdekaini.Walau,tentunya beda setting dan perannya, namun cerita “keterjajahan” masa lalu “mirip” dengan kisah kita sekarang ini. Sebutsajamisalnya,kisahantreanuntukmendapatkan bahanmakananpadamasaBelandadanJepang.Demikian juga kisah makan ubi dan tiul masa penjajahan Jepang yang selalu menjadi “kisah sedih” yang dilontarkan para orang tua kita dahulu, namun tak dapat ditampik bahwa kisahitujugaterjadisaatini.Pemandanganserupaterdapat ditempatkitatinggal,dilayarTVjelasterlihatmasihmirisnya kehidupan sebagian saudara sebangsa. Masih banyak saudarakitayangjugaantreanmendapatkanminyaktanah, bahkan air minum dan merupakan kebutuhan dasar bagi manusia juga masih antrean mendapatkannya. Belum lagi, kisah “mati kelaparan” pada masa penjajah juga pemandangan yang masih “ramai” pada saat ini. Lebih parah lagi, masih segar diingatan kita kisah seorang ayah yang harus “tak gendong kemana-mana” bayinya yang meninggaldisebabkantidakmempunyaiuangmembayar tempat di kubur (kuburan). Ironis bukan? Lain lagi persoalan terbatasnya akses ekonomi masyarakatyangmirippadamasapenjajahandulu,walau dengan sejumlah angka orang miskin sedang mengalami “kemajuan“denganjumlah34,96jutajiwaatau15,42persen darijumlahpendudukIndonesia(dataBPS)”namunangka pengangguran juga masih sangat mencengangkan. Pertumbuhan ekonomi kita belum mampu mengangkat angka pengangguran secara signifikan. Kemerdekaan Individu Kemerdekaanekonomisebuahbangsasesungguhnya merupakan tanggungjawab kolektif seluruh komponen bangsa. Sebab, sebuah bangsa didirikan berdasarkan konsensusbangsaituuntukdirinya.Secaraindividu,maka setiap komponen bangsa berkewajiban membebaskan bangsanya dari keterpurukan dan keterbelengguan ekonomi.Namundisisilain,tanggungjawabnegaramerupakan faktor penentu dalam membentuk sistem ekonomi yang berjalanyangsangatberdampaksecarakolektif.Karenanya, kemerdekaan individu dan kemerdekaan sistem yang dijalankan negara adalah syarat mutlak yang harus kita “bebaskan” saat ini. Islamadalahagamayangsangatmemotivasiumatnya untuk bekerja keras dan produktif. Ismail Raji Al-Faruqi dalambukunyamenyatakanbahwaIslamadalahareligion of action, agama amal dan kerja. Lebih lanjut, Ismail Raji menjelaskan hubungan iman dan amal (kerja) adalah ibarat hubungan akar dengan pohon, sebab keberadaan yang satu sangat ditentukan oleh yang lain. Lihat saja frekuensi penyebutan kata “kerja” dalam Al-Quran yang sangat variatif. Berdasarkan hasil penelusurannya, terdapat 360 ayat yang terkait dengan “amal”, 109 ayat berbicara tentang “fi’il” dan dua buah kata yang artinya

“kerja dan aksi”. Lain lagi kata yang menunjukkan kerja seperti “kasab”, “baghiya”, sa’aa dan “jahada”. Nah, frekuensi penyebutan kata kerja yang sedemikian banyak dan variatif itu menunjukkan betapa pentingnya kerja yang bersifat produktif dalam Islam. Karenanya,sikapproduktifsesungguhnyamerupakan perintah Al-Quran yang sangat monumental. Sebaliknya, sifat pasif, statis, berpangkutangan dan tidak produktif merupakan sikap yang sangat dibenci dan dimurkai Allah Swt. Nah, sifat inilah yang masih “membelenggu” kemerdekaan individu bangsa ini.Yang lebih ironisnya adalah sikap tidak produktif itu telah menjadi bagian dari budaya yang telah mendarahdaging. Lihat saja seberapa besar sikap enterpreneur sudah tumbuh berkembang di kalangananakmuda,khususnyaangkatankerjayangmenjadi problem pengangguran. Lebih mudahnya kita lihat, bagaimanasifat“buruh”yanglebihmenonjolbagisebagian besar anak bangsa, baik menjadi buruh swasta maupun buruh negara (baca: pegawai negeri sipil) dan seterusnya. Kemerdekaan Dalam Sistem Ekonomi Selainitu,tanpabisadipungkiriketerbelengguanbangsa ini disebabkan oleh kesalahan sistem ekonomi yang digunakan oleh para pengambil kebijakan. Kewajiban negaralah menjadikan negara tersebut mandiri menuju kepada kemakmuran. Negara harus mampu “membersihkan” segala kepentingan pribadi dan golongan yang menggerogoti kepentingan dan kemakmuran rakyat. Kepentinganrakyatdannegaradiataskepentingansegalanya. Karenanya,pembangunanperekonomiannasionalmenjadi prasyarat menjadikan sebuah negara yang mandiri tanpa terbelenggu oleh pihak asing. AjaranIslamyangmenganjurkanmenghindarihutang adalahsalahsatucaramenjadikanbangsayang“merdeka”. Dalamartiyanglebihkontekstualbahwautangmerupakan carayangtakterelakkandalamkontekshubunganekonomi global saat ini, namun yang perlu diambil dari anjuran nabiuntukmenghindariutangadalahterdapatnyapeluang untuk menjadikan sebuah bangsa terikat. Poin penting yang harus digarisbawahi adalah menghindari ketergantungankepadaoranglainakanmenjadikanbangsa itulebihbekerjakeras,mandiridantidak“cengeng”dengan segala kondisi. Pelajaran berharga harusnya dapat kita ambil dari perjalanan bangsa pada masa orde baru saat kita hidup diatastumpukanhutangyangpadagilirannyamenjadikan bangsa ini terseret arus ketergantungan negara lain. Nah, sampaidetikinipun,negarainimasihsaja“hobi”mengutang. Angkamenunjukkanutangpemerintahmasihmengalami “kemajuan”.Jikapadaakhir2004utangkitahanyaberjumlah Rp.1.275triliun,saatiniutangkitatelahmencapaiRp.1.695 triliun. Berarti pemerintahan saat ini telah “berhasil” menambah utang sebanyak Rp. 400 triliun. Selain itu, perubahan sistem ekonomi yang dimaksud juga menyangkut keberpihakan negera terhadap sistem ekonomi yang berbasis sektor ril. Sudah saatnya ekonomi yangdibangun“bebas”daritransaksiyangbersifatspekulatif yang sangat kental dengan unsur ribawi. Dalamkonteksinilahketerpaduanantarapeningkatan etos kerja masyarakat dengan penggunaan sistem yang berbasis ril menjadi satu kesatuan yang utuh dalam menjadikankemandirianekonomi.Kemandiriandanetos kerja masyarakat akan menjadi hampa tanpa kebijakan pemerintah dalam membuka akses dan sistem ekonomi yang berpihak, sistem ekonomi juga tidak akan berjalan tanpa kerja keras seluruh masyarakat. Wallaua’lam. � Penulis adalah Dosen Hukum Bisnis Fak. Syariah IAIN-SU dan STIH Graha Kirana Medan

Semarak Ramadhan Di Masjid Al Amin

Ketua Majelis zikir Az-Zikra H. Rizal Mahaputra bersama rombongan setelahmengadakan ibadah zikir wisata ke Brastagi berpose bersama dengan jamaah baru-baru ini. (foto: ist).

Ramadhan adalah bulan yang suci, yang diwajibkan kepada orang-orang beriman berpuasa pada siangnya, dan mene-gakkan malam-malamnya dengan melaksanakan shalat Taraweh, Tadarrus al Qur’an, serta amalanamalan sunnat lainnya. Pada kesempatan Ramadhan 1430 H ini, Masjid Al Amin jalanProf.HM.Yamin,SHtetapmelaksanakanshalatTaraweh seperti Ramadhan-Ramadhan sebelumnya. Namun kali ini Badan Kenaziran Mesjid Al Amin dalam pelaksanaannya insya Allah mengundang para hafidz sebagai imam shalat Taraweh,sehinggapelaksanaannyaakanlebihkhusu’.Demikian disampaikan oleh Pelaksana Harian Kenaziran, Masdar Tambusai, S.Ag. Setiap hari Selasa malam dan Kamis malam diadakan taushiyah Ramadhan yang diisi oleh ustadz-ustazd yang sudah dikenal yaitu ustadz Abdul Muthalib, MAg, ustadz Musdar Sa’ban, MAg, Ustadz Drs.Makmur Situmorang, dan

ustadz H. Ali Amran Zakaria, Lc. Sementara untuk kuliah Subuh diadakan pada setiap hari Sabtu dan Minggu yang diisi oleh ustadz H. Fachrurrozy Pulungan,SE,ustadzH.SutanSyahrilDalimunthe,SAg,ustadz Prof. Dr. H. Hasan Mansur Nasution dan ustadz Drs. H. Musa Yahya. Sedang untuk khatib Idul Fithri insya Allah diisi oleh ustadz Dr. H. Milhan Yusuf, MA Pada malam 17 Ramadhan, insya Allah BKM Al Amin jugaakanmengadakanHaflahalQur’andenganmengundan qori-qori’ah Internasional dan Nasional. Untuk berbuka puasa, setiap harinya BKM al Amin menyediakan bubur pedas, dan perbuka lainnya dari masyarakat yang tak mau ketinggalan dalam meraih berkah Allah.Untuk itu dihimbau kepada kaum muslimin, muslimat khususnya disekitar mesjid al Amin dan masyarakat luas dapat bersama-sama melaksanakan shalat Taraweh dan Subuh di masjid ini.

Mimbar Jumat

14 U

Jumat 21 Agustus 2009

Memaknai Ramadhan

ntuk kesekian kalinya, kita bertemu kembali dengan bulan Ramadhan 1430 H. Sebagai orang beriman atau setidaknya mengaku beriman, kehadiran bulan yang agung ini harus disambut dengan penuh kegembiraan. Gembira karena kita diberikan kesempatan oleh Allah untuk membersihkan diri dari segala macam dosa. Lebih dari itu, momentum Ramadhan juga dapat dimanfaatkan untuk meningkatkan kualitas ruhani dan jiwa kita menuju insan paripurna (insan kamil). Ramadhan sebagai sebuah momentum tidak berpretensi untuk menjadikan orang lebih baik, lebih saleh dan lebih beradab. Semuanya sangat tergantung dengan orangorang yang berada di dalam bulan tersebut, apakah akan memanfaatkannya atau membiarkan dirinya berlalu bersamaan berlalunya. Tidak ada makna apapun. Tidaklah mengherankan sudah puluhan Ramadhan berlalu, namun tidak banyak perubahan dalam hidup manusia. Kita masih egois, mementingkan diri sendiri, menurutkan hawa nafsu, tidak pernah sabar,danjauhdariTuhan.Padagilirannya tidak ada perubahan apapun di dalam hidup kita. Semua-nya sama dengan yang lalu.Yang berbeda hanya usiakitaterusbertam-bahdansemakin dekat kepada kematian. Apakah Ramadhan akan memberi perubahan atau tidak, sangat tergantung pada diri kita sendiri. Namun bagi saya pilihannya hanya satu. Kita harus memberi arti pada Ramadhan. Dengan Ramadhan sejatinya diri kita harus lebih baik. Ramadhan adalah madrasah ruhaniyah yang membuat siswanya menjadi insan paripurna, sepanjang program dan kurikulumnya diikuti dengan ikhlas dan sungguh-sungguh. Setidaknya di dalam Bulan yang penuh ampunan ini kita bertemu dengan tiga momentum penting. Pertama, puasa Ramadhan itu sendiri. Kedua, Nuzul Al-Qur’an atau peristiwa turunnya Al-Qur’an. Ketiga, pelaksanaan zakat fitrah dan takbir. Ketiga peristiwa ini memiliki keterkaitan yang cukuperatdalammembentukpribadipribadi muslim yang bertakwa (la’allakum tattaqun), bersyukur (la’allakum tasykurun), dan cerdas (la’allahum yarsyudun). Puasa atau shiyam yang di dalam bahasa Arab bermakna al-imsak mengandung arti bahwa kita harus dapat mengendalikan diri kita dari dorongan hawa nafsu yang cenderung menjerumuskan kita ke dalam lembah kehinaan. Apakah nafsu terhadap harta tanpa batas. Nafsu terhadap wanita yang tak terkendali

Oleh Azhari Akmal Tarigan

ataupun nafsu terhadap jabatan yang tiada bertepi. Tentu saja keinginan untuk memiliki harta, wanita dan jabatan merupakan sesuatu yang alami. Bahkan dalil-dali syara’ menganjurkan kita untuk memiliki ketiga-tiganya. Justru yang menjadi masalah jika keinginan terhadap ketiganya begitu mendomasi sehingga abai terhap norma-norma agama dan asusila. Pada saat keinginan kita terhadap dunia dapat ditekan sedemikian rupa, bersamaan dengan itu kita mesti menumbuh-suburkan kualitas ruhani kita. Ruh yang berasal dari Allah SWT, sesungguhnya ingin selalu dekat kepada Allah. Ibadah kepada Allah seperti shalat, zikir, dan secara khusus puasa adalah media yang paling tepat untuk mengembalikan ruh kepada asalnya. Sampai di sini tidak sulit memahami mengapa orang yang telah selesai melaksanakan ibadah merasakan kedamaian dan ketenangan bathiniyah. Sangat kontras kondisinya dengan orangorang yang tidak beribadah kepada Allah. Mereka akan mengalami kekeringan jiwa, kegersangan, kehampaan dan kehilangan makna hidup. Oleh sebab itu selama bulan Ramadhan – lebih diharapkan akan terus berlanjut pada bulan berikutnya kita dianjurkan untuk banyak melakukan amal shaleh, baik yang wajib atau yang sunnat. Bersamaan dengan itu kita juga didorong untuk melakukan amalamal sosial seperti menyantuni pakir miskin, anak yatim, orang-orang lemah dan dilemahkan. Perpaduan amal individual dan amal sosial inilah yang akan menjadikan kualitas diri kita menjadi sempurna. Selanjutnya Nuzul Al-Qur’an atau turunnya Al-Qur’an. Malam yang agung itu juga oleh Al-Qur’an disebut dengan Lait al-Qadar. Turunnya Al-Qur’an mengandung arti bahwa kehidupan di bumi harus ditata dengan ajaran-ajaran AlQur’an. Al-Qur’an tidak saja merupakan kitab suci karena berasal dari

wahyu Allah, namun lebih dari itu Al-Qur’an adalah petunjuk (hudan ), penjelas (bayyinat), dan pembeda (al-furqan). Pada sisi lain, Al-Qur’an juga menyebut dirinya sebagai syifa’ (penyembuh) dari segala penyakitpenyakit jiwa. Al-Qur’an memuat berbagai dimensi ajaran, baik yang berkaitan dengan tauhid, syari’ah, etika, kisahkisah dan informasi-informasi ilmiah. Namun harus diingat, kendati di dalam Al-Qur’an ditemukan ajaran yang bersifat detail namun secara umum Al-Qur’an hanya memuat ajaran-ajaran yang bersifat umum (mujmal, global). Al-Qur’an bukanlah kitab hukum yang memuat segala macam hal, memiliki bab dan ayatayat yang begitu rinci. Jika Al-Qur’an menguraikan ajarannya dengan rinci, maka sudah lama Al-Qur’an akan ketinggalan zaman. Pilihan Allah untuk mengungkap petunjuknya dengan bahasa yang umum mengandung hikmah agar manusia menggunakan akalnya untuk menterjemahkan pesan-pesan Allah dan mengkontekstualisasikannya dengan realitas empirik manusia. Pesan umum itulah yang disebut dengan nilai universal Islam yang tetap relevan dengan zaman (salihun likulli zaman wa makan). Ketika Al-Qur’an menyatakan dirinya bahwa ia tidak perlu diragukan apa lagi berkaitan dengan sumbernya, maka sejatinya tidak ada keraguan sedikitpun di hati manusia untuk menerapkan ajaran Al-Qur’an dalam kehidupan nyata. Persoalannya adalah tarikan hawa nafsu dorongan hawa, yang membuat manusia enggan sepenuhnya untuk menerapkan Al-Qur’an. Konsekuensinya adalah, karena Kehidupan di muka bumi tidak di tata sesuai dengan kehendak penciptanya, maka terjadilah kekacauan-kekacauan seperti yang kita alami sekarang ini. Hutan yang gundul menyebabkan banjir dan long-sor. Sungai yang sejatinya dipelihara menjadi tercemar karenaulahmanusia.Manusiamenjadi sumber bencana baik yang berhubungandenganalamaataupundengan kehidupan sosial. Ironisnya akibat buruknya kembali pula kepada kita. Lewat Ramadhan kita sesungguhnya diingatkan kembali untuk hidup bersama Al-Qur’an. Menata kehidupan sesuai dengan petunjuk Al-Qur’an. Di dalam sanubari kita

harus muncul keyakinan, apapun yang ditawarkan Al-Qur’an pastilah mengandung nilai-nilai kebaikan dan kemaslahatan. Terkahir adalah zakat fitrah. Saya mendapat kesan kuat, zakat fitrah sesungguhnya adalah penegasan Islam bahwa akhir dari segala peribadatan adalah amal sosial. Buah dari segala ibadah kita kepada Allah adalah amal sosial. Semakin baik ibadah mahdah seseorang maka semakin tinggi pula kepedualian sosialnya. Kita lihat dalam sholat yang akhirnya salam. Salam itu sendiri yang satu akar kata dengan Islam bermakna kedamaian, ketenangan dan keselamatan. Orang yang shalat harus mampu menebar keselamatan dan kedamaian kepada orang-orang yang berada disekitarnya. Dalam ayat lain dikatakan, sesungguhnya shalat dapat mencegah perbuatan keji dan munkar. Tegasnya sha-lat akan menghasilkan perilaku dan akhlak yang baik. Jika dilihat dari kadarnya, zakat fitrah itu sangat kecil. Apa yang bisa dilakukan dengan 2,7 Kg atau 3,4 Kg beras atau sekitar Rp. 27.000 ribu rupiah. Karena zakat fitrah adalah pemberian simbolis, maka yang dituntut Al-Qur’an dan sunnah Rasul sebenarnya lebih dari itu. Saya ingin mengatakan, kadar di atas adalah batas minimal. Sedangkan maksimalnya tidak berbatas. Sejatinya ketika kita membayar zakat fitrah tidak perlu dibatasi jumlah. Semakin banyak semakin baik. Di dalam hadis disebutkan bahwa zakat fitrah itu adalah tuhratan (pembersih) bagi orang yang berpuasa dan tu’matan (makanan) bagi orang miskin. Adalah tidak logis, besarnya fungsi zakat fitrah hanya ditebus dengan 2,7 Kg beras. Sekali lagi kadar beras yang 2,7 adalah minimal. Mungkin bagi orang yang hidupnya paspasan namun digolongkan mampu membayar zakat, angka di atas sudah memadai. Bagi orang kaya angka tersebut sangat tidak tepat. Ia harus memberi lebih banyak dan tentu saja dengan kualitas materi yang terbaik. Setidaknya tiga hal di atas membuat Ramadhan itu menjadi sangat penting terlebih dalam kaitannya dengan peningkatakan kualitas diri kita sebagai seorang muslim. Moga Ramadhan 1430 H ini tidak berlalu begitu saja tanpa meninggalkan makna penting bagi kita. Mulai sekarang mari kita beri makna setiap hari Ramadhan yang kita lalui. Wallahu a’lam. � Penulis adalah Koordinator Tim Penulis Tafsir Al-Qur’an UTS.

Mengungkap Kembali Makna Ziarah Kubur

Z

WASPADA

iarahkuburpadaawalIslam,ketika pemeluk Islam masih lemah, masihadaberbaurdenganamalan orang-orang jahiliyah yang dikhawatirkanolehNabidapatmenyebabkan perbuatan syirik. Rasulullah SAW ketika itu melarang ziarah kubur, akan tetapi setelah Islam mereka menjadi kuat, dan dapat membedakan mana perbuatan yangmengarahkepadasyirikdanmana yang mengarah kepada ibadah kepada Allah, kemudian Rasulullah Saw menyuruh ziarah kubur, karena ziarah kubur itudapatmengingatkankepadapelakunya selaluteringatkematiandanakhirat. ZiarahkuburolehsebagianmasyarakatkitadiIndonesiaditradisikansebagai amalan yang tidak boleh ditinggalkan, terutama di bulan Sa’ban menjelang Ramadhan,menjelangIdulFitridanhari raya Idul Fitri. Begitupun ada yang beranggapan belum dianggap lengkap menjalankanpuasaRamadhandanhari raya Idul Fitri jika belum ziarah kubur. Pengertian Ziarah Kubur Ziarah kubur terdiri dari rangkaian dua kalimat, yaitu : ziarah dan kubur, yang masing-masing mempunyai arti sebagai berikut, ziarah artinya, datang untukbertemu,sedangkankuburartinya tempat untuk menguburkan manusia. Dengan demikian ziarah kubur adalah: mendatangiataumenziarahiseseorang yang telah dikuburkan, dikebumikan atau disemayamkan dalam kubur. Kubur juga disebut dengan Ad-Dar (rumah),karenakuburadalahmerupakan hunian bagi manusia setelah menjalani kehidupanselamadidunia,kuburdisebut jugadenganAl-Barzakhyaitumerupakan kehidupandialamghaibyangmemisahkan seseorang antara mati menuju ke

Oleh : Drs. H. As’ad Marlan, M.Ag

rumah hunian yang abadi, yaitu rumah akhirat (Addar Al-Akhirah). Allah SWT berfirman : “Dan dihadapan mereka ada pemisah (alam kubur atau barzakh) sampai pada hari mereka dibangkitkan”. (QS. Al-Mu’minin : 100). Kubur juga diartikan sebagai fase kehidupan yang kedua, dimana kehidupan fase ini sangat berbeda dengan kehidupanfaseinisangatberbedadengan kehidupan fase pertama (alam dunya), di alam dunia sebagaimana diyakini antara jasad dan ruh menyatu menjadi satu kesatuan. Akan tetapi dalam kehidupan fase kedua ini (di alam barzakh), berbalik arah jasadlah yang mengikuti ruh, ia hanya pindah dari alam dunia ke alam barzakh (alam ghaib). Olehkarenaitu,menurutsaturiwayat mereka mendengar suara dari alam dunia,sepertisalamorangyangberziarah, sebagaimana sabda Rasulullah Saw berikut : “Rasulullah SAW, pergi menuju ke ahli badar,kemudian bersabda kepada

Konsultasi Al-Quran

Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H. Yusdarli Amar), 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustadz, saya ditanya orang tentang kalimat “qowariro” dalam surat Al-Insan ayat 15-16. Dulu saya pernah menerima panjelasan tentang hal itu, tetapi sekarang sudah agak lupa, sehingga saya ragu memberi jawaban terhadap yang bertanya. Jadi Ustadz, bagaimana cara membacanya? Mohon penjelasan. Dari H.M. Yunus. Tembung. Jawab : Terimakasih atas pertanyaanya, Dalam membaca kalimat “qowariro” pada surat Al-Insan ayat 15-16, dapat kami jelaskan sebagai berikut: 1. Apabila wakaf (berhenti) pada lafazh “qowariro” ayat 15, maka huruf ro dibaca panjang dua harkat. Jadi dibaca “qowariroo” . 2. Apabila washal (disambungkan) pada lafaz “qowariro” pada ayat 16, maka dibaca pendek. Jadi dibaca “qowariro qowa…”. 3. Bisa saja berhenti pada pada lafaz “qowariro” pada ayat 16, tetapi dibaca dengan cara sukunkan huruf ro. jadi dibaca “qowariro qowariir”. 4. Apabila wasal kedua-duanya dan wasal pula pada kalimat berikutnya, maka dibaca pendek. Jadilah bacaannya “qowariro qowariro min fidh…” . (Ahmad Dimyathi Badruzzaman, Dalilul Hairan, mengupas kata-kata pelik dalam bacaan Al-Qur’an. Hal 274-276). Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

mereka,HaiFulanIbnuFulan,apakahengkau benar-benar telah menemukan kebenaranyangdijanjikanAllahdanRasul-Nya kepada kamu?, sesungguhnya saya telah menemukannya,Umar berkata,Ya Rasulullah, mengapa engkau berkata kepada jasadyangtidakmempunyairuh”?Rasulullah menjawab, “Kalian tidak lebih mendengarpembicaraankudaripadamereka, hanyasajamerekatidakdapatmenjawab sedikitpun kepadaku”. (HR. Muslim). Dialaminiruhsesamamuslimbisa salingmengenal,bertemudanberkumpul sebagaimana di alam dunia, karena hakikatnya mereka itu adalah hidup di alamnya sendiri, hal ini dijelaskan AllahSWTdalamAl-Qur’an:“Danbarangsiapa menaati Allah dan Rasul (Muhammad SAW),maka mereka itu akan bersama-sama dengan orang-orang yang diberikan Allah nikmat, yaitu para Nabi, para pencinta kebenaran, orangorangyangshaleh.Merekaitulahteman yang sebaik-baiknya”. (QS. An-Nisa: 69). IbnuAl-Qayyimberpendapatdalam kitabnya “Ar-ruh” ayat tersebut turun karena adanya ke khawatiran para shahabat Nabi mereka akan berpisah denganNabisetelahmeninggalduniananti. Oleh karenanya kehidupan fase kedua ini merupakan kehidupan di alam tersendiri yaitu kehidupan di alam kubur atau alam barzakh yang merupakan kehidupan alam ghaib, maka wajib bagi kita untuk meyakininya dan mempercayai keberadaan dan kenyataannya. Ziarah kubur pernah dilarang Nabi kemudianNabimenyuruhnyakembali untukziarahkubur.Halinidiriwayatkan oleh Imam Muslim, Abu Daud, Baihaqi dan Nasa’i. Rasulullah Saw bersabda : “Dulu aku telah melarang kalian berziarah kubur,maka sekarang berziarah kuburlah kalian, karena sesungguhnya ia dapat mengingatkan kalian akan akhirat. Dan hendaklah ziarah kubur karena akan menambah kebaikan, barangsiapa yang hendak ziarah kubur, maka hendaklah dia melakukannya, dan janganlah kalian berkata dengan kata-kata yang bathil”. Kemudian,setelahkaummuslimin menghayatidanmendalamiajarantauhid yang benar serta larangan kepada syirik, kekhawatiran tersebut menjadi sirna,ketikaituNabiSawmemperbolehkan serta menganjurkan ziarah kubur. Hukum Ziarah Kubur Menurut Imam Nawawy, dalam kitab“Majmu’ Syark Al-Muhadzdzab” berpendapat :“Adapun hukum ziarah kubur telah sepakat nash-nash Imam Syafi’i dan para pengikutnya bahwa ziarah kubur di sunnahkan terutama bagi laki-laki”, sedangkan menurut Imam Asy-Syaukani dalam kitab “Nail Al-Authar”,hadits-haditsyangberkaitan dengan ziarah kubur, semua menunjukkan atas disyariatkan ziarah kubur dan dihapusnya larangan ziarah kubur. Menurut riwayat lain, ziarah kubur

di sunnahkan bagi laki-laki dan dimakruhkanbagiperempuan.Kecualikubur paraNabi,Rasul,UlamadanAuliya,tidak dimakruhkanbagiperempuan.Jikabagi laki-laki dan perempuan pergi ziarah kuburdenganmeratapipenghunikubur serta meminta keselamatan kepada orang yang ada di dalam kubur, maka ziarah kubur mereka itu adalah diharamkan. (fiqh, J’anah at-thalibin, jilid dua, h, 142). Tujuan Ziarah Kubur Berziarah kubur kepada orang tua, kerabatdankaummuslimintidakmesti harus dibulan Sya’ban menjelang Ramadhan, akhir Ramadhan, hari raya dan lainnya, yang dianggap suatu keharusan.Akantetapidianjurkankapan saja asal sesuai dengan syariat Islam. Bagi yang berziarah kubur dianjurkan melakukanbeberapahal:Pertama,mengambil pelajaran atau iktibar dari kematiansepertiorangyangdiziarahinya, AllahSWTtelahmenciptakankematian dankehidupan,setelahkematianiatidak mampu berbuat apa-apa, kecuali yang menyertainya iman dan amal shaleh. Kedua,mengingatakhirat,azabdidunia atau musibah di dunia ini hakikatnya belum seberapa jika dibanding dengan azab diakhirat nanti. Maka oleh karena itu kita disuruh memperbanyak taubat dan muhasabah diri. Ketiga, apabila seseorang telah meninggal dunia dan akhirat menjadi pengikutnya, tentu perbuatannyatidakakansemena-mena mengambilhakoranglaindenganzhalim dan kejahatan lainnya. Adab Ziarah Kubur Adapun tata cara ziarah kubur diantaranya : a. Mengucapkan salam kepada ahli kubur, seperti sabda Rasulullah berikut: “Rasulullah SAW mengajarkan kepada para shahabat jika mereka keluar untuk ziarah kubur, agar mereka mengucapkan, salam.... keselamatan bagi kalian hai penghuni kubur dari orang mukmin dan muslimin, kata InsyaAllahakanbertemudengankalian, aku mohon keselamatan bagiku dan kalian”. (HR. Muslim). b. Berdoa kepada Allah SWT agar orang yang diziarahi itu mendapat ampunan dari Allah SWT. c. Melepas alas kaki, seperti sandal. Rasulullah SAW bersabda.......”Ketika Rasulullah melewati kuburan kaum muslimin, dan berkata, mereka telah mendapat kebaikan yang banyak, dan disaatitupandanganRasulullahtertuju kepada seorang laki-laki, ternyata ia sedang berjalan di kubur sabil mengenakan sandal, Rasul berkata, Hai pemakai sandal celakalah kamu, lepaskankeduasandalmu”.(HR.AbuDaud). d. Tidak duduk di atas kubur, Rasulullah SAW bersabda : “Sungguh duduk di atas bara api, kemudian membakar pakaian dan mengelupas kulitnya, itu lebih baik daripada duduk di atas kubur”. (HR. Muslim). � Penulis adalah: Guru MAL IAIN dan Dosen Fakultas Tarbiyah IAIN-SU

Keutamaan Bulan Ramadhan Allah SWT berfirman tiga kali: ’’Siapa yang memohon maka Aku akan penuhi permohonannya. Siapa yang bertobat maka Aku akan menerima tobatnya, dan siapa mohon ampun maka Aku akan menerima ampunannya.’’ Bulan Ramadhan adalah bulan penuh ampunan. Begitulah keutamaan bulan Ramadhan yang segera kita masuki beberapa saat lagi. Allah SWT berfirman: ’’Setiap kebaikan yang dikerjakan oleh manusia itu dilipatgandakan dari sepuluh sampai 700 kali lipat kecuali puasa, karena puasa itu untuk-Ku dan Aku yang akan membalasnya. Ia meninggalkan keinginan, makan dan minumnya karena Aku. Puasa itu adalah perisai. Bagi orang yang berpuasa itu memiliki dua kegembiraan, yaitu kegembiraan sewaktu berbuka, dan kegembiraan sewaktu bertemu dengan Tuhannya nanti pada hari kiamat. Nabi Muhammad SAW mengabarkan berita gembira kepada para sahabatnya seraya bersabda: ’’Bulan Ramadhan adalah bulan penuh berkah, telah datang kepadamu. Allah SWT mewajibkan atas kamu berpuasa. Pada bulan ini pintu-pintu surga dibuka, pintupintu neraka ditutup, dan setan-setan yang jahat dibelenggu. Dalam bulan (Ramadhan) itu ada Lailatul Qadar yang nilainya lebih baik dari seribu bulan.’’ Oleh karena itu, Nabi SAW mengajak umat Islam untuk bergembira memasuki bulan Ramadhan. Barang siapa yang berpuasa dan mengerjakan shalat malam pada bulan Ramadhan karena iman dan mengharapkan ridha Allah, maka diampunilah dosa-dosanya yang telah lalu. Justru itu, mari kita manfaatkan bulan Ramadhan tahun ini dengan sebaik-baiknya untuk beribadah dan meningkatkan keimanan-ketakwaan serta menjalankan ukhwuah islamiyah. Berpuasa dengan penuh kesabaran, beribadah dengan khusu’ terutama sekali waktu malam, tak lupa bersedekah kepada orang-orang yang kurang beruntung, termasuk memberi panganan berbuka. Pahalanya sungguh luar biasa. (Abu Laits As Samarqandi, Terjemah Tanbihul Ghafilin, penerbit PT Karya Toha Putra, 1993, Semarang). ==

Marhaban Ya Ramadhan “Hai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana diwajibkan atas orang-orang sebelum kamu agar kamu bertakwa.” (QS. Al-Baqarah: 183).

Oleh K.H. Amiruddin, M.S.

R

asulullahMuhammadSAWada bersabdayangartinya:“Sungguh telah datang kepadamu satu bulan yang agung, yaitu pada Ramadhan. Diwajibkan atas kamu berpuasa pada bulan itu, pintu-pintu neraka terkunci, syeitan dubelenggu. Didalam bulan itu ada satu malam uang mulia (lebih baik dari seribu bulan) yaitu “Lailatul Qadar”. (Al-Hadist). Wahai saudaraku yang beriman, ketahuilah bahwa waktu berjalan sedemikian rupa tanpa kita sadari telah menggerogoti jatah usia didunia dan apabila masa hidup telah berakhir dunia ini akan kita tinggalkan . Delapan bulan dalam setahun sudah kita lalui tanpa terasa. Tidak berapa lama lagi bulan suci Ramadhan akan datang menghampiri kehidupan kita. Bulan yang sangat dinantikan oleh orang-orang yang beriman dengan penuh kegembiraan, semangat dan pengharapan. Rasulullah SAW ada bersabda yang artinya : “Siapasiapa yang bergembira menyambut kedatangan bulan suci Ramadhan, Allah mengharamkan tubuhnya disentuh oleh api neraka”. (Al-Hadist). Alangkah meruginya orang orang yang menyia-nyiakan waktu,apatahlagimengisinyadenganmelakukanperbuatanperbuatan maksiat, sementara semua tercatat disi Allah dan akan dipertanyakan dan dipertanggung jawabkan di hadapan Allah SWT. Tidak ada penghapus yang dapat dipergunankan untuk menghilangkan semua catatan noda dan dosa seseorang yang dilakukannya didunia ini. Tidak pula seseorang dapat berbalik kebelakang menebus semua kelalaian dan kelengahannya dimasa lalu. Sungguh hidup ini sangat singkat dan diberikan Allah untuk menguji siapa-siapa yang paling baik amal ibadahnya. ”Yang menjadikan mati dan hidup, supaya Dia menguji kamu, siapa di antara kamu yang lebih baik amalnya. Dan Dia Maha Perkasa lagi Maha Pengampun.”(Surat Al-Mulk: 2). Allah SWT berfirman; Dibulan ini Allah menyediakan peluang dan sarana untuk mensucikan diri dengan meraih maghfirah Nya melalui tobat dan mohon ampunan. Juga kuantitas amal Ibadah dilipat-gandakan untuk mengejar ketertinggalan dan kerugian kita dimasa lalu, jangan lagi menunda waktu ,sehingga tertipu pesona dunia. Bergegaslahuntukmenyambutdanmemenuhinyadengan amal-ibadah. Jangan lalai dan lengah lagi. Bangunlah dari tidur lelap nina bobok duniawi dan mimpi hidup kekal abadi didunia, karena kita akan berpisah dengan dunia ini. Mari kitasambutdanucapakanlahahniyahyangdiajarkanRasulullah Muhammad SAW untuk menyambut Ramadhan, yaitu: “MarhabanYa Ramadhan, MarhabanYa Ramadhan” Keutamaan Bulan Ramadhan Bulan Ramadhan adalah bulan yang dinantikan kehadirannyadalamsetahunolehorang-orangyangberiman. Bulankesembilan menurutderetanhitungan bulanqamariyah ini memiliki beberapa keistimewaan yaitu : 1. Pemimipin ( induk) dari semua bulan yang dua belas selama setahun. 2. Bulan yang didalamnya diturunkan Kitab Suci al- Qur‘anul karim. 3. Didalam bulan Ramadhan ada satu malam lebih baik dari seribu bulan( lailatul Qadar). 4. Bulan dimana orang berdo‘a akan diijabah oleh Allah SWT. 5. Amal Ibadah mendapat peningkatan penilaian ,amal ibadah yang wajib digandakan pahalanya 70 kali lipat dan amalan yang sunnat nilainya dipersamakan dengan yang wajib. 6. Pada bulan itu pintu syurga dibuka dan pintu neraka dikunci. 7. Syeitan dibelenggu pada bulan Ramadhan. 8. Shalat tarawih dikerjakan setahun sekali hanya dibulan Ramadhan. 9. Bulan yang apabila orang meniggal dunia waktu itu, dihapuskan darinya siksa kubur. 10. Yang paling penting adalah bahwa dibulan Ramadhan diwajibkan manusia beriman berpuasa dan ibadah puasa sangat disukai Allah SWT. Amalan-amalan Di Bulan Ramadhan 1. Melaksanakan Shaum (Puasa) pada siang hari dan hukumnya wajib. Sikaporangberimanmenerimadanmelaksanakanibadah baginya bukanlah beban atau kewajiban yang memberatkan akantetapihalitumerupakaninvestasiukhrawi sebagaibekal di akhirat untuk dinikmati. Dibulan suci Ramadhan ada amal Ibadah yang wajib dilaksanakan dan ada pula yang sunnat untuk dikerjakan. Melaksanakan Shaum ( Puasa) pada siang hari dan hukumnya wajib. ” Hai orang-orang yang beriman, diwajibkan atas kamu berpuasa sebagaimana diwajibkan

atas orang-orang sebelum kamu agar kamu bertakwa,” (Surat Al-Baqarah: 183). 2. Melaksanakan Shalat Tarawih pada malam hari Bulan Ramadhan. Shalat ini dapat dilaksanakan secara berjama‘ah ataupun sendirisendiri dan mengenai jumlah reka‘at sebaiknya tidak diperdebatkan apakah delapan atau dua puluh rekaat. Kerjakan saja dengan ikhlas sebab keduanya memiliki dasar yang sama kuat dan yang menilai amal ibadah itu adalah Allah SWT. bukan manusia. 3. Membaca Al-quran ( Tadarrus). Ramadhan adalah bulan turunnya Al-Qur‘an dan Rasulullah Muhammad SAW. membaca AlQur‘an dan disimak oleh malaikat Jibril. Adalah sangat tidak pantas apabila kita umatnya justeru mengabaikan apa yang yang dicontohkan oleh Rasulullah ini, seyogiyanya kita lebih rajin lagi. 4. Bersedekah hidangan berbuka dengan pebukaan yang telah disiapkan atau dengan cara berbuka puasa bersama. Rasul menganjurkan dan mengerjakan ini,nilainya seperti orang yang berpuasa. 5. Banyak berzikir dan bertasbih sambil melakukan I‘tikaf didalam masjid diwaktu yang lowong. 6. Mengeluarkan zakat mal apabila telah sampai nisab dan khaulnya. Hal ini sangat menggembirakan sebab nilai amal yang wajib dlipat gandakan 70 kali dibulan suci yang penuh berkah ini. 7. MenyelenggarakanTa‘lim untuk meningkatkan ilmu pengetahuan umat Islam dengan beragam peluang seperti: Kultum, Kulipat, Kutejam,dan lain-lain sebagainya. 8. Menyelenggarakan peringatan Nuzulul Qur‘an, sebagai momentum untuk mengingatkan umat Islam bahwa Ramadhan adalah bulan ulang tahun turunnya Al-Qur‘an, sekaigus mendorong untuk memberantas buta huruf Al-Qur‘an. 9. Mengeluarkan Zakat Fitrah dipenghujung Ramadhan. Meskipun timing wajibnya adalah tanggal 1 Syawal maka untuk inventarisasi pezakat, inventarisasi penerima zakat danuntukuntukdistrbusiyangtepatwaktusertatepatpenerima, maka diakhir Ramadhan baik dilakukan. 10. Adalahsangatbermanfaatapabiladapatdiselenggarakan Bulan Da‘wah masuk desa selama bulan suci Ramadhan. Sebab antusias umat untuk menambah amal pada bulan Ramdhan lebih tinggi dan bergairah. 11. Sebagai penutup apabila Ramadhan akan lenyap diufuksenjatatkalamentariterbenammengantarRamadhan pergi,KumandangkanlahTakbirsebagaiungkapankemenangan dan kesyukuran. Allah SWT berfirman: ”Dan hendaklah kamu mencukupkan bilangannya dan hendaklah kamu mengagungkan Allah atas petunjuk-Nya yang diberikan kepadamu,supayakamubersyukur.”(SuratAl-Baqarah:185). BergembiralahmenyambutbulansuciRamadhan sebab kegembiraanituakanmenjauhkanengkaudarisiksaapineraka. Rasulullah Muhmmad SAW ada bersabda yang artinya: “Barangsiapa bergembira menyambut kedatangan bulan Ramadhan diharamkan Allah tubuhnya disentuh oleh api neraka”.( Al-Hadist). Kegembiraan menyambut Ramadhan adalah ekpressi qalbu yang sehat dan suci berlandaskan keyakinan yang diikuti dengan tindakan mengerjakan ibadah dengan tulus dan ikhlas mengharapkan ridho Allah SWT. Meskipun akan meniggalkan makan dan minum pada siang hari dan dilarang bergaul dengan pasangan suami isteri, hal tersebut tidak membuat orang beriman merasa tersiksa akibat tertundanya pemenuhan kebutuhan biologis tersebut disiang hari sebab berpuasa itu perintah Allah. Tentu ada jaminan dari Allah yang memerintahkan berpuasa bahwa tidak makan dan minum disiang hari dan menjauhi bergaul dengan pasangan suami isteri tidak mendatangkan mudarat serta mengandung hikmah baik bagi kesehatan badan maupun kelezatan lainnya sebagai imbalan yang disediakan bagi saimun. Rasulullah Muhammad SAW ada bersabda yang artinya: “Ada dua kegembiraan bagi orang yang berpuasa; pertama pada waktu berbuka puasa disenja hari; dan kedua ketika bertemu dengan Tuhannya Allah SWT. diakhirat nanti”. (Al-Hadist). Selamat menyambut bulan suci Ramadhan dan selamat beribadah kepada saudara-saudaraku , wahai orang-orang yang beriman! � Penulis adalah Dosen IAIN Sumatera Utara, Ketua Umum TAZKIRA (Taishiah, Zikir dan Doa) Sumatera Utara, Pengurus Ikatan Persaudaraan Haji Indonesia Jakarta, Mubaligh Mancanegara (ASEAN), beralamat : 1. Jl. Nyiur Melambai Kompleks Setneg Blok P No. 23 Telp. 43904689 Jakarta. 2. Jln. Suluh No. 139 Telp. 6617468 Medan – Sumatera Utara/ Hp. 08126006639.

Mimbar Jumat

WASPADA

Jumat 21 Agustus 2009

15

Syarat Dan Imbalan Puasa Dalam Al-Qur’an

Mencari Lailatul Qadar Alhamdulillah. Bulan Ramadhan 1430 H Insya Allah masih dapat kita lalui, karena bulan ini sangat agung dibandingkan bulan-bulan lainnya, di mana di 10 hari terakhir bulan Ramadhan ini ada misteri malam ’lailatul qadar’ yang menjadi dambaan bagi orang-orang beriman. Kita sebut ’misteri’ karena kita tidak tahu persis kapan datangnya malam ’lailatul qadar’ itu. Maka sangat merugilah orang-orang yang mengabaikannya. Mudah-mudahan kita dapat menjalani bulan puasa ini dengan mulus. Artinya, kita sambut gembira datangnya bulan penuh mahfirah ini. Kita jalani sejak hari pertama dan seterusnya, sampai memasuki hari ke-21. Setelah itu kita pun berjaga-jaga, meningkatkan amalan kita terutama di malam ganjil untuk mendapatkan ’lailatul qadar’. Mengenai ’lailatul qadar’ ini cukup banyak haditsnya di antaranya: Bahwasanya Nabi Muhammad SAW ke luar ruangan sementara orang-orang sedang bertengkar, kemudian Nabi SAW bersabda: ’’Aku datang bermaksud untuk memberi tahu kepadamu tentang ’lailatul qadar’ hanya saja aku khawatir kamu akan bersandar kepadanya dan barangkali akan menjadi lebih baik. Carilah ’lailatul qadar’ itu pada malam ganjil, tanggal 21, 23, 25, 27, dan pada malam terakhir. Tanda-tandanya yaitu: malam itu cuaca dan udaranya terang, tidak panas dan tidak dingin, dan pagi harinya matahari terbit dengan cahaya yang tidak tajam. Barang siapa yang menghidupkan malam itu dengan iman dan mengharapkan ridha Allah SWT, maka Allah mengampuni dosanya yang sebelum itu. Nah, saatnya kita songsong Ramadhan ini dengan membersihkan jiwa kita, memohon ampunan kepada orang tua dan rekan-rekan/tetangga. Rasanya tak sabar kita menuggu tibanya Ramadhan, apalagi menunggu untuk bisa mendapatkan ’lailatul qadar’’ yaitu satu malam bila kita melaksanakan ibadah, seperti shalat, membaca Al-Quran, zikir dll maka pahalanya seperti beribadah 1000 bulan, maka surgalah imbalannya. Dalam hadits lain disebutkan: ’’...pada malam 26 beliau tidak ke luar, lantas pada malam 27 beliau bangun malam dan mengajak semua anggota keluarga serta mengerjakan shalat bersama-sama dengan kami sehingga kami khawatir (kalau-kalau) kami kehabisan waktu untuk sahur.’’ Tak pelak lagi, Ramadhan adalah bulan mulia, bulan penuh berkah dan mahfirah, bulan di mana keutamaannya sangat luar biasa. Selamat datang Ramadhan. Selamat mencari ’lailatul qadar’.(Abu Laits As Samarqandi,Terjemah Tanbihul Ghafilin, penerbit PT Karya Toha Putra, 1993, Semarang).

A

da yang beranggapan bahwa imbalan taqwa akan berlaku secara otomatis bagi orangorang yang mengerjakan ibadah puasa. Anggapan ini muncul karena terpengaruh dengan kata la’allakum yang diartikandengan“kepastian”karenayang mengucapkannyaadalahTuhan.Berbeda halnya dengan ucapan manusia yang maknanya adalah“mudah-mudahan” yaitu sesuatu yang belum pasti. Pengertian“pasti”padakatater-sebut tidak bersifat mutlak karena masih ada syaratyangharusdipenuhisebagaimana disebutkanpadapang-kalayat.Dengan demikian,kepastiantaqwahanyaberlaku bagiorang-orangyangtelahmemenuhi syaratketikamengerjakanibadahpuasa. Adapun orang-orang yang tidak memenuhi syarat dimaksud maka tidak termasuk ke dalam jaminan ayat. Pengaruh dari anggapan ini menyebabkan kurangnya perhatian terhadap syarat yang dikemukakan oleh al-Qur’an pada pangkal ayat yaitu iman dan ikhlas karena terobsesi dengan imbalantaqwasebagaimanadisebutkan pada akhir ayat. Oleh karena itu, banyak orangyangmengerjakanpuasanamun tingkah lakunya tidak mencerminkan nilai-nilai taqwa sama sekali. Ajakan al-Qur’an yang terfokus kepada orang-orang yang beriman dan kemudianmembandingkankewajiban puasa dengan umat terdahulu (sebagai bentukdarikeikh-lasan)dapatdijadikan sebagaiukurantentangnilaipuasayang dilakukan.DalamtataraniniTuhantidak akan gegabah memberikan imbalan kepada orang-orang yang tidak memenuhikriteriauntukmendapatkannya. Korelasi Antara Syarat dengan Imbalan Berdasarkan ayat di atas nampaknyaal-Qur’anhanyamengajakorangorang Mukmin untuk me-laksanakan ibadah puasa. Kemudian al-Qur’an membuat semacam perbandingan bahwa kewajiban ibadah puasa sudah pernah diwajibkan kepada umat-umat terdahulu. Pada akhir ayat, al-Qur’an menegaskan bahwa puasa dapat mengantarkan pelakunya ke jenjang taqwa. Fokus ajakan al-Qur’an yang hanya tertuju kepada orang-orang Mukmin adalah sebagai isyarat bahwa iman

(Kajian Q.S. Al-Baqarah Ayat 183) Hai orang-orang yang beriman, kamu diwajibkan berpuasa sebagaimana halnya orang-orang sebelum kamu supaya kamu menjadi orang-orang yang takwa. (Q.S. al-Baqarah ayat 183).

Oleh Achyar Zein

termasuksalahsatusyaratpentingyang harus diperhatikan oleh orang-orang yang mengerjakan puasa. Dengan demikian,makasyaratimanmerupakan salah satu faktor yang dapat mempengaruhi nilai puasa seseorang dalam mendapatkan prediket taqwa. Urgensi menetapkan iman menjadi salah satu syarat dalam ber-puasa karena orang-orang Mukmin dapat memahami bahwa setiap ketentuan Tuhan pasti baik untuk hamba-Nya. Sebaliknya, orang-orang yang tidak beriman selalu beranggapan bahwa puasaadalahbebanyangmenyusahkan dan karena itu mereka tidak pernah berupaya untuk mencari manfaat dari setiap ketentuan Tuhan. Adapun dimaksud dengan“iman” pada ayat di atas -menurut al-Thabari (w. 310 H)- ialah orang-orang yang beriman kepadaTuhan dan Rasul-Nya serta membenarkan dan mengakui ketetapan keduanya. Tafsiran yang dikemukakan oleh al-Thabari ini menunjukkan bahwa orang-orang Mukmin senantiasa berbesar hati menerimasetiapke-tentuanTuhandan Rasul termasuk ketentuan berpuasa. Bagi orang-orang Mukmin, seruan al-Qur’an supaya melaksanakan puasa

adalah sebagai peluang untuk meningkatkan kualitas diri ke jenjang yang lebihtinggi.Olehkarenaitu,responorangorang Mukmin dalam menghadapi kehadiran puasa selalu disambut dengan hati yang gembira karena kehadirannya sudah lama ditunggutunggu dan dirindukan. Responsepertiinilahyangdiinginkan oleh Tuhan sehingga al-Qur’an hanya memfokuskanajakannyakepadaorangorang Mukmin tidak kepada yang lain. Dengan demikian, ajakan al-Qur’an ini sekaligusmerupakansyaratutamauntuk mencapaitargetdaripelaksanaanibadah puasa yang tanpanya maka target dimaksud tidak akan pernah terealisasi dengan baik. Selainpersyarataniman,makaayat di atas juga mensyaratkan adanya keikhalasanuntukmenerimakewajiban puasakarenakewajibantersebutsudah pernahberlakumulaidaridulu.Adanya syarat ikhlas ini dapat dipahami dari penggalan kalimat kama kutiba ‘ala allazina min qablikum (sebagaimana sudah diwajibkan kepada umat-umat sebelum kamu). Pentingnya syarat ikhlas dalam melaksanakan ibadah puasa karena ibadah ini termasuk ke dalam kategori ibadah berat lantaran merubah tradisi yanglazimberlakusehinggadiperlukan ikh-las dalam melaksanakannya. Oleh karena itu, perbandingan kewajiban ibadah puasa yang dilakukan oleh alQur’andenganumatterdahulubertujuan agar ibadah puasa dikerjakan dengan landasan ikhlas. Dengan demikian, perbandingan kewajibaninimenunjukkanbahwasifat ikhlas dapat menjadi motivasi dalam mengerjakansesuatudan karena itusetiappekerjaanyangberatdapatmenjadi ringan bilamana dilandasi dengan keikhlasan. Berdasarkan hal ini maka

ibadah puasa sekalipun terkesan berat namunjikadilandasidenganikhlastetap saja merupakan nikmat tersendiri bagi pelakunya. Keduapersyaratandiatas(imandan ikhlas) menunjukkan bahwa manusia memiliki peran dalam menentukan kualitaspuasayangdilakukannya.Selama kedua sya-rat ini dapat dipenuhi maka ma-nusia berhak untuk mendapatkan nilaibaikdaripuasayangdilaku-kannya. Sebaliknya, jika manusia tidak mengindahkan kedua syarat tersebut maka haknyagugurmen-dapatkannilaipuasa yang baik. Persyaratan ini pada prinsip-nya memberikan kebebasan kepada manusiadalammenilai,dankarenanya jangan bermimpi bahwaTuhan menerima puasa seseorang jika syarat-syarat di atas belum terpenuhi dengan baik. Dalamtataraninidapatdipastikanbahwa puasa yang akan diterima atau yang mendapat imbalan dariTuhan apabila puasa dimaksud sesuai dengan syarat yang sudah ditetapkan. Pernyataanal-Qur’ansebagai-mana pada akhir ayat la’allakum tattaqun (mudah-mudahan kamu bertaqwa) tidakberlakuseca-raotomatisbagisetiap orang yang mengerjakan ibadah puasa. Pemberlakuan ini hanya diberikanTuhan secara khusus kepada orang-orang yangmengerjakanibadahpuasaapabila puasa yang dilakukan dilandasi dengan keimanan dan keikhlasan. Tanpakedualandasanini(imandan ikhlas) maka dapat dipastikan bahwa puasa yang dikerjakan oleh seseorang gagal dalam mencapai taqwa. Hal yang seperti ini sudah dikemukakan oleh Rasulullahdalamsebuahhadisnyabahwa “banyak sekali orang-orang yang mengerjakanibadahpuasaakantetapitidak dapatnilaiapa-apadaripuasanyakecuali hanya sekadar lapar dan haus saja”. Penutup Melalui kedua persyaratan di atas maka jaminan al-Qur’an bahwa puasa akan membuat pelakunya menjadi orang-orang yang bertaqwa adalah jaminan yang bersyarat. De-ngan kata lain, imbalan taqwa hanya diberikan kepadaorang-orangyangmengerjakan ibadah puasa apabila puasa yang dilakukannya dilandasi oleh keimanan dan keikhlasan.

Marhaban Ya Syahrushshiyam

K

etika tulisan ini diturunkan, hanya dalam hitungan hari saja, bahkan hitungan jam kita akan menyambut kedatangan bulan yang paling istimewa diantara dua belas bulan yang dijadikan Allah SWT. Keistimewaan bulan ini nampak jelas ketika ia satu-satunya nama bulan yang disebut Alquran dari 12 (dua be-las) nama bulan yang dikenal dalam Islam. Di dalam surat alBaqarah ayat 185 Allah SWT berfirman: Bulan Ramadhan bulan yang di dalamnya diturunkan Alquran, sebagai petunjuk bagi manusia dan penjelasan mengenai petunjuk itu dan pembeda (antara yang hak dan yang batil). Keistimewaan lain dari bulan ini, adalah diturunkan padanya Alquran, kemenangan Rasul SAW dan orangorang mukmin dalam perang Badar, penaklukan kota Makkah, adanya Lailatul Qadar, digandakan pahala amal ibadah, dibukakan pintu surga dan ditutup pintu neraka, diangkatnya Muhammad SAW di Gua Hira’ menjadi Rasul, diwajibkan puasa, dan sebagai penghapus dosa sepanjang tahun sampai Ramadhan berikutnya. Rasul SAW bersabda: Ramadhan ke Rama-dhan adalah kafarat (penghapus dosa) antaranya selama tidak me-lakukan dosa-dosa besar. (HR. Ah-mad dan an-Nasai). Demikian mulianya bulan Ramadhan dalam pandangan Islam, sehingga ulama terdahulu dan kaum

muslimin senantiasa menantikan kedatangan bulan Ramadhan bahkan mereka berdo’a 6 bulan sebelumnya agar dapat hidup pada bulan Ramadhan berikutnya, dan ketika berakhir Ra-madhan, mereka berdo’a lagi selama 6 bulan agar anak mereka selama bulan Ramadhan diterima oleh Allah SWT, demikian seterusnya. Di negara ini tidak ketinggalan umat Islam, nampak mengekspresikan kegembiraannya menyambut kedatangan bulan yang mulia ini dengan berbagai kegiatan, baik dengan murni kegiatan ibadah atau murni tradisi, atau campuran antara tradisi dan ibadah. Tidak ada ditemukan di dalam Alquran dan hadis, anjuran untuk melakukan upacara-upacara tertentu untuk menyambut kedatangan bulan Ramadhan. Demikian pula ibadah khusus sebagai penghormatan, atau ucapan Tahniah lainnya yang dijadikan seremonial penyambutan bulan yang agung itu. Kenyataan yang kita lihat di masyarakat muslim menjelang datangnya Ramadhan mereka berduyun-duyun datang berziarah kekuburan, men-do’akan orang tua dan kaum kerabat mereka yang telah berpulang ke rah-matullah. Hal ini tidak ada hubungan sama sekali dengan bulan Ramadhan, karena berziarah ke kuburan memang dianjurkan di dalam syariat Islam baik laki-laki maupun perempuan, sama ada pada bulan-bulan biasa atau ketika menjelang Ramadhan.

Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B.Darat II Al-Waritsiin Jl. Bilal No. 71 Kel.Pulo Brayan Darat I Al-Quddus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Baiturrahman Jl. Gaharu Komplek PTPN-II Bustanul Huda Jl. Perwira I Lingk. VIII Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nurul Yaqin Jl. Bukit Barisan I No. 74 Nur Chadidjah Komp.Wartawan Jl. Letter Press No.51 Syuhada Jl. Budi Pengabdian No. 03 P. Brayan Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Taqwa Kampus UMSU III Jl. Kapt.Mukhtar Basri No.3 Taqwa Jl. Rakyat/Lr. Maninjau No.6 Sidorame Timur Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.B. Darat II Taqwa Jl. Pelita II No. 3/5 Sidorame Barat Taqwa Jl. Mustafa No. 1 Glugur No. 1 Kp. Dadap Taqwa Ubudiyah Jl. Bambu III Kel. Durian MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No.1 Ar-Ridho Jl.Tuasan Gg.Sukun No.10 Kel.Sidorejo Hilir Ar-Ramli Jl. Sidorukun Ujung/Jl. Surya Lingk. XII Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel.Bantan At-Tawwabin Jl. Pimpinan No. 1 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Falah Jl. Pukat Banting IV No. 10 Al-Hidayah Jl. Letda Sujono No.62 Kel. Bdr. Selamat Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5B Al-Huda Jl. Tuasam Gg. Aman Al-Ikhlas Lingkungan II Kel. Bandar Selamat Al-Ikhlash Jl. Pukat V Kel. Bantan Timur Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muhajirin Jl. Garuda II Kel. Kenangan Baru Al-Muslimun Jl. Pertiwi No.94 Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur INDRAPURA Jami’Indrapura Kota KISARAN Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Husna Simpang 6 Kel. Kisaran Barat Nurul Yaqin Jl. K.H. Agus Salim Pasar Lama Nurul Huda Jl. Malik Ibrahim No. 37 LABUHAN BATU

Oleh H.M. Nasir, Lc, MA Demikian pula tata cara berziarah, para ulama Fikih tidak mengatur urutan dan tata tertib yang wajib diikuti. Namun yang paling baik dilakukan oleh para penziarah kuburan adalah memilih waktu yang telah ditetapkan oleh para ulama. Menurut ulama mazhab Hanafi, mazhab Maliki, baik dilakukan pada hari Kamis, Jum’at dan Sabtu. Dan menurut mazhab Syafii, waktu ziarah dilakukan pada hari Kamis selepas Ashar sampai matahari terbit pada hari Sabtu. Sedangkan menurut mazhab Hanbali, tidak ada ketentuan waktu dalam berziarah kubur, dan baik dilakukan kapan saja. Para ahli Fikih 4 mazhab mengemukakan hal-hal yang hendaknya dilakukan oleh para penziarah : Pertama: Mengucapkan salam dengan posisi berhadapan dengan wajah mayat. Salam yang diajurkan oleh Nabi dan sahabatnya antara lain: Assalâmu’alaikum ya dâra qaumin mukminin, wainna insya Allah biqum lahiqun. (Assalâlaikum wahai penghuni tempat kaum mukminin, sesungguhnya kami insya Allah akan menyusul kalian. (HR. Muslim). Kedua : Menanggalkan alas kaki hukumnya sunat menurut mazhab Imam Ahmad, sedangkan menurut mazhab Jumhur Ulama hukumnya

Drs. Darfikri K.H. Zulfikar Hajar, Lc Drs. H. Sangkot Saragih Drs. Syahrein Pane Drs. M. Labib Maulana Drs. H. Akhiruddin Muhid Ahmad Harahap, BA Drs. Syahridan L. Tobing Drs. Dahron Hasibuan Drs. Abdul Majid Syam DR. H. Sudirman, Lc, MA Drs. Hasanuddin, MA Samidi Ahmad Yunan Siregar, S.Ag Nahar A. Gani, Lc, MA Gunawan, S.Ag A. Sampurna, S.Ag Sayuti Lubis, S.Ag Drs. Khairul Siregar Saraman, S.Ag Fahmi Hutasuhut, S.Pd.I Drs. H. Syauri Syam Drs. Nazrun Drs. Legimin Syukri Drs. Hasan Basri Siregar Drs. H.M. Yahya Zakaria Drs. Kasto Nadir, N.K. Syofyan Lubis, BA Ibrahim Lubis Drs. H.M. Yahya Zakaria Shufriadi Drs. H.A. Halim Siregar Drs. A. Irma Harahap Drs. K.H. Mahyuddin Nasution Iriansyah Drs. H. Mhd. Haji, SH Drs. Muh Haji, SH Aswiluddin Rambe, S.Pd.I Drs. H. Parenta Siregar

mubah (harus). Menurut ulama di kalangan mazhab Hanbali, ziarah hukumnya sunat dilakukan berdiri. Ketiga : Membaca ayat-ayat Alqur-an karena menurut keyakinan Ahli Sunnah wal Jamaah dan menurut Jum-hur Ulama Fikih termasuk diantaranya sebagian dari ulama Syafiiyah menga-takan bahwa : pahala bacaan Alquran yang diniatkan kepada orang yang telah mati akan bermanfaat dan sam-pai kepadanya. Menurut mazhab Hanafi dianjurkan membaca surat Yasin, alFatihah, 5 ayat awal surat al-Baqarah, ayat Kursi, akhir surat al-Baqarah dari âmanar-raul, surat al-Mulk, surat a-Takatsur, dan surat al-Ikhlas 3 kali atau sampai 12 kali. Sedangkan jumhur ahli Fiqih mengatakan baca ayat-ayat apasaja yang termudah bagi penziarah.

Al-Muhtadin Jl. Bantam No. 15-A Lingk. III Baiturrahman Jl. Willem Iskandar Psr V Medan Estate Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 9 Kel. Bantan Timur Ubudiyah Jl. Mandala By Pass No. 110 Ulul Albab Jl. IAIN No. 1 IAIN-Sumatera Utara Taqwa Jl. Belat No. 76B Taqwa Jl. Tangkul II No. 128-A Taqwa Jl. Enggang Raya No. 85 Taqwa Jl. Kolam No. 01 Kampus I Medan Estate MEDAN TUNTUNGAN Ar-Rahman Griya Nusa Tiga Lingk. 03 Tg. Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hasanah Jl. Teh 10 Perumnas Simalingkar Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Muhtadin Jl. Kemiri Raya I No. 1 Blok-G Al-Muhajirin Jl. Kopi Raya II Blok A Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Baitul Rahman Jl. Rami II Simalingkar Nurul Hayat Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Silaturrahim Jl. Kapas 13 No. 49 Perum. Simalingkar Taqwa Jl. Sawit Raya Perumnas Simalingkar DELI SERDANG Amal Islamiyah Kel. Lubuk Pakam Pekan Ainul Yaqin Jl. Pembangunan IV No. 30 Al-Furqon Perumahan Bumi Tuntungan Sejahtera DSC Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hafiz Desa Hamparan Perak Kec. Hamparan Perak

Baiturrahman Kamp. Masjid Kec. Kualuh Hilir L.Batu BATU BARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al Mukhlisin PT. Moeis Kel. Perk. Sipare-Pare Nurul Iman Dusun V Pasar Lapan Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Keempat : Berdo’a memohon ampunan bagi ahli kubur dan seluruh ahli Fikih, berpendapat bahwa do’a berman-faat bagi si mayat, berdasarkan firman Allah SWT : Dan orang-orang yang datang sesudah mereka (Muhajirin dan Ansor) mereka berdo’a : Ya Tuhan kami beri ampunlah kami dan saudara-saudara kami yang telah beriman lebih dahulu dari kami, dan janganlah Engkau biarkan kedengkian dalam hati kami terhadap orang beriman,Ya Tuhan sesungguhnya Engkau Maha Penyantun lagi Maha Penyayang. (QS. Al Hasyr : 10). Dan do’a dilakukan meng-hadap kiblat dan ditutup dengan do’a yang diajarkan Nabi SAW: Allâhumma la tahrimna ajrahu wala taftinna ba’dahu (Ya Allah jangan Engkau halangi kursi untuk menerima pahala mereka dan janganlah Engkau menimpakan musibah kepada kami setelah kematian mereka. (HR. Abu Daud). Kegiatan lain yang dilakukan oleh kaum muslim di negeri ini menjelang Ramadhan adalah punggahan. Punggahan ini berarti membongkar muatan seperti layaknya orang membongkar barang-barang dari dalam kapal. Barangkali tradisi sebagian masyarakat kita jauh sebelum datang bulan Ramadhan sudah mempersiapkan dana tabungan untuk upacara penyambutan Ramadhan, sampai 2 hari atau 1 hari menjelang Ramadhan ta-

Drs. Amiruddin Batubara Drs. Ramli Nur, MA Azrai Al Bantany H. Muhammad Taufiq, MA Drs. H. Zainul Fuad, MA H. Abd. Muluk Lubis Drs. H. Bahauddin Nst., Lc Drs. H. Aswan Lubis Prof. Dr. H. Asmuni, MA Drs. Suprapto Zefri Arisky M. Yunus Daulay, S.Ag H. Ismet Junus, LMP, SDE Usban Drs. H. Hasby Yunus Drs. Mhd. Syafi’i Nasution Drs. H. Marahalim Hrp., M.Hum Ali Asikin, BA Drs. Syahrul Hadidhy, SH Ponimin, S.Ag Syafruddin Syam, MA Drs. Nazaruddin Sir, S.Ag Ishaq Daely Drs. H. Ahmad Basirun Drs. Aman Parlindungan Nuraswara Putra, ST Drs. Ma’ruf Lubis Afwan Helmi, S.Ag H. Marzuki Supriono, S.Pd.I Ahmad Fauzi Lubis, S.Ag Drs. Sahabat Berutu

Aslan Marpaung Bahauddin Lukman Yanis A. Hadi Nur Mariadi Drs. Zainuri, AR

bungan yang telah disimpan sebelum Ramadhan dibongkar untuk membeli daging hewan, dan makanan untuk disantap bersama, sambil silaturrahim dengan warga diiringi dengan bermaafan antara sesama. Dan tradisi ini dipandang oleh syara’ adalah suatu tradisi yang baik, sekaligus merupakan budaya lokal yang perlu dipelihara karena banyak memberi manfaat untuk menjaga persatuan antara warga masyarakat. Nabi SAW bersabda: Apa yang dipandang oleh kaum muslimin itu baik maka di sisi Allah juga baik. Hal lain yang menjadi tradisi masyarakat kita adalah mandi pangir atau mandi dengan air yang dicampur dengan daun-daunan yang wangi. Kebiasaan ini dilakukan menjelang detik-detik datangnya bulan Ramadhan sebagai ekspresi kegembiraan untuk memakmurkan masjid shalat Tarawih berjamaah. Islam memang tradisi ini merupakan perbuatan baik (istihsan) sepanjang tidak ada yang berbau khurafat. Akhirnya, selain dari yang telah disebutkan, masih banyak lagi hal yang dilakukan dalam rangka penyambutan bulan suci Ramadhan sesuai dengan budaya lokal masingmasing. Lain lubuk lain ikan – lain padang lain belalang. Semua itu boleh dilakukan sepanjang tidak bercampur aduk dengan khurafat dan perbuatan-perbuatan maksiat sebagai ungkapan kegembiraan atas datangnya bulan rahmat yang penuh

karunia Allah SWT. Dan oleh karenanyalah Allah menyuruh bergembira : Qul bifadhlillahi wabirahmatihi fabizalika falyafrahu (katakanlah dengan rahmat dan karunia-Nyalah handaklah mereka bergembira. (QS. Yunus : 58). Secara nasional penyambutan Ra-madhan tahun ini bernuansa lain dari tahun-tahun sebelumnya, karena Rama-dhan tahun ini diawali dengan peristiwa-peristiwa yang dapat menorehkan sejarah kebersamaan kita dan keprihatinan kita, diantaranya baru saja anak bangsa ini menyelesaikan pesta demokrasi, lalu di goncang oleh bom di Hotel J.W. Marriot dan Ritz Carlton oleh tangan-tangan nakal yang dapat mengusik keberagamaan kita. Setelah itu disambut pula oleh pera-yaan hari ulang tahun kemerdekaan sebagai ekspresi kegembiraan karena terbebasnya anak bangsa ini dari penjajahan fisik, dan akhirnya usia kita disampaikan jua oleh Allah SWT ke bulan Ramadhan 1430 H. dalam upaya untuk memerdekakan diri kita dari penjajahan nafsu dalam rangka untuk mencapai kemerdekaan hakiki. Wallahua’lam. Marhaban ya Ramadhan Marhaban ya Syahrushshiam � Penulis adalah : - Pimp. Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batu Bara - Pembantu Rektor IV Universitas Al Washliyah (UNIVA) Medan - Anggota Komisi Fatwa MUI Medan

Al-Iskhlas (YAMP) Komp. Perkant. Pemkab L. Pakam Al-Muttaqin Jl. S.M.Raja Km.12 Gg.Rasmi T.Morawa Al-Muttaqien Gg. Kolam Deli Tua Baiturrahman Jl. Merica Raya Blok F Kec.Pancur Batu Baitussalam Dagang Kerawan-Tg. Morawa Baitul Mukmin Jl. Medan-Binjai Km.15,5 Kec.Sunggal Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa Khairul Fatihin Dusun II Tg. Morawa-A Nurul Ikhwan Jl. H.A. Dahlan No. 38 Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Taqwa Jl. Diponegoro No. 1 Lubuk Pakam TEBING TINGGI Amal Muslimin Kampung Rao Ash-Sholihin Jl. Badak Lingk. I Kel. Bandar Utama An-Namirah Perum.Griya Prima Ling.II Kel.Tg.Marulak Al-Falah Jl. Ksatria Kodim-0204/DS Al-Falah Jl. Ir. H. Juanda Lingk. I Kel. Karya Jaya Al-Hidayah Kel.Tg.Marulak Hilir Lingk.03 (Kp.Keling) Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16-A Al-Mukhlis Jl. A. Yani/Sakti Lubis Al-Muthmainnah Lingk. I Kel. D.Sundoro Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Musyawarah Jl. Abd. Rahim Lubis No. 48 A Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Darul Jannah Jl. Bhakti LKMD Lingk. I Kel. Lalang Farida Jl. H. Ahmad Bilal Kel. Damar Sari Jami’ Jl. Batu Bara Kel. Satria Nurul Hidayah Jl. G.Martimbang II Kel. Rantau Laban Syuhada Jl. Iskandar Muda No. 70 Taqwa Jl. Prof. H.M.Yamin Kel. Sri Padang Kp.Keling Quba Tanjung Kubah PEMATANG SIANTAR Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba RANTAU PRAPAT Al-Qodar Jl. Torpisang Mata Atas D A I R I Al-Muhajirin Perumnas Kalang Simbara Telaga Zam-zam Kecamatan Sidikalang

Drs. H. Senen Sulaiman, MSi Drs. H. Nasrun Zakaria Drs. H. Usman Harahap Drs. Muhammad Nasution Drs. Jamaluddin Ginting Misto, A.R. Risan, S.Pd.I Syaifuddin Nur, S.Ag H. Arif Mhd. Erde, S.Pd.I Yatiman, S.Pd.I H. Ali Amran Zakaria, Lc Drs. H. Jalaluddin Hasibuan Drs. H.A. Taufik Lubis, S.Pd.I H. Waluyo/Ibrahim Batu Bara Nasiruddin Nasution Muhammad Misrin Ahmad Toga Marbun, S.Ag Sugianto H. Sujarno, S.Ag Sofyan, MS Drs. H. Ibrahim Harahap H. Amir Hasan, BA Khairul Anwar Siregar, SH Hamdani Rangkuti T. Azmi,S.Sos.I Zuhril Lubis A. Yasin De Frasong Syahidin Albantani Ishak Ibrahim, S.Pd.I Drs. H. Hamdani Budi Agustiono, SH Drs. A. Yasir Nainggolan Muslim Sinulingga H. Zulkarnain Ismail Iswadi Lubis, S.Ag Drs. H. Usman Ahmad I. Lamhot Nadeak, S.Ag Drs. H. Mhd. Hatta Nst., SH

16

Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Drs. Lahmuddin Lubis Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Drs. H. Ahmad Syafiar, MA Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Drs. H. Muhiddin Ginting Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Drs. Abd. Rahman Batu Bara Al-Ihsan Jl. Bromo Gg. Sukri No. 2 Kel. Tegal Sari II Drs. H. Ade Pivan Al-Ikhwanul Wathan Jl. A.R. Hakim Gg. Langgar Drs. Mahmuddin, MA Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Ibnu Hajar Harahap Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib Nol 15 Fahmi Ilham, S.Ag Al-Makmur Jl. A.R. Hakim Gg. Langgar No. 25 Asri Koto Al-Misbah Jl. A.R. Hakim Gg. Langgar/Dame No. 27 Darhot Hasibuan, S.Th.I Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Drs. H. Saleh Umar Istiqlal Jl. Halat No. 53 Drs. H. Abu Sammah Pulungan Jamik Jl. M.A. Selatan No. 289 Kel. Surakamai-I Drs. H. Azwardin Nasution Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I H. Arief Muhammad, S.Pd.I Jami’ Darul Ikhlas Jl. Batu No. 13 M. Tuah Sirait, MA Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8A Burhanuddin Siagian, MA Khairiyah Jl. Rahmadsyah Gg. Subur 192 H. Muhammad Yahya Muslimin Jl. Selam II No. 47 H. Abdul Muthalib Husba Muslimin Jl. Dr. Sun Yat Sen No. 71 Kota Matsum I Drs. M. Yunan Silalahi Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Drs. H. Mardjan, AN Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Drs. Maulana Siregar, MA Silaturrahim Jl. Emas No. 10 Drs. H. Mulkan Daulay Silaturrahim Jl. Bromo Gg.Silaturrahim Kel. T.Sari III Drs. Amri, S. Syekh Hasan Maksum Jl. Puri Gg. Madrasah H. Darwis Usman, Lc Taqwa Jl. Bromo Gg. Taqwa No. 11 Rafdinal, S.Sos, MAP Taqwa Jl. Megawati H. Nahar Abd. Ghani, Lc Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No.240AR Drs. Muslim Wahid Siregar Taqwa Jl. Demak No. 3 Irwan Syahputra, S.Ag, M.Ag Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8 Drs. Tanerman MEDAN AMPLAS Amaliyah Jl. K.H. Rivai Abdul Manaf Nasution No. 83 Drs. H.M. Syuib Saragih Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No.60 Prof.DR.H.Ramli Abd.Wahid,MA Al-Hilal Asrama Widuri Eks Brigif 7 Jl. S.M. Raja Amir Husin Al-Muhajirin Jl. Bajak II H Gg. Nasional No. 100-D Aslen SThI, MA Al-Waqif Jl. Sempurna Kel. Sudirejo I Tengku Syafruddin, S.Ag Hijratur Ridho Jl. Selamat Ujung Gg. Subrah No. 12 Drs. Ahmad Jaminan Hasibuan Ikhwanul Muslimin Jl. Swadaya Lingk. XVI Marindal Prof. DR. H. Basyaruddin, MS Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Drs. Syahrul Effendi Siregar Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Drs. H.M. Joyo Nurul Islam Jl. M. Nawi Harahap Sofyan Daulay, S.Pd.I Nurul Iman Jl. S.M. Raja Km. 09 Timbang Deli Drs. M. Adnan Yus, SH Nurul Barkah Jl. Selambo IV No. 29 Sori Monang, MA Nurun Nabatiyah Jl. S.M.Raja Komp.Kantor Kehutanan Drs. H.M. Basyir Yahya Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Rusli Effendi, S.Pd.I Salman Jl. STM. Kel. Sitirejo II Drs. H. Hamdan Yazid Raya Taqwa Jl. S.M.Raja Km.5,5 No.1 Kel.Harjo Sari Drs. Zulkifli Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B Drs. Zulkarnain Lubis, MA MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Prof.Dr.H.M.Hasballah Thaib,MA Al-Amanah Komplek GKN Jl. P.Diponegoro No. 30-A DR. H.M. Sofyan, MA Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Abdul Roni, S.Ag Al-Ikhlas Jl. Sei Padang No. 129 Jailani, S.Pd.I Dakwah Jl. Dr. Hamzah No. 2 Kampus USU H.M. Nuh A. Muiz, M.Si Muslimin Jl. Batang Serangan No. 93 Drs. H. Azhar Anwar Nurul Muslimin Jl. DR. TD. Pardede No. 42 H.Z. Zainal Arifin Nurul Huda Jl. Djamin Ginting Km. 8 Kwala Bekala Drs. Umum Sitepu Nurul Huda Jl. Sei Serayu No. 38 Drs. Khairuman Arsyad Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob Drs. Lisman Lubis Taqwa Kampus II Jl.Setia Budi No.79-B/Jl.Sei Serayu Prof.Dr.H.A.Ya’kub Mtd., MA MEDAN BARAT At-Taqwa Jl. Puteri Hijau No. 14 Musohur, S.Ag Al-Furqan Jl. Karya II Kompleks Ex Kowilham Kel.K.B. Drs. H.M. Ridwan Siregar Al-Hasanah Inna Dharma Deli Jl. Balaikota Drs. H. Khaidir Tanjung Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Roni Darwin, S.T. Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran H. Faisal M. Jamil Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Drs. H. Mahyuddin Nst., MA Al-Massawa (Arab) Jl. Temenggung (Arab) No. 2,4,6 Drs. A.R. Piliang Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Akhyar Zein, M.Ag Haji Maraset Jl. Sei Deli No. 139 Drs. Lily Suheri Jami’ Jl. Merdeka No. 3 Pulo Brayan Kota Drs. H. Ahmad Taufiq, SH Jami’ Jl. Kejaksaan Ujung Ahmad Jais, M.Ag Jami’ Ash-Shalihin Jl. S.M. Raja No. 178-A Bukhori Muslim, S.Ag Nurul Hidayah Jl. Danau Singkarak Gg.Masjid Lingk. I Drs. Ilyas Ismail Nurul Islam Jl. Karya Lk.VIII No.203 Kel.K.Berombak H. Sutan Syahrir D., S.Ag Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Drs. H. Muaz Tanjung, MA Rabithatul Muslimin Lingk. 14 Kel. Glugur Kota Dr. Ky. Maragading Syuhada Komp. Trikora Jl. Danau Toba No. 2 Watni Marpaung, MA Taqwa Jl. Karya Gg. Madrasah No. 24 Drs. Abd. Kadir Jaelani MEDAN BELAWAN Al-’Aqabah Jl. Taman Makam Pahlawan G. Arang Drs. H. Sya’banuddin Amir Jami’ Belawan Jl. Selebes Belawan H. Zakaria Rasyidi MEDAN DELI Amalyatul Huda Jl. Nusa Indah No.22-A Kel.Tg.Mulia Drs. Paino Ar-Ridho Komplek TNI AL Barakuda Tg. Mulia Hilir As’ad Marlan, MA Ar-Rakid Jl. Kol. Laut Yos Sudarso Khairil Fatah, SH As-Sa’adah Jl. Aluminium IV Gg.Tawon Tg. Mulia Drs. H. Dharma Bakti Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg.Mulia Syamsul Bahri Al-Ikhlas Jl. Aluminium III Kel. Tg. Mulia Drs. H. Ibrahim Al-Ikhlas Complek Deli Raya Kel. Titi Papan Drs. H. Ardiansyah, Lc, M.Ag Al-Munawwarah Jl. Pulau Batam No. 1 Drs. Yusuf As’ady Al-Mustaqiem Kel. Tg. Mulia H. Parmohonan Nasution Al-Syarifah Jl. Metal Gg. Rukun Ling. 18 Tg. Mulia Drs. Sofyan, M.S. Jamik Jl. K.L. Yos Sudarso Km. 6,2 Drs. H. Sahbudin, K.S. Jami’iyyatush Shoolihiin Jl. Almunium I Lk. XIII Mahyudi, S.Ag Nurul Iman Jl.Sidomulyo Ujung Lingk. XXVI Tg.Mulia Bahaudin, S.Ag MEDAN DENAI ‘Arafah Jl. Boromo Ujung/Jl. Selamat Gg.Mulia No.3 Ahmad Riduan, S. Ar-Ridha Jl. Camar 18 Perumnas Mandala H.M. Ansyari, MA Al-Ansor Jl. Raya Tenggara Gg. Ansor Drs. H. Anwar Noor Siregar Al-Fajar Jl. Harapan Pasti No. 50 Kel. Binjai Drs. Syahroni Husein Al-Hidayah Jl. Menteng Indah VI H Blok D7 Drs. Tarmizi Effendi Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah DR. H.Roihan Nasution, Lc, MA Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Harmein Lubis Al-Mukhlishin Jl. Bromo Ujung/Jl.Selamat Kel. Binjai Drs. Bulian M. Purba Al-Mukhlishin Jl. Enggang I Perumnas Mandala Drs. H. Nurman Almy Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg.Kurnia Drs. H. Darwin Nasution, Lc Al-Quba Jl. Denai/Rawa No. 233B Kel. Tegalsari I H. Marajaksa, S.Ag Baiturrahman Jl. Medan Tenggara VII No. 42 Drs. Ahmad Syukron Jannatul’alim Jl. Pancasila/Rawa Cangkuk IV No. 1 H. Mhd. Hafiz, Lc Nurul Iman Jl. Rawa Lr. Sedar M. Feri Al Banzar, S.Ag Nurul Hidayah Jl. Tangguk Bongkar II No. 28 Irham Khalid Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Drs. H. Abdul Djalilsyah, Lc Taqwa Jl. Bromo Gg. Aman Drs. Faisal Lubis Taqwa Jl. Mandala By Pass No. 140 Tanwir Siagian Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel. T.S.M.III Sapri Chan, MA MEDAN HELVETIA As-Syarifah Jl. Pembangunan Komp. Pondok Surya Drs. Tarmizi Attholibin Husni Jl. Veteran Gg. Utama Pasar 5 Drs. Hamdan Manurung Al-Amal Jl. Banten Gg. Amal Dusun X Drs. Rubino A. Sayuti Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Drs. H. Syahrul Limbong Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. H. Mukhlis Lubis Al-Furqoan Jl. Kemboja Raya No. 02 Perum Helvetia Drs. Abdul Majid Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora M. Bahren, AR, BA Al-Ikhlas Jl. Klambir Lima Gg. Bahagia Drs. H. Amran Bahrum Al-Ikhlas Jl. Pembangunan Gg. Melati No. 16 Abdul Karim, S.Ag Al-Ikhlas Jl. Jongkong No. 1A Komp. Dolog DR. H. Amnas, N. SH Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. Mulia Harahap Al-Ishlah Jl. Kapten Muslim No. 54-A Drs. H. Marasonang Siregar Al-Jihad Jl. Veteran Pasar 8 Helvetia Manunggal Mhd. Azmi Al-Mustaqim Jl. Kapten Muslim No. 226 Drs. Zulkarnain Al-Mukhlisin Jl. Bakti Utara No. 21 Tg. Gusta Ponidi Sabari Al-Muhajirin Perumahan Bumi Asri Helvetia I DR. H. Muzakkir, MA Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Drs. Syafi’i Zailani Darussalam Jl. Asrama No. 11 Drs. H. Raden Taufiq Istiqomah Jl. Amal Luhur No. 86 Drs. Idrus Uteh Nurul Iman Jl. Bambu No. 37 Pasar IV Ir. Anwar Marpaung Ubudiyah Jl. Klambir Lima Lingk II Tg. Gusta Safruddin Haris, BA Shilaturrahmi Jl. Gaperta Gg. Sekolah, 120 H. Suhaidi, Lc Taqarrub Jl. Darussalam No. 24 H. Mufti Ahmad Nasihin Taqwa Sukadono Jl. Pemasyarakatan Gg. M.Taqwa Drs. H. Sudarno Taqwa Tanjung Gusta Jl. Setia No. 30 Asrizal Tanjung Taqwa Helvetia Jl. Kamboja Raya no. 319 Blok 4 Sahirman, S.Ag Taqwa Jl. Kapten Sumarsono, Gg. Safar Drs. H. Syahrul Nasution, M.Ag Taqwa Jl. Kapten Muslim Gg. Jawa Sultan Syahrul MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Aswan Efendi, S.Ag Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Drs. Jainuri Amaliyah Perumahan Citra Wisata Drs. Syahroni Husein Assyafi’iyah Jl. Suka Tari No. 9 Ali Idrus, S.Ag Ar-Raudhah Komplek Risva I Blok V Drs. H. Nazarudin Ainul Iman Jl. Eka Warni I Kel. Gedung Johor Drs. Suherman, MA Annazhirin Jl. Karyawisata Gedung Johor Drs. Abdul Jalil Husen Al-Amin Jl. Eka Surya Gg. Eka Kencana Rustam Harahap, S.Pd.I Al-Badar Jl. Karya Dharma No. 19 Kel. Pkl. Masyhur Fahruddin Rokan, S.Ag Al-Hidayah Jl. Karya Jaya Gedung Johor Drs. Safwan Harahap Al-Huda Jl. Eka Surya Psr V Gg. Sidodari Ged. Johor Nuruddin Maktub, S.Ag

WASPADA Jumat 21 Agustus 2009

Masjid Faisal Islamabad, Terbesar Di Asia Selatan Masjid Faisal di Islamabad merupakan masjid terbesar di Pakistan dan Asia Selatan dan menempati urutan keenam di dunia. Predikat masjid terbesar dunia pernah dipegang masjid ini dari 1986 sampai 1993, ketika posisinya tergeser dengan selesainya pembangunan Masjid Hassan II di Casablanca,  Maroko. Pelebaran lanjutan Masjidil Haram di Makkah dan Masjid Nabawi di Madina pada 1990-an membuat posisi Masjid Faisal merosot ke urutan keempat dalam hal ukuran besarnya. Masjid Faisal merupakan masjid nasional Pakistan. Luas area di bawah naungan atapnya 5.000 m2 dan secara keseluruhan mampu menampung kira-kira 300.000 jamaah yang terdiri dari 100.000 jamaah di dalam masjid, halaman dalam dan serambi, ditambah 200.000 jamaah di halamannya. Walau ruang utamanya lebih kecil dibanding Masjid Hassan II, Masjid Faisal menempati urutan ketiga dalam hal daya tampung jamaah di halaman luarnya, setelah Masjidil Haram dan Masjid Nabawi. Masjid Faisal memiliki empat menara yang tingginya 80 m, tertinggi di Asia Selatan Nama Raja Faisal bin Abdul Aziz dari Arab Saudi ditabalkan untuk masjid ini, karena jasanya sebagai pendukung dan penyandang dana pembangunannya. Wacana pembangunan masjid ini dimulai pada 1966 ketika dalam kunjungan resminya almarhum Raja Faisal mendukung inisiatif pemerintah Pakistan untuk membangun masjid nasional di Islamabad. Tiga tahun kemudian diadakan sayembara internasional yang diikuti arsitek-arsitek dari 13 negara dengan 43 rancangan. Diperlukan waktu empat hari untuk memutuskan pemenangnya, rancangan arsitek terkenal

Masjid Faisal dengan empat menara bergaya Turki setinggi 80 meter ( foto kanan atas), bermandikan cahaya pada malam hari (foto atas) dan pemandangan di dalam masjid (foto kanan)

Al-Ikhlas Jl. STM Suka Ikhlas H. Awaluddin Yahya, Lc Baiturrahman Komp Perum Johor Indah Permai I Drs. H. Nazaruddin Hasibuan Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor H. Idris Yusuf, BA Al-Ikhlas Jl. Karya Tani Lingk. VIII Pkl. Masyhur Drs. H. Sazlin Nasution Al-Issyah Hakim Jl. Karya Jaya/Namo Rambe Psr IV Drs. Zarlan Lubis Al-Muslimin Jl. Suka Luhur Kel. Suka Maju H. Ahmad Iqbal, Lc Al-Muhsinin Jl. Pintu Air Simp. Pos Ahmad Junaidi Al-Muharram Jl. Eka Budi Gedung Johor Drs. M. Syaukani Al-Mahmudiyah Jl. Brigjen Hamid Km.5 Kel. T.Kuning Drs. M. Ridwan Baitul Iman Jl.Karya Jaya Asrama Arhanud P.Masyhur Drs. H.M. Selian Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Hanafi Hasibuan, S.Pd.I Baitussholihin Jl. Karya Bakti No. 71 H. Abdul Rahim, SA, Lc Fajar Ramadhan Komplek Perum.Johor Indah Permai II H. Ali Husin Siregar Muslimin Jl. Karya Jaya No. 120 Kel. Pkl. Masyhur Devrizal Lubis, S.Pd.I Muslimin Jl. Eka Surya Pasar V Pamonaran Siregar Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Drs. Amrin Yus Namiroh Asrama Haji Embarkasi Medan Drs. H. Ramli Abd.Wahid S.,MA Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur H. Safria, SHI Nurul Falah Jl. Eka Rasmi 42 Kel. Gedung Johor Drs. H. Azhari Lubis Silaturahmi Jl. Brigjen Zein Hamid Ling. XVI G.Wakaf Drs. Shafwan, S.Pd.I Sunnah Rabithah Jl. Karya Darma Pkl. Masyhur Mawardi MEDAN KOTA Al-Hidayah Jl. Saudara Kel. Sudirejo-II Drs. Zabir Rasyid Al-Hasanah Jl. Tanjung Bunga II Kel.Sudirejo II Komaruddin, S.Ag Al-Huda Jl. Kemiri III No. 28 Drs. Fahmi Ahmad Al-Ikhlas Jl. Salak No. 09 Drs. Masaludin Berutu Al-Mashun Medan Deli Jl. Sisingamangaraja Drs. H. Ulumuddin Hamsyi Baiturrahim Jl. Pelajar Timur Gg. Darmo No. 5 Drs. Ismail Panjaitan Da’wah Jl. Sakti Lubis Gg. Amal No.5 Kel. Sitirejo-I Drs. H. Yusdarly Amar Muslimin Jl. Air Bersih Lingk. III Kel. Suderejo I Drs. Jamaluddin Pohan Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 Drs. Zainal Abdin Zein Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Prof. DR. H. Abdullah Syah, MA Islamiyah Jl. Jati 3 No. 85 Teladan Timur Deliman Siregar, S.Ag Jami’ Teladan Jl. Teladan/Gembira No. 2 Drs. Darfikri Jamik Jl. Air Bersih Gg. I Kel. Sudirejo-I Masrianto, S.Ag Pahlawan Muslim Jl. Pencak Drs. H. Syahminan Hasibuan Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Fahmi Hutasuhut, S.Pd.I Raya Pusat Pasar Drs. H. Agus Taher Nasution Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Drs. H. Muniruddin, M.Ag Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel.Sitirejo Drs. Muas Tanjung Taqwa Jl. Mahkamah K. 36-C Kel. Masjid Drs. Zulkifly Tarbiyah Simpang Limun Drs. H. Khaidir Lubis Thawalib Jl. S.M. Raja Gg. Isa No. 7 Drs. Alhuda Yusuf MEDAN LABUHAN Ash-Shobirin Jl. Pancing V Lingk. III Kel. Besar H. Bachtiar Wahid Al-Husein Jl. Raya Griya Martubung Kel. Besar H. Hasan Basri Sai Al-Mukarramah Kampung Besar Darat Kel. Martubung Hasan Basri Sai Baitul Ikhwan Jl. T. Lestari 12/198 Griya Martubung H. Amaluddin Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No.234 Hasan Elwahby Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Drs. H. Ilyas Halim, M.Pdi Nurul Khairiyah Jl. Veteran Ujung Pasar X Drs. Paino MEDAN MAIMON ACC Jl. Palang Merah No. 2 Drs. Tagor Muda Lubis Abidin Jl. Brigjen Katamso Km.III No.420 Kel.Kp.Baru Drs. Ahmad Azizi Al-Husna Jl. Teratai Fajar Hasan Mursyid, Lc Al-Muhajirin Jl. Letjend. Suprapto No. 2 Drs. H. Abdullah Jamil, M.Si Al-Mujtahidin Jl. Brigjen Zein Hamid Gg.Lori Kp.Baru Agus Rizal Koto Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 H. Achdar Bunaiya Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 H. Maddin Nasution Jami’ Kamp. Baru Medan Jl.Brigjen Katamso No.53 Drs. H. Sofyan Jami’ ‘Aur Jl. Kampung Aur Kel. Aur Drs. Komaruddin Dalimunte Muslimin Jl. Brigjen Katamso Lingk. II Pantai Burung Ahmad Ilyas, S.Ag PT.Bank Negara Indonesia (Persero) Jl. Pemuda No.12 DR. Dalail Ahmad, MA Thoyyibah Jl. Multatuli Lingk. V No. 64 Drs. Rafly Hasan MEDAN MARELAN Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Drs. Yusril Fuad Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Syahrudin, S.Pd.I Taqwa Jl. Marelan Raya Pasar 3 Timur Drs. Tukiman MEDAN PERJUANGAN Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 DR. Ir. H. Rafiqi Tantawi, MA Al-Amin Jl. Prof. H.M. Yamin SH, 482 Drs. Saparuddin, MA Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Drs. H. Abdul Karim Rangkuti Al-Falaah Jl. Ibrahim Umar No. 3 Drs. Bahron Nasution Al-Huda Jl. Malaka No. 117 H. Hanafi Ismet Fahmi, Lc Al-Ikhlas Jl. Setia Jadi Gg. Masjid Drs. H. Thoharuddin, AG Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Armia Yusuf Drs. Syahlul Amin Al-Muslimin Jl. Gerilya No. 1 Al-Majidiyah Jl. Prof.H.M. Yamin SH Gg. Belimbing Drs. H. Romalis Tanjung Hidayatul Ihsaniyah Jl. Sentosa lama Gg. Aman No.5 Abdul Majid Amar, SHI Istiqomah Jl. Bambu Runcing/Pahlawan H.M. Rusman, Lc Ikhwaniyah Jl. M. Yacub No. 3 Drs. Mustafa Gholayani Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir-I Bachrum Syam Ibnu Sina RSU DR.Pirngadi Jl. Prof.H.M.Yamin No.47 DR. Ramlan Yusuf Rkt., MA Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. Muslim Wahid Siregar Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Hidayatullah, S.HI Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Drs. H. Musa Yahya Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Drs. Muslim Nasution Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Abdullah Hakim, S.Ag MEDAN PETISAH Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan H. R.M. Syafii, SH Ar-Ridhwan Jl. Abd. Hamid No.28 Kel. S.P. Tengah Drs. H.Azhari Akmal Tarigan,M.Ag As-Syahaadah Jl. Sikambing Belakang No. 18 Drs. Nazaruddin Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Usmar Chan Al-Hidayah Jl. Periuk Gg. Masjid No. 2 H. Usman Lubis

Vedat Dalokay dari Turki. Pembangunan masjid dimulai 1976, didanai pemerintah Arab Saudi dengan biaya saat itu lebih dari 130 juta riyal. Masjid dan jalan raya yang menuju masjid diberi nama King Faisal bin Abdul Aziz setelah Raja Arab Saudi itu tewas terbunuh pada 1975. Pembangunannya rampung pada 1986 dan belakangan Dalokay memenangkan penghargaan Agha Khan Award melalui masjid ini. Awalnya, banyak pemuka Muslim mengecam rancangannya yang tidak konvensional dan tidak adanya struktur kubah tradisional. Kecaman-kecaman mereda sejalan dengan pembangunannya, oleh ukuran, bentuk masjid dan setting lokasinya di ujung utara Islamabad dengan latar belakang Bukit Margalla, kaki pegunungan Himalaya paling barat. Menaranya memperlihatkan pengaruh arsitektur tradisional masjid Turki, kurus dan seperti pensil. Di ruangan utamanya tergantung lampu kristal indah yang sangat besar. Dinding bagian dalamnya berhias mosaik dan kaligrafi karya seniman terkenal Pakistan. Kini, Masjid Faisal merupakan ikon paling terkenal kota Islamabad. Masjid Faisal disebut-sebut sebagai salah satu contoh arsitektur modern Islam paling terkemuka di dunia. (m04)

Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Drs. H. Irham Hasibuan Al-Mukaram Jl. Sikambing Gg. Citarum No. 58 Drs. Azwani Lubis, MA Nurul Hidayah Jl. Tinta No. 69 Kel. Sei Putih Barat Nazrial Amin, S.Ag Nurul Haq Jl. Listrik No. 12 Drs. H. Tuah Sirait, M.Ag Istiqamah Pasar Petisah H. Hasmin Nasution Istiqomah Jl. Abdul Hamid No. 70 H.M. Ibrahim, Lc Raya Aceh Sepakat Jl. Mengkara No. 2 Drs. H. Abd. Hadi Harahap Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman Drs. M. Ilyas Mustawa MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Drs. H. Takhlak Mahmud Al-Hidayah Jl. Starban Kel. Sari Rejo Khuza’i Has, BA Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel.Sari Rejo Alamsyah Ahmad Baitussalam Kosek Hanudnas III H.M. Syafiar, Lc, MA Bakti Jl. Mongonsidi Baru I No. 11 Sari Guna Rambe, S.Ag Dirgantara Lanud Jl. Imam Bonjol No. 52 Drs. H. Bahrum Saleh Hsb. MA Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Drs. Samporna Silalahi Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Razai, BA Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Drs. Lebimin Syukri MEDAN SELAYANG Al-Arif Kompl. Tm.Setia Budi Indah II Blok III No.136 Drs. H. Fahmi Mahyaruddin Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Sugeng Raharjo, S.Ag Al-Ghufron Jl. Suka Baru No. 21 Kel. P.Bulan Syarifuddin Sinaga, S.Ag Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. Adi Sucipto Al-Ikhlas Pasar VII, P. Bulan Drs. Muhammad Nasution Al-Muttaqin Jl. Setia Budi Gg. Tengah No. 11 Ahmad Zaid, M.Ag Al-Muhtadun Jl. Karya Sembada No. 179 Drs. Hakimuddin Jami’ Jl. Psr I Lingk. VIII Tg. Sari H. Ali Imron, S.Ag Muslimin Jl. Setia Budi Kel. Tg. Sari H. Jamaluddin, Lc Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Asno Susanto Nurul Mukmin Jl. Bunga Mawar No. 46 Drs. H. Irham, H. Nurul Mukminin Jl. Kenanga Raya No. 10 Tg. Sari Drs. H. Ramlan Nurussalam Jl. Bunga Cempaka No. 53 P.B.S. II Drs. H. Zahiruddin Nasution Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Solihin Dalimunthe Salamiyah Jl. Bunga Wijaya Kesuma, 58 D Pasar IV S. Muliono, S.Ag, MPd Taqwa Jl. Setia Budi Pasar I/Abd. Hakim No. 2 Burhanuddin, M.Ag Taqwa Jl. Bunga Wijaya Kesuma Psr IV Gg. M.Taqwa Drs. Nazaruddin Lubis Taqwa Jl. Sembada No. 25/33 Legino, S.Pd.I MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Rahmad Siswanto, S.Pd.I Ar-Ridha Jl. Darussalam No. 52-A Kel. Babura H. Rahmat Fitriansyah, S.Ag Ar-Ridha Jl. Tut Wuri Handayani Perkamp.Kodam I/BB Drs. A. Suhaili Al-Basyir Jl. Garuda No. 78B Sei Sikambing B Drs. Isman Rambe Al-Badar Jl. Binjai Km. 6,8 Medan Drs. H. Adlan Sirait Al-Falah Jl. Murni No. 27 Tg. Rejo Dasuki Al Jawawi Al-Hasanah Jl. Stasiun No. 4 Dusun I Tg. Gusta Mukhsin Nasution, S.Ag Al-Huda Jl. Perjuangan No. 44 Tg. Rejo H. Suhaidi, Lc Al-Hikmah Jl. Kiwi No. 7 Sei Sekambing B. Drs. Mahyiddin, M.Ag Al-Hafiiz Jl. Pinang Baris No. 142 M. Kamiluddin Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Imran Al-Ikhwan Eks Komplek PTP III Desa Lalang Drs. Poniman, S. Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Diski M. Yusriza, S.Ag Al-Istiqomah Jl. Raya Medan-Binjai Km.11,5 Dusun I Drs. H. Khairul Akmal Rangkuti Al-Irma Jl. Rajawali Sei Sikambing-B Drs. Syukri Albani, MA Al-Jihad Jl. Sunggal No. 129 Drs. Syarifuddin Al-Jariah Jl. Gagak Hitam No.117 Sei Sikambing-B H. Syarifuddin Siagian Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Drs. Ali Mulkan Siregar Al-Muttaqin Jl. Masjid No. 51 Lingk. II Helvetia Drs. Saukani Muda, MA Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Drs. H.M. Syarifuddin Al-Muhajirin Kompl. BBLKI Jl. Gatot Subroto Km.7,8 Drs. Ardiansyah Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Drs. H. Sahrin Alazhar Lubis Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Drs. Abd. Wahab Kalimantan Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo H. Muhsin Siddiq Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Drs. Lili Suheri Istiqomah Jl. Binjai Km. 7.2/Perwira No. 20 Nurdin, S.Ag Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Drs. H. Azhari Akmal Trg., MA Isti’adah Jl. Amal No. 4 Kel. Sunggal Drs. H. Nazrul Fachri Hamyar Jamik Jl. Pinang Baris No. 19 Kel. Lalang Ridwan, S.Pd.I Jamik M.Jayak Jl. Gatot Subroto Km. 5,5 No. 184 Drs. Mhd. Solihul Amri Mukhlisin Jl. Darussalam/ Sei Rokan Drs. H. Darwansyah Simanjuntak Nurul Huda Jl. Garuda No. 29 Sei Sikambing-B Drs. Burhanuddin Harahap Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Turman Nasution, S.Pd.I Nurul Amaliyah Jl. Jend. Gatot Subroto Km. 9 Drs. H. Khairul Anwar Riyadussholihin Lingk. XIV Kel. Sei Sikambing-B H. Syafi’i Muchtar, SH Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo DR. H. Syarbaini Tj. Lc, MA, Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Drs. H. Mahmuddin Sirait Silaturrahim Jl. Perintis Kemerdekaan D.SeiSemayang M. Syukur, SE Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Drs. Khalidin Musa Taqwa Jl. Garuda Sei Sikambing-B Drs. Sulidar, M.Ag Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Hasnan, S.Ag MEDAN TIMUR Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. Humala Harahap Amal Ridha Jl. Cemara P. Brayan Bengkel Baru Amal Pasaribu, S.Ag Amaliyah Jl. Perwira II Pulo Brayan Bengkel Drs. H. Faham Ritonga Arrahim Jl. Purwosari Gg.Puskesmas P.Brayan Bengkel Dhiauddin Tanjung, SHI Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Drs. H.M. Samin Pane Al-A’la Jl. Pembangunan I No.46 Krakatau Kel.Glugur Drs. Musdar Syahban Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Drs. H. Asoolani Pulungan Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Drs. Makmur Situmorang Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Drs. H. Zulkarnain Mahfuz Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.B. Alibinaga, S.Ag Al-Ikhwan Jl. Prajurit No.28 Gg.Bali Kel.Glugur Darat Drs. Bahari Ahmad Al-Ihsan Jl. Jemadi No. 34 Drs. Soeparlan Al-Ikhlas Hubdam-I/BB Jl. Timor No. 23 Drs. Amrul Fuad Harahap Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Ruslan Idri, BB Al-Ikhlash Jl. Madiosantoso No. 197 Lingk. 14 Drs. Khairuddin, MA Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Drs. H. Juanda Sirait Al-Mukhlishin Jl. G.B. Josua No. 8 Drs. Mahyuddin Lubis

Sumatera Utara

WASPADA Jumat 21 Agustus 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:29 12:36

‘Ashar 15:58 16:11 15:59 16:06 16:06 16:02 15:59 15:55 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46

‘Isya

Imsak

Shubuh Syuruq

Kota

19:57 20:14 19:58 20:08 20:06 19:57 19:57 19:52 20:00

04:51 05:00 04:51 04:56 04:56 04:59 04:52 04:48 04:54

05:01 05:10 05:01 05:06 05:06 05:09 04:52 04:58 05:04

Langsa 12:36 L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:31 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28

06:21 06:31 06:22 06:26 06:27 06:29 06:23 06:18 06:25

Zhuhur ‘Ashar 16:01 16:04 15:57 15:57 16:08 15:56 15:57 15:57 15:53

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:47 18:52 18:42 18:42 18:54 18:37 18:40 18:39 18:36

20:01 20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49

04:52 04:54 04:50 04:49 05:00 04:52 04:50 04:51 04:49

05:02 05:04 05:00 04:59 05:10 05:02 05:00 05:01 04:59

Sabang 12:46 Pandan 12:33 Sibolga 12:32 Sidikalang 12:34 Sigli 12:44 Singkil 12:37 Stabat 12:34 Takengon 12:40 T.Balai 12:29 Tapaktuan 12:39

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:25 06:20 06:19 06:30 06:22 06:21 06:22 06:19

Zhuhur ‘Ashar 16:11 15:58 15:58 15:59 16:02 16:02 15:59 16:05 15:54 16:04

17

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

19:00 18:40 18:40 18:43 18:44 18:44 18:44 18:52 18:38 18:48

20:14 19:53 19:53 19:56 19:58 19:58 19:57 20:06 19:51 20:02

05:00 04:54 04:53 04:53 04:57 04:57 04:51 04:56 04:48 04:57

05:10 05:04 05:03 05:03 05:07 05:07 05:01 05:06 04:58 05:07

Tarutung 12:32 T.Tinggi 12:31 Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:38

06:31 06:24 06:24 06:23 06:27 06:27 06:22 06:27 06:18 06:28

Zhuhur ‘Ashar 15:57 15:56 15:54 16:01 15:59 15:55 15:57 15:54 15:54 16:04

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:39 18:41 18:35 18:42 18:43 18:39 18:40 18:36 18:35 18:51

19:53 19:54 19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05

04:52 04:49 04:52 04:59 04:54 04:48 04:51 04:51 04:51 04:54

05:02 04:59 05:02 05:09 05:04 04:58 05:01 05:01 05:01 05:04

06:23 06:20 06:22 06:29 06:24 06:19 06:21 06:21 06:21 06:24

Perampok Bersenpi Antar Provinsi Diamankan KISARAN (Waspada) : Anggota sindikat perampok bersenjata api (senpi) antar provinsi diamankan Polres Asahan di tempat dan waktu yang berbeda. Polisi juga mengamankan dua pucuk senjata api (senpi) jenis FN organik.

Waspada/Sapriadi

SENPI : Polres Asahan AKBP Rudy Sumardiyanto didampingi Kasat Reskrim AKP Hendry Yulianto melihat dan memeriksa senpi jenis FN organik yang digunakan tersangka perampok dan alat bukti lainnya, seperti dua lakban, dua borgol dan sebilah senjata tajam. Foto direkam, Kamis (20/8).

Sejumlah Kafe Terkena Razia Di Langkat STABAT (Waspada): Sejumlah kafe yang diduga menyediakan wanita penghibur dan tempat mangkalnya sejumlah PSK terkena razia yang dilancarkan oleh Tim gabungan Pemkab Langkat, Rabu (19/8) malam. Tim yang terdiri dari sejumlah personil Satuan Polisi Pamong Praja (Satpol PP) dan Kantor Sosial melakukan penyisiran ke sejumlah kafe di sepanjang Jalinsum Kec. Besitang dan Kec. Gebang, yang disinyalir Rabu (19/8) malam. Namun beberapa di antara kafe dan warung remangremang yang selama ini beraktifitas terutama dalam menjual minuman keras dari berbagai merk kelihatan sudah tutup. Diduga datangnya aparat ke lokasi guna melancarkan razia sudah bocor, ucap sumber Waspada. Lokasi penyisiran merupakan wilayah yang selama ini telah beberapa kali menjadi target operasi oleh tim penertiban Pemkab. Langkat. Namun aktifitas haram disinyalir masih berlangsung secara sembunyi. ‘’Walau demikian, perkembangan di lapangan terus dipantau, sesuai dengan instruksi Bupati Langkat,’’ kata Ka. Kantor Sosial H. Taufik, SE. Menurutnya dalam memberantas penyakit masyarakat partisipasi tokoh dan pemuka masyarakat sangat diharapkan. (a01/a02)

57 Anggota Pramuka DS Terima Lencana LUBUK PAKAM ( Waspada): 57 Anggota Pramuka Deliserdang penghargaan lencana Dharma Bakti dan Panca Warsa I, II, III, IV, V, VI dan VII pada peringatan Hari Pramuka ke-48 di Kab. Deliserdang, di lapangan Taman Pramuka Lubuk Pakam, Rabu (19/8). Penghargaan dan lencana disematkan Ka. Kwarcab Gerakan Pramuka Deliserdang H. Azwar S, MSi didampingi Sekretaris Kwarcab Sofian, MPd, Ka. Kesbang Drs. H. Eddy Azwar, Camat Patumbak/Ka. Kwaran H. Faisal Arif Nasution, MSi, Camat Lubuk Pakam Drs. Sariguna Tanjung, MSi dan Camat Deli Tua Drs. Citra Efendy Capah. Ka. Kwarnas Gerakan Pramuka Prof. Dr. H. Azrul Azwar, MPH dalam sambutan tertulis dibacakan Ka. Kwarcab Deliserdang H. Azwar mengatakan, secara bertahap tapi pasti, citra dan kinerja gerakan pramuka makin membaik. Hal ini karena minat kaum muda tampak makin meningkat bersamaan dengan banyaknya berbagai kegiatan yang dilaksanakan. H Asrul Azwar mengajak seluruh anggota dewasa gerakan pramuka lebih merapatkan barisan dan menyatukan gerak langkah guna untuk percepatan kemajuan dan perkembangan gerakan pramuka.(a05)

Resepsi HUT Ke-64 RI Dan Sambut Ramadhan 1430 H Meriah Di Sunggal SUNGGAL (Waspada): Muspika Sunggal, Kabupaten Deliserdang menyelenggarakan malam resepsi peringatan HUT Ke-64 Proklamasi Kemerdekaan RI sekaligus pisah sambut dengan Danramil 01/Sunggal di Lapangan Sei. Semayang serta penyerahan hadiah pemenang pertandingan bola kaki dan menyambut Ramadhan 1430 Hijriah. Demikian Sekretaris II Panitia Pelaksana/Kasi Pemerintahan Kec. Sunggal, Deliserdang, Jahar Rambe kepada Waspada di ruang kerjanya, Rabu (19/8). Acara menurut Jahar berlangsung, Senin (17/8) malam yang dihadiri unsur Muspika Sunggal, para Kades se-Kec. Sunggal, seluruh Kepala Dusun (Kadus), tokoh masyarakat, anggota DPRD Deliserdang Renzo Siregar dan lainnya. Berturut-turut memberikan sambutan, Camat Sunggal HMA Yusuf Siregar, Danramil 01/Sunggal Kapten Inf. Imam Karmani dan Kapolsek Medan Sunggal AKP Faisal Napitupulu. Acara dirangkai dengan pisah-sambut Danramil 01/ Sunggal yang lama Kapten Inf. Novizar dan yang baru Kapten Inf. Imam Karmani. Pada kesempatan itu juga Muspika menyerahkan hadiah kepada pemenang sepak bola menyambut HUT Proklamasi. Juara I Asosiasi Kepala Desa (Asoka) Sunggal, juara II KNPI Sunggal dan juara III Koramil 01/Sunggal. Kepada masingmasing pemenang diberikan uang pembinaan. Jahar juga menambahkan, sebelumnya, Senin (17/8) seusai upacara HUT Proklamasi di Lapangan Sei. Semayang, Sunggal dengan Irup Camat Sunggal HMA Yusuf Siregar yang diikuti pelajar, Pramuka, OKP/KNPI, unsur Muspika dan LVRI Sunggal, diserahkan piagam penghargaan dan bingkisan kepada keluarga Samuri/Linda, warga Desa Medankrio yang menjadi juara terbaik II Pola Hidup Bersih dan Sehat (PHNS) tingkat Provinsi Sumut sekaitan Hari Keluarga Nasional (Harganas) 2009. Penyerahan dilakukan camat atas nama Gubsu. Serangkaian peringatan HUT Proklamasi, tambah Jahar, juga dilaksanakan malam renungan suci dan tabur bunga di makam pejuang Kasimin di Desa Tanjungselamat, dipimpin Kapten Inf. Imam Karmani. (m34)

Beli Rokok Pakai Uang Palsu, Mahasiswa Ditangkap Marinir P. BRANDAN (Waspada): Membeli rokok dengan uang palsu, seorang mahasiswa salah seorang perguruan tinggi swasta di Medan, Rabu (19/8), ditangkap anggota Marinir dan diserahkan ke Mapolsek P. Brandan. Terbongkarnya peredaran uang palsu ini berawal dari kecurigaan pemilik warung di Desa Pasir Putih, Kec. Brandan Barat, setelah menerima pecahan uang Rp20.000 dari salah seorang tersangka, Mahmuddin, 23, mahasiswa semester X, warga Dusun Lorong Melati, Desa Paya Tampak, Kec. Pangkalansusu, ketika hendak membeli rokok. Pemilik kios merasa curiga setelah menerima dan mencermati uang pecahan Rp20.000 dari seorang pemuda yang baru saja membeli sebungkus rokok di warungnya. Merasa tertipu, sang pemilik warung segera menghubungi anaknya yang kebetulan bertugas di Marinir. Menerima laporan ini, anggota TNI-AL segera melacak keberadaan pemuda itu dan berhasil menciduk Mahmuddin di kawasan Simpangsusu. Untuk proses hukum, pelaku diserahkan ke Mapolsek setempat. Hasil pengembangan, polisi membekuk, Yayang Andre Pazaruddin, 23, di kompleks perumahan Pertamina EP Pangkalansusu. Dari kedua tersangka, polisi menyita sejumlah lembaran uang palsu Rp20.000. Selain itu, polisi mengamankan barang bukti satu unit komputer

berikut printer sebagai alat pencetak di rumah kost, Andre di Jalan AR. Hakim, Gang Sehat No.16, Medan. Menurut keterangan, modus pemalsuan yang mereka jalankan dengan cara men-scaner uang pecahan Rp20.000 asli, kemudian diedit melalui komputer. Otak pelaku pemalsuan, katanya, rekan mereka, Sugianto Sirait, 24, juga mahasiswa di perguruan tinggi yang sama warga P.Siantar. Kejahatan ini diakui tersangka mereka jalankan secara bersamasama di rumah kos temannya, Andre, sejak medio April 2009. Pria berpostur tubuh sedang dan berkulit putih itu mengakui, selama menjalankan aksi kejahatan ini, mereka sudah mencetak sedikitnya 200 lembar uang palsu pecahan Rp20.000. Mahsiswa semester akhir yang saat ini sedang menyusun skripsi itu menyatakan, mereka hanya beberapa lembar saja mencetak uang pecahan Rp50.000 dengan alasan uang pecahan dengan nilai sebesar itu sulit dijadikan alat transaksi, sebab masyarakat lebih selektif dan gampang curiga, beda dengan uang pecahan Rp20.000. Kasat Intel Marinir Yonif-8 Tangkahan Lagan, Kapten Mar Najamuddin dikonfirmasi Waspada, Rabu (19/ 8) malam menyatakan, pelaku telah diserahkan kepada polisi. Secara terpisah, Kapolsek P. Brandan, AKP Sofyan Sinaga, tidak berhasil ditemui di kantornya, sementara telefon genggam tidak diangkat saat dihubungi Waspada, Kamis (20/8). (a02)

Tersangka, ART alias Anto,31, warga Jalan Walet/ Diponegoro, Kec. Binjai Timur, Kota Binjai, MII alias Deni,24, warga JalanTanjungsari, Gang Famili Pasar II, Medan, MS alias Ari,28, warga Jalan Tani Asli, Dusun II, Gang Wicaksana Tanjunggusta, Medan Sunggal, Kota Medan dan RI alias Tupong alias Rubuh,28, warga Jalan Pertanian Barat, Kec. Binjai Barat, Kota Binjai. Mereka diduga terlibat perampokan truk colt diesel yang memuat 40 zak pupuk delomit kieserit di Jalinsum Limapuluh -Kisaran, tepatnya di Desa Sei Beluru, Kec. Meranti, Kab. Asahan, beberapa waktu lalu. Dalam beraksi mereka mengguna-

kan senpi dan menahan sopir serta kernetnya. Keduanya kemudian dibuang ke wilayah Pematangsiantar, sementara truk dijual ke Aceh. Sedangkan, penangkapan AS dan MA alias Yoyon warga Jalan Bilal, Kec. Tanjungmorawa, Kab. Deliserdang berawal dari penganiayaan sopir CV Karya Agung Syafaruddin Saragih,37, warga Desa Bahgunung, Kec. Bandar, Kabupaten Simalungun di wilayah Kec. Limapuluh, Kabupaten Batubara, Sabtu (15/8). Saat polisi melakukan penyelidikan, mereka merupakan perampok antar provinsi yang akan mencari korban berikutnya di wilayah hukum Polres Asahan. “ Mereka adalah gerombolan antar provinsi,” ujar Kapolres Asahan AKBP Rudy Sumardiyanto, Kamis (20/8) di Aula Polres Asahan. Menurutnya, ART dkk, banyak melakukan tindakan perampokan dan tidak segan-segan menganiaya korbanya. “Selain di Asahan, mereka melakukan aksinya antara lain di wilayah Kota Binjai dan Kab. Langkat,” ujar Kapolres didampingi Kasat Reskrim

AKP Hendry Yulianto. Sedangkan, AS dkk, setalah diperiksa telah banyak melakukan tindakan kriminal, seperti pencurian satu mobil Kijang Innova di Medan dengan motif sebagai pelanggan rental mobil. Di tengah jalan, tersangka menganiaya sopir mobil dan mengikat tangan serta menutup mata korbannya kemudian dibuang ke Langkat. Mereka juga mencuri sepeda motor Yamaha Soul di wilayah hukum Polres Sergai dan mencuri satu unit dump truk di Aek Nabara, Kab. Labuhanbatu. “Dari penjelasan tersangka, semua barang hasil curian dijual di Aceh,” ujar Kapolres. Kapolres menambahkan, dua gerombolan perampok ini sudah lama menjadi target polisi. “Diharapkan Polres yang lain dan masih menyelidiki kasus dengan tersangka yang sama dapat menghubungi Polres Asahan. Hal itu agar bersama-sama mengungkap gerombolan lainnya,” tambah Kapolres. (csap/a36)

Dugaan Penyelewangan Pembangunan Jembatan

Kejari Jemput Berkas Ke Kantor PU Bina Marga DS LUBUKPAKAM ( Waspada): Kamis, (20/8) sekira pukul 11:30, sejumlah Pegawai Negeri Sipil disontakkan kehadiran sejumlah aparat hukum yang memasuki halaman Kantor PU Bina Marga Deliserdang. Kedatangan aparat dari Kejaksaan Negeri Lubuk Pakam menggeledah kantor PU Bina Marga terkait dugaan penyelewengan dana pembangunan jembatan Paluh Merbau, Desa Tanjung Rejo, Kecamatan Percut Sei Tuan, Deliserdang. “Kita melakukan penjemputan berkas,” ujar seorang petugas Kejaksaan menuju ruang Bidang Peningkatan Jalan dan Jembatan Dinas PU Bina Marga Deliserdang. Sekira 10 berkas terkait pembangunan jembatan Paluh Merbau dibawa ke Kejaksaan Negeri

Lubuk Pakam. Kasi Pidsus Riky Septa Tarigan, SH.MHum mengatakan, pembangunan jembatan Paluh Merbau dibangun sebagai pengganti jembatan yang lama tahun 2007 dengan anggaran Rp739. 450.000. Melalui adendum, anggaran ditambah menjadi Rp1.307.886.000,yang selesai dikerjakan 10 Desember 2007. Di tahun 2008, kegiatan pembangunan jembatan itu terdapat lagi dengan anggaran Rp 1.591.350.000 ditambah lagi melalui suplemen surat perjanjian dengan anggaran Rp 567. 979.000. sehingga total anggaran menjadi Rp2.159.329.000. Adanya dugaan tindak pidana korupsi pada pembangunan jembatan, dengan kerugian negara yang ditimbul-

kan sementara sekira Rp500 Juta. Disebutkan, penjemputan berkas sebagai tindak lanjut ketidakhadiran tanpa alasan 2 pegawai Dinas PU Bina Marga yang dipanggil Kejaksaan Negeri Lubuk Pakam. Kabag Hukum Pemkab Deliserdang, Redwin, SH, yang dihubungi mengatakan, kedatangan petugas kejaksaan ke Dinas PU Bina Marga, untuk meminta berkas terkait pembangunan jembatan Paluh Merbau. Katanya, pembangunan itu sudah memenuhi bestek dan dinilai tidak ada menimbulkan kerugian negara. Hal itu terbukti, pemeriksaan Tim BPK terkait pembangunan itu sudah selesai dan tanpa masalah. (a06)

Tiga Atlet Diperiksa, Terkait Dugaan Korupsi Di KONI BINJAI (Waspada): Tiga atlet Binjai, Kamis (20/8) diperiksa terkait dugaan korupsi di KONI Binjai pada tahun 2007, sebesar Rp 7 miliar. Ketiga atlet masing-masing Sujono dan Wita dari cabang voli dan Andi Lala dari cabang gulat. Sementara tiga orang lagi menyusul akan diperiksa sebagai saksi. Ketiganya diperiksa di ruang unit III, Reskim sejak pukul 10:00 sampai pukul 13:00. Dari hasil pemeriksaan ini, polisi mengetahui 6 atlet masingmasing 4 dari voli dan dua dari gulat tidak pernah menerima honor. Sementara berdasarkan data,

biaya pembinaan/honor ke enam atlet yang dibuat KONI ke Bendahara Pemko Binjai, sebesar Rp40 juta dan honor bervariasi dari Rp 1,2 juta sampai Rp 6 juta per atlet. Para atlit itu diketahui tidak menerima honor saat mengikuti Pra PON ke Jakarta selama 10 hari hanya diberikan uang saku sebanyak Rp 1,3 juta per orang. Sementara honor yang dijanjikan pengurus kepada atlit tidak pernah mereka terima. Dikatakan sumber Waspada, saat ini sudah 20 orang saksi diperiksa. Lebih lanjut dikatakan, polisi telah menandatangani berkas temua kasus dugaan

korupsi di Dispora dan Senin (24/ 8) pihaknya akan melayangkan berkas perkara ke Bareskrim dan pihak BPKP serta KPK dan di BPKP kasus itu akan digelar dan temuan kasus itu sebesar Rp 800 juta. Disebutkan sumber, paling lama bulan 11 tahun ini juga pihak kepolisian sudah menetapkan tersangka. Paling sedikit tersangka dalam kasus itu adalah tiga orang termasuk di dalamnya para pejabat di Binjai. Kapolresta Binjai, AKBP Robets Kennedy melalui Kasat Reskrim AKP HM Taufiq ketika dikonfirmasi membenarkan pemeriksaan para atlit. (a04)

OKP Dan Ormas Se-Sergai Tarik Ulur Penanganan Kasus Buat Pernyataan Jauhi Narkoba Dugaan Korupsi Mulai Terjadi SEI RAMPAH (Waspada): OKP dan Ormas se Kabupaten Serdang Bedagai membuat pernyataan sikap untuk menjauhinarkobadihalamanMapolresSegai di Firdaus, Rabu(19/8). Hadir dalam acara yang digagas PMK Sergai itu,Wabup Sergai H. Soekirman, Kapolres Sergai AKBP Drs. Eri Safari dan jajarannya, Ketua PMK Sumut Rajamin Sirait, SE, Danramil 0204 Sei Rampah Kapten JP. Girsang, OKP, Ormas dan undangan. Ketua PMK Sergai Drs. Indra Syahrin, MSi dalam sambutannya mengatakan, tingkat pengguna narkoba saat ini sudah sangat mengkhawatirkan. Umumnya para remaja yang banyak menyalah gunakannya, khususnya di

Kabupaten Serdang Bedagai. Untukitu,kataIndrayangjugaketua KNPI Sergai, harus dilakukan tindakan atau aksi nyata untuk mencegah kondisi tersebut. “Perlu langkah bersama untuk mencegahnya dan memberantasnya,” katanya Kapolres Sergai AKBP Eri Safari mengatakan, masalah narkoba merupakan masalah nasional. Tidak ada lagi wilayah di republik ini yang steril dari narkoba. “Diharapkan unsur pemuda dapat bekerja sama dengan kepolisian di dalam mencegah peredaran dan penggunaan narkoba dengan berbagai bentuk kegiatan nyata dilapangan,” tandas pamen melati dua itu. (a07)

PP Bukan Organisasi Preman Tapi Ormas TANJUNG MORAWA (Waspada): Ketua MPC Pemuda Pancasila Deliserdang menegaskan, organisasi Pemuda Pancasila (PP) bukan organisasi preman melainkan organisasi kemasyarakatan (ormas). Penegasan itu dicetuskan Dahril Siregar (foto) di sela-sela acara Isra’ Mikraj dan menyambut Bulan Ramadhan 1430 H di DusunVII, Desa Limau Manis, Kec. Tanjungmorawa, Selasa (18/8) malam. Acara yang diprakarsai PAC PP Tanjungmorawa di bawah pimpinan H Syahbuddin juga memberikan tali asih dan bingkisan kepada 150 kaum duafa dan anak yatim. HM Dahril yang akrab disapa

“Mak Utop” menyatakan, kalau dirinya sangat bangga dengan aktivitas yang dilaksanakan PAC PP Tanjungmorawa yang peduli dengan kondisi masyarakat. Inilah membuktikan organisasi PP bukan organisasi preman melainkan organisasi kemasyarakatan. Mak Utop meminta kepada jajaran PP Deliserdang khususnya PAC PP Tanjungmorawa untuk tetap menjaga ketertiban dan keamanan terutama selama Bulan Ramadhan ini. “Jika ada yang anggota PP yang membuat keribuatan pada Bulan Ramadhan ini, dirinya tidak segan-segan mengeluarkannya dari keanggotaan PP,” tegas Mak Utop. Sebelumnya, Ketua PAC PP Tanjungmorawa H Syahbuddin melalui Ketua Panitia Isra’ Mikraj, Edi Narto didampingi Sekretaris Kemas Bachtiar SH, Sulaiman, M Syafii Tanjung menjelaskan acara digelar untuk menunjukkan PP tetap eksis berkarya di tengah-tengah masyarakat. (a05)

STABAT (Waspada): Pengurus LSM kelompok studi dan edukasi masyarakat marginal (K-SEMAR) Sumut, Togar Lubis berpendapat, pada dasarnya setiap manusia di mata hukum sama, tidak ada istilah pilih kasih. Jika Penyidik Kejari Stabat ingin mempertahankan citra gemilangnya memberantas praktek dugaan korupsi di Kab. Langkat, hilangkan diskriminatif dan tegakkan hukum sesuai ketentuan. Hal itu disampaikannya, Kamis (20/8). Berdasarkan keterangan dan penulusuran Waspada, beberapa bulan silam citra Penyidik Kejari Stabat banyak mendapat pujian dan acungan jempol meski tidak secara langsung setelah menahan empat PNS Dinas P Dan P Langkat terduga melakukan tindak pidana korupsi berkisar Rp6,6 miliar. Gebrakan itu disusul penahanan

mantan Kepala SMKN I Stabat terkait dugaan korupsi penyimpangan dana pengadaan perangkat komputer. Kinerja itu menjadikan PNS khususnya aparatur Pemkab Langkat yang ‘nakal’ tidak berani menyimpang dalam tugasnya. Prestasi penyidik tidak berhenti disana, pejabat naungan Depag juga turut diperiksa dugaan penyimpangan bantuan dana pendidikan tahun 2008 senilai Rp3,425 miliar. Seiring dengan itu dinamika pemerintahan di Kab. Langkat semakin galau pengaruh kinerja penyidik di bawah naungan Febrie Adriansyah, SH yang terlihat serius memberantas praktik korupsi. Kemudian prestasi penyidik mulai pudar dan tidak terbuka sejak dugaan kasus penyimpangan dana Bansos senilai Rp30 miliar dan dana stabilitas disidik dua bulan silam hingga kini. Salah satu langkah penyidik mengungkap

aktor kasus itu, 23 Camat di Kab. Langkat turut diperiksa, termasuk staf khusus Gubsu Dhani Setiawan Isma yang sebelumnya menjabat sebagai Camat Stabat. Namun hingga kini hasil pemeriksaan masih misteri. Hasil pemeriksaan mantan Bupati Langkat Yunus Saragih dan Sekda Surya Djahisa dalam dugaan kasus serupa juga mengambang. Penyidik semakin menutupi kasusnya. Dampak upaya menutupi perkembangan kasus yang disidik menjadikan sejumlah wartawan kesulitan meminta informasi kepada penyidik berwenang. Kasi Intel Kejari Gloria Sinuhaji seringkali menolak memberi keterangan dengan berbagai alasan seperti sedang sibuk, rapat dan alasan tugas lainnya. Konfirmasi terakhir Waspada seputar perkembangan kasus korupsi Kamis (20/8) siang juga tidak ditanggapi. (a38)

Lokasi Eks Terminal Dibangun Pasar Tradisional STABAT ( Waspada): Pemkab Langkat berwacana membangun pasar tradisional di lokasi eks Terminal Tanjungberingin Kec. Hinai. Kepala Bappeda Langkat Ansyarullah menjelaskan, pasca tidak terpakainya lokasi itu sejak setahun silam, Pemkab mengkaji potensi lokasi dengan meminta pendapat aparatur instansi lainnya untuk membahas jenis bangunan yang cocok serta menguntungkan masyarakat. ‘’Namun sejauh ini masih dalam pembahasan lebih lanjut. Wacananya akan dibangun pasar tradisional,’’ katanya, Rabu (19/8). Secara terpisah Kadis Perhubungan Langkat Syahmadi juga mem-

benarkan wacana pembangunan pasar mengingat di samping lahan itu terdapat terminal bus aktif antar kabupaten/ kota yang tentunya meramaikan Jalinsum Hinai. ‘’Kita telah beberapa kali membahasnya bersama aparatur Pemkab dan kemungkinan tahun 2010 nanti lahan itu tidak terbengkalai lagi,’’ tuturnya. Kabid Perdagangan Disperindag Langkat, Salman, mengakui wacana itu dan pihaknya akan mengusulkan bantuan dana ke Dirjen Koperasi setelah melalui tahapan pengkajian dan peninjauan lokasi. ‘’Bukan tidak mungkin nantinya mengandalkan dana APBD, tetapi selama ini digunakan untuk merehab sejumlah pasar tradisional yang

butuh perawatan,’’ katanya menjelaskan, Rabu. Usulan bantuan dana ke Dirjen Koperasi yang dimaksud, lanjut Salman, tentu tidak semudah yang diperkirakan. Kemungkinan besar pihak Dirjen akan turun ke lokasi meninjau apakah layak dibangun pasar. Sementara dasar Pemkab Langkat berwacana membangun pasar tradisional di lahan eks terminal, setelah melihat secara tidak langsung keinginan warga Kec. Batangserangan, Padangtualang dan Sawit Seberang yang mendambakan pasar megah tidak kumuh. ‘’Selama ini warga di sana hanya mengandalkan pasarpasar kecil musiman,’’ ujarnya. (a38)

18

Sumatera Utara

Tersangka Pembunuh Tahun 2000 Diringkus

TEBINGTINGGI (Waspada): Langkah, rezeki, pertemuan, dan maut sudah ketentuan yang Maha Kuasa, tak seorangpun mampu menghalanginya. Peristiwa mengejutkan warga terjadi, seorang bayi lahir tanpa lapisan tengkorak (batok) kepala di Lingkungan VI Jalan Danau Ranau, Kel. Lubuk Raya, Kec. Padang Hulu, Tebingtinggi, Kamis (20/8) pagi sekira pukul 08.00. Kondisi bayi laki-laki lahir dengan berat 3 kg. Tubuh dan kedua tangan serta kedua kaki normal, namun kepala di ubun-ubun terlihat menonjol selaput otak bewarna merah tanpa batok kepala yang membungkus. Jiran tetangga yang berkunjung terlihat iba melihat sang bayi di pangkuan sang nenek yang menangis tersedu. Atas saran keluarga, bayi mungil selanjutnya dibawa ke RSU Dr. Kumpulan Pane sekira pukul 13:00 setelah melengkapi surat administrasi

Dua Pelajar SMA Dihajar Massa

Shalat Kunci Meraih Derajat Tinggi TANJUNGBALAI (Waspada): Ketua Majelis Ulama Indonesia Kota Tanjung-balai Abdul Ma’ruf menegaskan, jika ingin meraih derajat tinggi, maka kuncinya adalah shalat. “Bila kita ingin meraih derajat yang tinggi dan tidak dibodohbodohi orang lain, maka kuncinya adalah laksanakan shalat,” tegas Ketua MUI pada peringatan Isra’ Mikraj di Yayasan Madrasah Pendidikan Islam (YMPI) Kota Tanjungbalai di Jalan Besar Teluk Nibung, Kec. Sei Tualang Raso, Rabu (19/8). Ketua MUI kembali menegaskan, kita bakal jauh terhindar dari perbuatan keji dan munkar, apabila senantiasa melaksanakan shalat. “Jadi, dengan memperingati Isra’ Mikraj ini, janganlah pula kita sampai meninggalkan salat,” pesan Abdul Ma’ruf yang juga Ketua YMPI Kota Tanjungbalai. Sementara, Kasek YMPI Zainibah mengingatkan para siswa untuk senantiasa menjalankan puasa selama Ramadhan ini. (a37)

Masjid An Nur Diresmikan AEKKANOPAN (Waspada): Pimpinan PT Pastima Salomo P Hutabarat meresmikan Masjid An Nur sekaligus pemotongan nasi tumpeng di Dusun V, Desa Mekar Marjanji, Kec. Aeksongsongan, Asahan, Rabu (19/8). SalomopadakesempatanitumenyampaikandibangunnyaMasjid An Nur agar warga Dusun V, Desa Mekar Marjanji dapat beribadah dengan tenang dan nyaman tanpa terkena banjir lagi sebab masjid yang selama ini digunakan warga sering terkena banjir, akibatnya masyarakat yang sedang beribadah sering terganggu. Setelah berdirinya Masjid An Nur dia berharap kepada masyarakat agar semakin rajin menjalankan ibadah, terlebih sekarang sudah mau memasuki Bulan Ramadhan. Dia juga berpesan kepada warga DusunV Desa Mekar Marjanji dapat menjaga dan merawat masjid ini dengan baik. Hadir dalam acara itu Kapolsek Bandar Pulo AKP Aris Fianto, Danrami Bandar Pulo, Sekcam, serta tokoh masyarakat. (csi)

PKS L. Batu Gelar Pawai RANTAUPRAPAT (Waspada): Menyambut Bulan Ramadhan 1430 Hijriah, kader dan simpatisan Partai Keadilan Sejahtera (PKS) Kab. Labuhanbatu menggelar pawai keliling Kota Rantauprapat, belum lama ini. Ketua DPD PKS Labuhanbatu H Marasakati Harahap, Lc, dalam sambutannyamenyampaikan,kedatanganBulanRamadhanharuslah disambutdengangembira.“Kitaingintularkankegembiraanmenyambut Bulan Ramadhan kepada warga L. Batu. Sudah saatnya keistimewaan Ramadhan dioptimalkan. Jangan disia-siakan,” ujar Marasakti. Pawai sambut Ramadhan ini dimulai dari Masjid Ar Ridho Ujung Bandar, dilanjutkan dengan pawai kelilling Kota Rantauprapat disertai dengan menyebarkan brosur dan jadwal Imsakiyah Ramadhan dan berakhir shalat Ashar berjamaah di Masjid Agung Rantauprapat. Untuk memeriahkan pawai itu, DPD PKS L. Batu menggunakan odong-odong (angkutan kuntuk seputaran Kota Rantauprapat), beca bermotor dan sepeda motor.Warga Kota Rantauprapat cukup antusias menyaksikan pawai tersebut. (a27)

Memaknai Tiga Cobaan Dari Allah SWT RANTAUPRAPAT (Waspada): Dalam kehidupan manusia ada 3 macam cobaan dari Allah SWT tetapi karena tidak menjadi perhatian membuat manusia tidak mengetahui rahasia tersebut. Sebenarnya banyak rahasia alam yang tidak diketahui dan diperhatikan oleh kita. Karena tidak kita perhatikan membuat diri kita gelisah jauh dari ketenangan atau lupa diri. Hal itu dikatakan Al Ustadz KH Ridwan Hamid, dai dari Medan ketika menyampaikan tausiah dalam acara peringatan Isra’ Mikraj Nabi Muhammad SAW sekaligus takbir akbar menyambut bulan suciRamadhanyangdilaksanakanIkatanPersaudaraanHajiIndonesia (IPHI) Kabupaten Labuhanbatu yang berlangsung di Masjid Al Ikhlas Ujung Bandar Rantauprapat, sepekan lalu. Ustadz Ridwan dalam ceramahnya bersama 250 orang tamu forum majelis taklim dari Medan dan Muspida L.Batu, menyatakan, banyak pembelajaran yang ia sampaikan, terutama bagaimana hubunganmanusiadenganTuhannyadanbagaimanapulahubungan sesama manusia. Sampai kepada 3 cobaan dari Allah SWT, baik dalam bentuk cobaan nikmat dan musibah. Acara dimulai pembacaan Al Quran oleh H.Tukino, S.Sos qari L.Batu serta hiburan disumbangkan ipqoh L.Batu yang dipimpin Drs.H.Abd.Hamid Jahid. Dalam kesempatan tersebut pimpinan rombongan forum majelis taklim dari medan menyerahkan sebuah kursi roda kepada warga IPHI L.Batu yang diterima Sekretaris HM. Sofyan, MA (c07)

Waspada/Sapriadi

GANJA: Kapolsek Labuhanruku AKP Mijer menunjukkan ganja seberat 10,5 kg dan 4 tersangka tersangka. Rencananya barang haram itu akan dipasarkan di wilayah Kec. Tanjungtiram dan sekitarnya. Foto diekam, Kamis (20/8).

Lagi, Seorang Pengedar Dan Tiga Pelanggan Ganja Diciduk LABUHANRUKU (Waspada) : Seorang pengedar dan tiga pelanggan ganja diciduk Polsek Labuhanruku Asahan dengan barang bukti 1,05 kg daun ganja siap pakai, Rabu (19/8). Tersangka, RD,43, warga Desa Bogak, Kec. Tanjungtiram Kab. Batubara yang diamankan petugas karena telah terbukti telah mengedarkan daun ganja seberat 1 kg yang disimpan di lemari pakaian anak tersangka, sedangkan NZ,21, warga Jalan Nelayan, Kec Tanjung Tiram, dan kedua rekannya YD,24, dan IS, 24, warga Jalan Hesa Air Genting, Simpang Kawat, Kab. Asahan ditahan karena telah

menyimpan ganja sebarat 0,5 gram yang diselipkannya pinggang atas perut dan direncanakan akan mengonsumsi barang haram itu. “ Tidak ada kerjaan lagi, jadi terpaksa saya melakukan bisnis ini,” ujar RD kepada Waspada, Kamis (20/8). Menurutnya, ganja 1 kg bila diamplop dengan paket Rp 5.000 dapat dibuat kurang lebih 300 amplop. “ Saya beli barang tersebut seberat 1 kg dari seseorang, dengan harga Rp 1.500.000, dan bila saya jual kembali dengan bentuk paket, Rp 5.000 maka akan mendapat keuntungan sebanyak Rp 500.000 per kilonya” ujar tersangka. YD dan IS mengakui barang haram hanya untuk dikonsumsi sendiri, sehingga dia meminta bantuan NZ untuk mendapatkan barang haram tersebut se-

banyak 0,5 gram dengan harga Rp 50.000. “ Tapi saya dan IS tertangkap petugas di Simpang Empat, saat akan pulang kerumah,” ujar YD. Kapolres Asahan AKBP Rudy Sumardiyanto melalui Kapolsek Labuhanruku AKP Mijer menjelaskan, penangkapan ini adalah kerja sama dengan masyarakat dengan memberi informasi,sehingga tersangka dapat ditangkap di waktu dan tempat yang berbeda. “ Antara RD dengan NZ dkk tidak ada hubungan dalam transaksi barang haram itu, tetapi ada beberapa orang yang ada dibelakang mereka, oleh sebab itu kami masih melakukan pengembangan kasus untuk mengungkap bandarnya,” ujar Mijer didampingi Kasat Narkoba AKP Napsanto. (csap)

Siswa SMP Hanyut Di Sungai Gambus LIMAPULUH (Waspada): Siswa kelas III salah satu SMP swasta di Batubara hayut di Sungai Gambus setelah jatuh dari atas tembok yang ambruk, Kamis (20/8) sekira pukul 15:30. Korban Yanti, 14, putri seorang penderes warga Dusun V, Desa Simpang Gambus, Kec. Limapuluh. Selanjutnya upaya pencarian masih dilakukan oleh masyarakat setempat. Menurut keterangan Waspada himpun menyebutkan, sebelumnya korban sedang duduk di atas tembok yang ambruk di sisi sungai Gambus. Setahu bagaimana korban jatuh secara tiba-tiba dan seketika itu hayut

terbawa arus sungai yang deras. Masyarakat sekitar mengetahui korban jatuh ke dalam sungai berupaya untuk membantu dengan menyisir sungai namun sampai berita ini dikirimkan korban belum berhasil ditemukan. Lamban Sementara Ketua dan Sekretaris Gagak Kabupaten Batubara, Jasmi Assayuti, SHI dan Ramadhan Zuhri, SH mempertanyakan kinerja instansi terkait dalam menangani masalah. Termasuk membenahi benteng atau tembok Sungai Gambus sehingga terjadinya

korban jiwa yang jatuh dari bangunan tembok yang ambruk. Peran DPRD lanjut mereka terkesan lamban dalam menyelesaikan berbagai persoalan/ masalah di Batubara baik temuan proyek bermasalah tahun 2008 dan penyimpangan penggunaan APBD 2009 sampai kepada bendungan/benteng di Simpang Gambus membuat sebagian petani resah tidak bisa bercocok tanam. Maraknya penambang pasir di Kec. Medang Deras, Sei Suka dan Air Putih yang terkesan tidak terpantau meskipun berdampak terhadap lingkungan hidup.(a11)

Wanita Penggelap Dana Perusahaan Ditangkap TEBINGTINGGI (Waspada): Seorang wanita diduga sindikat penipu ditangkap Polres Tebingtinggi atas dugaan penggelapan dana milik CV Harum Sakti Motor, perusahaan penjualan sepeda motor. Kini tersangka Lita, 22, warga Tebingtinggi menjalani persidangan di Pengadilan Negeri (PN) Tebingtinggi, Kamis (20/ 8). Namun sidang pertama kasus gagal dilaksanakan, karena kuasa hukum terdakwa tidak hadir. Kasus ini akan disidangkan kembali Senin (24/8). Hakim Ketua Abdul Hutapea, SH.MH bersama hakim anggota Anita Silitonga, SH.MH dan Cipto HP Nababan, SH.MH memutuskan sidang ditunda Senin. Dikatakan jika hari Senin kuasa hukum terdakwa tidak juga hadir, maka sidang tetap dilaksanakan tanpa kuasa hukum. Sementara saksi pelapor, Kepala Operasioanal dan Ad-

ministrasi Rosmadadi didampingi Direktur CV Harum Sakti Motor, Riki Ridwan dan Administrasi Perbengkelan Delila mengatakan, kasus dugaan penggelapan Rp160 juta milik perusahaan diketahui Agustus 2008, saat dilakukan audit keuangan. Dalam audit itu ditemukan kejanggalan pengeluaran bon biaya reperasi sepedamotor. Atas kecurigaan itu, perusahaan menelusuri pengeluaran anggaran empat bulan ke belakang. Saat itulah ditemukan bon fiktif sebanyak 442 lembar senilai sekira Rp160 juta yang tidak bisa dipertanggungjawabkan. Sedangkan Delila mengatakan, pernah disuruh terdakwa Lita merubah dua lembar kuitansi. Juga pernah di SMS terdakwa yang isinya “rubah aja kwitansi jangan beritahu kepada siapapun, nanti kuitansi asli saya yang pegang.” Kini ponsel itu disita PolresTebingtinggi sebagai

barang bukti. Direktur, Riki Ridwan mengatakan, terdakwa Lita, bekerja di perusahaan itu sejak 2004, masih memegang kas kecil. Kemudian 2006 hingga 2008 dia memegang kas besar. Riki mengatakan, sebelum melaporkan kasus itu ke polisi, pihaknya telah melakukan beberapakali pertemuan dengan terdakwa dan sejumlah staf. Tetapi kata dia, tidak ditemukan jalan keluar. Akhirnya kasus ini dilaporkan ke Polsek Batang Hulu Tebingtinggi, namun karena tidak ada perkembangan akhirnya diambilalih Polres Tebingtinggi pada Mei 2009. Tersangka kini ditahan di Kejari Tebingtinggi. Ada dugaan terdakwa mempunyai sindikat, karena sebelumnya dia melakukan hal sama di tempat lain, namun tidak terbukti sehingga lolos dari hukum. (m11)

Proyek Di Batubara, Yang Kocikpun Tunggu Diarahkan “MUNGKINKAH yang sekecil apapun namanya proyek masih diarahkan.” Itulah yang menjadi tanda tanya di kalangan kontraktor di Kabupaten Batubara. Pasalnya, untuk mendapatkan pekerjaan proyek fisik maupun non fisik bersumber APBD 2009 di lingkungan Pemkab Batubara sekecil apapun namanya paket proyek baik bentuk Penunjukan Langsung (PL) maupun SPK mulai dari nilai pagu Rp 90 juta Rp 50 juta hingga nilai ke bawah sudah ditentukan

dan tidak satupun Kepala/Pimpinan SKPD yang berani mengambil kebijakan. Apalagi namanya menjalankan kebijakan untuk mendahulukan suatu pekerjaan mereka mengaku tidak mempunyai wewenang atau dalam arti kata lain tidak berani melakukan tanpa ada arahan karena khawatir akan resiko. “Jika benar yang kocikpun (kecil) disontap (sentap) juga apo lagi untuk bawahan.Kita khawatir ini sengaja diembuskan demi kepentingan tertentu sehingga melempar bola ke atas.Apa mungkin itu semua,” ujarnya, Senin (17/8). Salah seorang pejabat Pemkab Batubara yang tidak perlu

Jumat 21 Agustus 2009

Bayi Tanpa Batok Kepala Lahir Di T. Tinggi

BINJAI (Waspada): Sat Reskrim Polresta Binjai, Rabu (19/ 8) sekira pukul 16:00 meringkus SB, 28, warga Dusun IV, Desa Durin Lingga, Kecamatan Sei Bingai dari rumahnya, terkait kasus pembunuhan pada tahun 2000 lalu. Tersangka ketika ditangkap mengakui perbuatannya. Dia mengaku hanya sebagai sopir mobil ketika bersama 8 orang temannya melakukan pembunuhan, di antaranya sudah ada yang bebas dari Lembaga Permasyarakatan Binjai, terhadap Sahrudin alias Deni Lubis, Selasa 28 Maret 2000 lalu sekira pukul 01:00 di Jalan Sei Bohorok, Kelurahan Pujidadi, Kecamatan Binjai Selatan. Mayat korban ditemukan warga beberapa hari setelah kejadian di Sungai Bingai tersangkut kayu di kawasan Perumahan Berngam, Kecamatan Binjai Kota. Pembunuhan itu diduga akibat “cinta segi tiga “ antara korban dengan BS yang sudah diringkus polisi 3 minggu lalu di kawasan Salapian, Langkat Kapolresta Binjai AKBP Robets Kennedy melalui Kasat Reskrim AKP Muhamad Taufiq ketika dikonfirmasi membenarkan. (a04)

KISARAN (Waspada): Dua pelajar SMA babak belur dihajar massa menjambret tas milik Linda Sihombing, 24, warga Jalan FL. Tobing, Kota Kisaran saat akan berangkat mengajar di SMP Negeri 4 Kec. Air Joman, Kab. Asahan, Rabu (19/8). Tersangka, DS, 15, dan AU, 15, warga Jalan Sentang, Kota Kisaran menggunakan sepeda motor BK 6831 CK dengan kecepatan tinggi mendekati korban dari belakang yang sedang berkendaraan sepeda motor. Tiba-tiba salah satu tersangka merampas tas milik korban, akibatnyakorbanterkejutdannyaristerjatuh,sehinggasecarasepontan dia menjerit. Berkat bantuan warga, kedua pelajar dapat dihentikan dan langsung dihajar massa kemudian diserahkan ke pihak yang berwajib. Kapolsek Airjoman AKP Abdul Rahman melalui Kanit Reskrim Aiptu ST Hutagalung dikonfirmasi Waspada membenarkan. (csap)

WASPADA

disebutkan jatidirinya kepada Waspada secara gamblang mengaku tidak berani membuat kebijakan atau memutuskan sendiri tanpa ada arahan dalam memberikan pekerjaan paket proyek. “Ini pernah saya lakukan, data yang diajukan dicoret dan diganti kepada lain,” ujarnya. Pasca pengumuman tender proyek APBD di lingkungan Pemkab Batubara kalangan kontraktor lokal khususnya anak daerah gigit jari karena dipradiksi hampir 80 persen tender dimenangkan kontraktor luar daerah baik di lingkungan Dinas PUmaupunKesehatanBatubara. Anehnya di antara paket proyek yang dimenangkan nilai penawaran tertinggi meskipun

nilai terendah yang responsif karena menguntungkan negara maupun masyarakat sebab sisa dari besar pagu yang dianggarkan dapat dimanfaatkan untuk pembangunan lain. “Itu makanya nilai terendah merupakan nilai yang responsif karena menguntungkan bagi daerah dan masyarakat sebagaimana diatur dalam lembaran Keppres No 80 Tahun 2003 dan sebagai pedoman panitia tender maupun PPK bekerja,” ujarnya. Kesal Dia tidak menyangkal maraknya sanggahan yang diajukan pihak rekanan karena menilai hasil pengumuman tender bernuansa KKN dan melanggar Keppres.Kemudian kurangnya

perhatian secara moral pembelaan terhadap kontraktor anak daerah baik dalam meluruskan dokumen administrasi maupun teknik salah satu alasan panitia maupun PPK mengalahkan. “Padahal anak daerah juga terlibat sebagai panitia tender maupun PPK, masak membantu saja tidak bisa. Padahal kita siap memenuhi seluruh kewajiban,” kata anak daerah dengan nada kesal yang banyak mengeluarkan uang dalam pengurusan semasa tender. Selain itu kontraktor daerah yang kalah tender dijanjikan akan mendapatkan paket pekerjaan PL atau SPK, namun ketika ditagih panitia menolak memberikan paket dijanjikan. (a11)

dari kelurahan setempat. Petugas medis yang berada di unit gawat darurat sempat kaget menerima bayi tanpa batok kepala ini karena terlahir abnormal. Selanjutnya memindahkan bayi ini ke ruang bersalin rumah sakit untuk mendapatan perawatan khusus. Menurut Sri Meliani,20, orang tua bayi, tidak menyangka kejadian tersebut menimpa anak pertamanya ini, karena selama sembilan bulan dalam kandungan dalam keadaan normal, namun beberapa waktu yang lalu saat ia mengaku pernah menonton TV dan membaca koran berita bayi cacat kembar siam bahkan koran yang dibaca sempat terlempar karena terdetak. “Tidak ada kelainan sebelumnya,” ucap Meliana saat terbaring di dalam kamar rumahnya. Sementara itu Gong Matua Pohan,23, suami Meliana mengharapkan anaknya ini dapat kembali normal. (a09)

Harga Bahan Pokok Di Pasar Di Stabat Stabil STABAT (Waspada): Jelang Ramadhan sejumlah bahan pokok relatif stabil, namun H-2 hingga H+1 Ramadhan biasanya ada sedikit kenaikan dan hal ini dinilai masih wajar. Namun demikian diharapkan para pedagang tidak mengambil kesempatan di saat permintaan barang meningkat seperti mengabaikan kualitas mutu barang, mengurangi timbangan atau menjual barang yang sudah kadaluarsa. Wakil Bupati Langkat Budiono didampingi Kabag Perekonomian Basrah P dan Kadis Perdagangan Diana Sari, Kadis Pertanian Basrah Daulay, Kadis Peternakan Ir.M. Tambeng dan Kadis Perikanan H. Nazaruddin, mengemukakan hal itu seusai meninjau ke beberapa pasar di Langkat, Rabu (19/8). Kabag Perekonomian Drs. Basrah Pardo-

muan menjelaskan, pihaknya hanya meninjau ketersediaan bahan pokok maupun harga menjelang Ramadhan di beberapa pasar besar di antaranya Stabat, Tanjungpura, Pangkalanbrandan, Pangkalansusu dan Kuala. Hasil pantauan harga di Pusat Pasar Baru Stabat antara lain beras ramos 15 kg Rp96.000, IR 30 kg Rp164.000, gula pasir 1 kg Rp. 9.000, terigu cap segitiga 1 kg Rp7.500, minyak goreng curah 1 kg Rp. 8.000, bawang merah 1 kg Rp10.000, bawang putih 1 kg Rp. 15.000, cabai merah besar 1 kg Rp20.000, cabai rawit 1 kg Rp. 11.000. Sedangkan harga telur ayam Rp850 per butir, daging sapi Rp60.000 per kg, daging ayam ras bersih Rp25.000 per kg, ayam kampung Rp50.000 per kg. Basrah mengungkapkan, trend kenaikan terjadi pada bawang putih dan daging sapi. (a01)

Bupati Langkat Imbau Masyarakat Tingkatkan Ibadah Ramadhan STABAT (Waspada): Seluruh masyarakat khususnya kaum muslimin diimbau untuk meningkatkan pengamalan ajaran agama dengan menghidupkan suasana Ramadhan guna terwujudnya suasana lingkungan yang harmonis . ‘’Mari bersama kita pelihara semangat saling menghormati suasana Ramadhan dan tingkatkan ibadah bagi umat muslim dengan memakmurkan masjidmasjid,’’ kata Kabag Humas Pemkab Langkat H. Syahrizal mengutip pernyataan Bupati Langkat Ngogesa Sitepu (foto), Kamis (20/8). Bupati juga menyampaikan beberapa imbauan di antaranya meminta agar pemilik restoran, rumah makan/ warung-warung agar tidak menjajakan makanan/minuman secara terbuka.Terhadap kaum muslim agar meningkatkan kegiatan keagamaan baik di rumah, masjid maupun mushala dengan shalat fardhu, tarawih

maupun tadarus Al Quran serta meningkatkankepedulian terhadap fakir miskin, dhuafa dengan mengeluarkaninfaqsadaqahdan zakat fitrah sesuai ketentuan agama. Kepada jajaran Muspika se Kabupaten Langkat, Bupati juga mengimbau agar agar dapat memeliharasuasanakekhusukan beribadah dengan memantau penggunaan mercon/petasan dan hal-hal lain yang dapat menimbulkan ketidaknyamanan beribadah maupun mengundang terjadinya bahaya. Peranaktifitu,menurutBupatidapatdilakukan bila peran serta tokoh agama tokoh masyarakat serta aparat di lapangan saling mendukung terpeliharanya suasana Ramadhan yang lebih baik. Oleh karenanya seluruh lembaga keagamaan diharapkan lebih berperan di masing-masing umatnya agar menjaga suasana saling menghormati dan menghargai. (a01)

PLN Rantauprapat Terancam Digugat RANTAUPRAPAT (Waspada): Jika listrik sering padam dan merusakan alat elektronik serta mengganggu kekhusukan beribadah pada Bulan Ramadhan, warga merencanakan akan menggugat PT PLN (Persero) Cabang Rantauprapat. “Kita sudah persiapkan bukti-bukti, antaranya barang elektronik yang rusak akibat pemadaman yang tidak beraturan,” tegas seorang warga, Muksin didampingi Ketua Lembaga Perlidungan Konsumen Labuhanbatu (LPKL) Drs Zulham Abdul Fattah dan Ketua DPC Pembina Iman Tauhid Islam (PITI) H Surya Darma. Menurut mereka, selama ini keresahan telah

dialami warga Kota Rantauprapat disebabkan pemadaman yang tidak beraturan dan di luar kewajaran. Sementara pemadaman tidak mengurangi tagihan rekening, melainkan melonjak naik. Sebab saat listrik kembali hidup, tarikan arus semakin memuncak tinggi. “Kalau tagihan berkurang masih wajar, ini semakin besar saja. Karena disitulah kesempatan untuk menutupi kerugian pihak PLN, saat lampu hidup, tarikan dayanya pasti kuat. Kami sudah mengumpulkan puluhan barang yang rusak dan rekening pembayaran untuk bukti,” ungkap Muksin. (a27)

Ratusan Warga Desa Sei Kasih Berburu Tikus Di Sawah LABUHANBATU (Waspada) : Ratusan warga Desa Sei Kasih melakukan perburuan tikus (gropoyokan) di areal persawahan seluas 650 hektare (ha) sebelum penanaman padi yang akan dilakukan secara serentak di akhir Agustsus 2009 ini, Minggu (16/8). Gropoyokan itu dilakukan mengantisipasi meluasnya persebaran hewan pengerat yang selalu meresahkan petani. Kepala Desa Sei Kasih H. Sugimanto yang turut turun ke sawah bersama-sama warga melakukan gropoyokan kepada Waspada menjelaskan, serangan hama tikus di desa memang belum ‘siaga satu’ namun wajib kita melakukan antisiapasi agar tidak gagal panen. Meski tantangan saat ini bagi petani masih tergolong ringan, namun mengingat perkembangbiakan tikus yang sangat cepat, maka sekitar 100 orang terdiri dari petani dan anak-anak muda melakukan aksi gropyokan di sawah Desa Sei Kasih. “Serangan hama tikus sudah menjadi rutinitas tiap musim tanam. Untuk kali ini kita lakukan sebelum tanam agar perkembangan tikus bisa diperkecil.Warga kami minta langsung

melakukan aksi pencegahan sebelum meluas ke wilayah sekitarnya,” kata Sugimanto. Sementara itu, Makmur Sentosa yang langsung memimpin masyarakat bersama kepala desa melakukan gropoyokan mengatakan pelaksanaan gropoyokan bertujuan untuk memutus siklus hama tikus yang dikhawatirkan bila tidak dicegah dini bisa merusak tanaman padi dan berakibat buruk untuk meningkatkan produksi padi tahun ini, paparnya. “ Pemutusan siklus hama tikus dengan upaya manual tersebut cukup efektif, “ papar Makmur sembari menambahkan petani satu hari sebelumnya telah menaruh racun tikus merek Kleret RM yang ditempatkan di jalur tikus dan lubanglubang tikus di areal pematang sawah. Sementara Kadis Pertanian Liyas Ritonga berharap warga Desa Sei Kasih tidak bosan untuk melakukan gropoyokan agar produksi padi tahun ini bisa meningkat. ‘’Kerjasama petani dengan pemerintah khususnya Dinas Pertanian sangat diharapkan agar geliat perekonomian dari sektor pertanian bisa terdongkrak, ‘’paparnya. (a26)

Sosialisasi Binmahum Di Sekolah TANJUNGBALAI ( Waspada) : Bagian Hukum Setdakot Tanjungbalai, mensosialisasikan pembinaan masyarakat taat hukum di SMA Negeri 1, 2, 6 dan sekolah swasta Sisingamangaraja, Rabu (19/8). Sosialisasi kesehatan, khususnya yang menyangkut masalah penyalahgunaan narkoba itu, menghadirkan narasumber dari Kejari Tanjungbalai Kadlan Sinaga dan Rudy Parhusip, Komisi Penanggulangan AIDS Tanjungbalai Rinto Prabowo, dan Polresta Tanjungbalai Bripka Zainuddin S serta Aipda P Sihombing. Pada paparannya, KPA Tanjungbalai lebih mengarah kepada informasi seputar Infeksi Menular Seksual. Menurutnya, penyebab IMS adalah bakteri, virus, jamur atau parasit. “ Secara umum bibit penyakit itu ditemukan di cairan mani, vagina dan darah. Penularannya sebagian besar membutuhkan cara, yakni bibit penyakit masuk ke aliran darah,” kata Rinto Prabowo. Lebih lanjut dijelaskan Rinto, IMS dapat

mengakibatkan kemandulan, keguguran, kanker rahim, kerusakan penglihatan, otak dan hati serta berujung kepada kematian. Sementara, dari Kejari Tanjungbalai dan Polresta, lebih mengarah kepada imbauan untuk melindungi keluarga dan masyarakat dari bahaya penyalahgunaan narkoba. Dijelaskannya, selain meracuni sistem saraf pusat dan otak, narkoba juga menyebabkan penurunan kualitas berfikir dan daya ingat otak, merusak berbagai organ vital serta menimbulkan ketergantungan. Dan, kata narasumber, masyarakat yang tidak melapor tentang adanya penyalahgunaan psikotropika, akan diancam hukuman 1 tahun ditambah denda maksimal Rp 20.000 sesuai pasal 65 UU No 5 Tahun 1997. Bagi yang tanpa hak menaman atau memelihara tanaman penghasil narkotika, maka sesuai pasal 78 ayat 1 A UU No 22 Tahun 1997 diancam hukuman 10 tahun dan denda maksimal Rp 500 juta. (a37)

WASPADA Jumat 21 Agustus 2009

Sumatera Utara

Guru MDA Minta Zulkarnain Damanik Bersedia Dicalonkan Lagi

Serobot Tanah Diadukan P. SIANTAR (Waspada): Diduga menyerobot tanah orang lain, LS, 72, warga Pardamaran, Dusun III, Nagori Siatasan, Kec. Dolok Panribuan, Kab. Simalungun dan JS, 60, warga sama dengan LS, diadukan ke Polres Simalungun. Korban Henri Ambarita, 33, warga Jalan Makmur, Kel. Asuhan, Kec. Siantar Timur, Kota Pematangsiantar dalam pengaduannya di Polres Simalungun, Rabu (19/8) menyebutkan LS dan JS diduga menyerobot tanahnya di Kampung Saitnihuta, Nagori Bandar Dolok, Kec. Dolok Panribuan pada tanggal tidak diingat lagi bulan Juli 2009 pukul 13:00. LS dan JS diduga menyerobot tanah korban dengan menjual tanah milik korban itu kepada orang lain tanpa sepengetahuan korban. Korban baru mengetahui kejadian itu sesudah ada yang melaporkannya kepadanya dan mencek kebenaran laporan itu dengan mendatangi lokasi tanahnya dan ternyata benar hingga korban mengadukan LS dan JS ke pihak Polres. Kapolres Simalungun AKBP Rudi Hartono saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Travolta di Mapolres, Kamis (20/8) membenarkan.(a14)

Saling Mengadukan Penganiayaan P. SIANTAR (Waspada): Merasa sama-sama dianiaya, Chandra Gunawan, 30, warga Jalan Tongkol, Kel. Pardomuan, Kec. Siantar Timur, Kota Pematangsiantar dan Andi Syahputra Damanik, 27, pegawai honor, warga Jalan Sawo II, Perumnas Batu Enam, Kec. Siantar, Kab. Simalungun saling mengadukan ke pihak Polres kasus dugaan penganiayaan. Bedanya, Chandra Gunawan mengadukan Andi Syahputra Damanik ke pihak Polres bersama dua temannya, Dedi Setiawan, 19 dan Mandawani, 25, keduanya warga sama dengan Chandra Gunawan. Sedang Andi Syahputra Damanik hanya sendiri mengadu dan hanya Chandra Gunawan yang diadukan ke Polres. Dalam pengaduan masing-masing disebutkan kasus dugaan penganiayaan itu terjadi di Jalan Asahan di depan Kantor Bulog, Nagori Rambung Merah, Kec. Siantar, Simalungun, Rabu (19/ 8) pukul 22:00. Kapolres Simalungun AKBP Rudi Hartono saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Travolta di Mapolres, Kamis (20/8) membenarkan.(a14)

Serahterima Jabatan Kasat Reskrim Dan Kasat Samapta PANYABUNGAN ( Waspada ) : Jabatan Kasat Reserse Kriminal ( Reskrim) dan Samapta Polres Mandailing Natal diserahterimakan di aula Polres, baru-baru ini. Sertijab disaksikan Kabid Binkum Poldasu Kombes Pol. Jhon Henri,Wakapolres Madina Kompol Edy Mashuri Nasution, perwakilan kehakiman/pengadilan, kejaksaan, koramil serta para tokoh agama dan masyarakat. Kasat Reskrim AKP Waiman pindah tugas ke Polres Tapanuli Selatan (Tapsel), sedangkan penggantinya AKP Sarluman Siregar sebelumnya Kasat Reskrim Polres Tapsel. Sementara, Kasat Samapta Polres Madina juga diserah terimakan dari AKP Sahril Madjid AKP Zulkarnain S. Menurut Kapolres Engkos Kosasih mengingatkan kepada pejabat lama meskipun tidak bertugas lagi di Polres Madina agar tetap menjaga silaturahmi dan harus menyikapi mutasi ini dengan positive thinking. Kepada pejabat baru, Kapolres berpesan, jabatan adalah amanah yang diemban dan dipertanggungjawabkan kepada pimpinan dan kepada Tuhan Yang Maha Esa. (a24)

Wakajagung RI : Saya Sering Diberi Telur Ayam PANYABUNGAN ( Waspada ) : Wakil Jaksa Agung RI H.Abdul Hakim Ritonga,SH,MH sebagai putra Kabupaten Mandailing Natal yang lahir di Desa Banua Simanosor, Kec. Naga Juang mengakui, saat kecil dia beri telur sebagai motivasi untuk meraih prestasi yang lebih baik. “ Orang tua saya punya kebiasaan, apabila saya naik kelas dan mendapat ranking baik, selalu diberi ayam dan sebutir telur sebagai rasa syukur atas prestasi yang dicapai sekaligus sebagai motivasi agar lebih meningkatkan prestasi lagi,” ujar Abdul Hakim di Panyabungan, baru-baru ini. Hal itu dikemukakan Abdul Hakim saat diupa-upa oleh tokohtokoh adat Madina di pendopo rumah dinas bupati di Aek Godang Panyabungan. Acara tersebut sebagai ungkapan rasa syukur masyarakat atas dilantiknya Abdul Hakim sebagai pejabat tinggi bidang hukum (Wakajagung RI). Selain dihadiri raja-raja adat Madina, kegiatan upa-upa juga disaksikan raja-raja adat dari daerah Tapsel, Padanglawas, Padanglawas Utara serta elemen masyarakat, sehingga kegiatan adat berjalan meriah. Sebelumnya, dia beserta keluarga besar melakukan tatap muka sekaligus dialog dengan masyarakat serta pelajar. Pertemuan juga ditandai peresmian SMA Negeri 1 Naga Juang dan Madrasah Al-Makun. (a24)

Deliserdang Harus Jadi Kabupaten Pendidikan TEMBUNG (Waspada) : Pemkab Deliserdang memberi penghargaan yang tinggi kepada Badan Koordinasi Pemuda dan Remaja Masjid Indonesia (BKPRMI) Deliserdang dan Forum Komunikasi Pusat Kegiatan Belajar Masyarakat (FK-PKBM) Sumut bersama OKP lainnya,yang peduli dengan kondisi perekonomian dan pendidikan masyarakat Deli Serdang, yang dituangkan dalam kerja nyata melalui pasar murah dan pembentukan kelompok belajar masyarakat. Ungkapan penghargaan itu disampaikan Wabup Deliserdang H. Zainuddin Mars di hadapan ratusan warga Percut Sei Tuan, pada pembukaan pasar murah Syariah dan Ramadhan Fair l430 serta pelaksanaan kegiatan belajar masyarakat di Pasar Syariah Al Lutfi yang dibangun Ketua BKPRMI Deliserdang Lutfi Solihin Sirait di Jalan Pendidikan Dusun I, Desa Bandar Setia, Kec.Percut Sei Tuan, Minggu (16/8). Pemkab Deliserdang, tegas Wabup, tidak ingin melihat masih ada anak-anak di Deliserdang yang tidak mengecap pendidikan. Bahkan, Wabup berobsesi menjadikan Deliserdang menjadi Kabupaten Pendidikan mencetak siswa-siswi berprestasi dan mampu bersaing di Perguruan Tinggi bergengsi di seluruh Indonesia. Sebelumnya Gubsu diwakili Kadis Pendidikan Sumut H. Bahrumsyah dalam sambutan menyambut baik kedua program yang digagas para pemuda khususnya kegiatan kelompok belajar masyarakat yang kini banyak tersebar di Deliserdang dan akan terus didukung dengan segenap potensi yang ada di Sumut. Ketua BKPRMI Deliserdang Lutfi Solihin Sirait yang membangun dan menggagas Pasar Syariah dan Ramadhan Fair l430 mengatakan, pasar murah merupakan embrio lahirnya pasar Syariah pertama dan satu-satunya di Indonesia. Peresmian pasar murah dan program belajar masyarakat ditandai penguntingan pita oleh Wabup Deliserdang didampingi Ketua GOP TKI Deli Serdang Hj. Asdiana Zainuddin Mars dan Kadis Diperindag Deliserdang H. Marapinta Harahap sekaligus peninjauan bersama Kadis Pendidikan Sumut H. Bahrumsyah dan undangan lainnya.(a05)

19

Waspada/Hasuna Damanik

BANTUAN: Bupati Simalungun, HT Zulkarnain Damanik menyerahkan bantuan (insentif) dari Pemkab Simalungun kepada para guru MDA se-Simalungun, Rabu (19/8) di Auditorium USI.

Tekan Laka, Polresta P. Siantar Gelar Operasi Malam P. SIANTAR ( Waspada): Kegiatan operasi rutin lalu lintas di wilayah hukum Polresta Pematangsiantar dalam menekan angka kecelakaan lalu lintas dan meningkatkan kepatuhan terhadap peraturan lalu lintas bukan hanya pada siang hari, namun turut dilakukan pada malam hari. “Kegiatan operasi rutin/ sweeping lalu lintas dilakukan di lokasi rawan,” sebut Kapolresta Pematangsiantar AKBP Andreas Kusmaedi, MM melalui Pabungpen AKP Muslim dan Kasat Lantas AKP F. Zendrato

di Mapolresta, Kamis (20/8). Kasat Lantas menyebutkan, hasil operasi rutin lalu lintas yang dilaksanakan di lokasi titik rawan di Jalan Merdeka di depan Pos Polisi Pasar Horas, Rabu (19/8) pada pukul 20:3022:30, hasilnya menunjukkan masih banyak warga yang tidak taat peraturan lalu lintas. Dalam operasi malam hari itu diperkuat personil terdiri 18 anggota Sat Lantas Polresta dan dua perwira ditambah dua anggota Polisi Militer menunjukkan para pelaku pelanggaran lalu lintas itu terutama para anak muda pengendera sepeda mo-

tor yang tidak menggunakan helm standar, sebut Kasat Lantas. Kasat Lantas menyebutkan, hasil operasi rutin itu, sebanyak 24 SIM dan STNK serta 10 unit sepeda motor disita sebagai barang bukti dan kepada pengendara sepeda motor dikenakan tilang. Menurut Kasat Lantas, operasi rutin itu masih tetap berlanjut, baik siang maupun malam hari di beberapa lokasi jalan di Pematangsiantar sebagai upaya menyadarkan masyarakat dalam berlalulintas yang baik.(a14)

Jual Koran Perusahaan Diadukan P E M ATA N G S I A N TA R (Waspada): Diduga menjual koran perusahaan tempatnya bekerja tanpa seizin perusahaannya, karyawan PT Siantar Media Pers Group (SMPG), AS, 27, warga Jalan Sangnawaluh, Komplek Mega Land, Blok D, KelurahanSiopatSuhu,Keca-matan Siantar Timur, Kota Pe-matangsiantar diadukan perusahaannya sendiri ke pihak Polresta. Satpam PT SMPG, Fadly, 26, warga Nagori Moho, Kecamatan Jawa Maraja Bah Jambi, Kabupaten Simalungun, atas nama PT SMPG mengadukan AS ke Polresta pada Rabu (19/ 8). Dalam pengaduannya, Fadly menyebutkan AS diketahui mencuri koran milik perusahaan itu dari gudang PT SMPG di Jalan Sangnawaluh, Komplek Mega Land, Blok D, Kelurahan Siopat Suhu, Kecamatan Siantar

Timur, Pematangsiantar pada Senin (11/5) pukul 16:00. Awalnya, pada Sabtu (11/ 4) pukul 16:30, Fadly sedang bekerja di PT SMPG sebagai Satpam. Ketika mengecek ke gudang, Fadly menemukan pintu gudang dalam keadaan rusak dan koran seberat 5.280 Kg sudah hilang. Fadly selanjutnya melaporkannya kepada Dumaria Nainggolan, 35, Manajer Keuangan PT SMPG. Keesokan harinya, saksi memanggil karyawan yang bekerja di gudang terdiri AS dan Sahat Marulitua Siallagan. Kepada AS dan Sahat, Fadly dan Dumaria menanyakan kejadian hilangnya koran dari gudang itu. AS saat itu mengakui mengambil koran itu dari gudang dan menjualnya serta hasil penjualannya digunakan untuk kepentingan pribadinya.

Perusahaan masih memberi kesempatan kepada AS mengganti kerugian perusahaan atas penjualan koran tanpa izin itu, namun sampai berbulan lamanya, AS tidak mengembalikannya hingga Fadly atas nama perusahaan didampingi saksi Dumaria dan saksi Adi Laoli, 35, Pimpinan Percetakan PT Media Graindo, warga Perumahan Sibatubatu Indah, Kelurahan Bah Kapul, Kecamatan Siantar Sitalasari, Pematangsiantar mengadukan AS ke Polresta, karena perbuatannya mencuri koran itu mengakibatkan perusahaan mengalami kerugian mencapai Rp 6.392.000. Kapolresta AKBP Andreas Kusmaedi saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolresta, Kamis (20/8) membenarkan. (a14)

AMPI Siap Kawal Pilkada Sibolga SIBOLGA ( Waspada) : Ketua DPD Angkatan Muda Pembaharuan Indonesia (AMPI) Kota Sibolga, Miryansah Pasaribu, SE menyatakan, pihaknya siap untuk mengawal proses demokrasi di Sibolga khususnya menjelang pelaksanaan pemilihan kepala daerah (Pilkada) pada 2010 mendatang. Kesiapan itu dikemukakan Miryansah Pasaribu saat melantik lebih dari 700 pengurus dan anggota Rayon AMPI Kecamatan Sibolga Selatan, Selasa malam (18/8) masa bakti 2009 - 2014, di Jalan Damai, Kelurahan Aek Habil, Kecamatan Sibolga

Selatan, Kota Sibolga dan Pengurus AMPI Sibolga Sambas, Rabu malam (19/8). Turut hadir, Wakil Ketua DPP AMPI Pusat yang juga anggota DPR RI dari Partai Golkar, HM. Syarfi Hutauruk, Wakil Sekretaris Partai Golkar Sumut, H Syukran J Tandjung, Ketua Partai Golkar Sibolga Selatan, Azwir Pardede, fugsionaris Partai Golkar, Hotma Nainggolan, Lurah Aek Habil, Faisal Fahmi Lubis dan undangan lainnya. Anggota DPR RI Syarfi Hutauruk mengingatkan warga Sibolga tidak terpecah-belah.

‘’Mari kita jaga jalinan silaturahmi serta kerukunan antar umat beragama,’’ katanya. Dia juga menyatakan pihaknya juga berencana untuk menggelar safari Ramadhan pada bulan suci Ramadhan tahun ini, karena hal itu merupakan agenda rutin tahunannya selama menjabat sebagai anggota DPR RI. HM Syarfi Hutauruk mengatakan, siapapun yang menjadi pengurus AMPI, dia itu adalah kader - kader militan dari partai Golkar. Oleh karenanya, diharapkan, segenap jajaran anggota AMPI tidak hanya bekerja untuk mencari jabatan. (a34)

SIMALUNGUN (Waspada): Sekira 800-an guru Madrasah Diniyah se-Kab. Simalungun yang tergabung dalam PGDI (Persatuan Guru Diniyah Indonesia) meminta HT Zulkarnain Damanik untuk bersedia dicalonkan kembali menjadi Bupati Simalungun pada periode 20102014. Dukungan itu muncul saat pertemuan silaturahmi antara Bupati Simalungun HT Zulkarnain Damanik dengan ratusan guru-guru Madrasah Diniyah se- Simalungun dan Pengurus Daerah (PD) PGDI Kab. Simalungun di gedung Auditorium USI, yang dirangkai dengan penyerahan bantuan (insentif ) dari Pemkab Simalungun kepada guru-guru MDA itu sebesar Rp 200 ribu per orang, Rabu (19/8). Acara itu dihadiri Kakandepag Simalungun Drs Muslim, Ketua MUI H Abdul Halim Lubis dan sejumlah pimpinan SKPD Pemkab Simalungun, Kabag Humasy Simesono Hia. Menurut Ketua PD PGDI Kab.Simalungun, Nurhaidah, sosok Zulkarnain Damanik masih pantas untuk memimpin Kab. Simalungun pada periode berikutnya. Dimana, selama empat tahun kepemimpinannya dinilai telah berhasil meningkatkan pembangunan di Simalungun, baik itu pembangunan secara pisik maupun non fisik.

Pada kesempatan yang juga dirangkaikan dengan penyerahan bantuan (insentif) kepada guru-guru madrasah itu, Nurhaidah menjelaskan, kondisi kesejahteraan para guru MDA se- Kab. Simalungun masih prihatin. Dikatakan, pemberian insentif ini sangatlah berarti bagi para guru MDA, dan hal ini semoga dapat menjadi motivasi bagi guru dalam menidik anak-anak di MDA. Nurhaidah juga berharap, bantuan ini hendaknya dapat berkelanjutan sehingga para guru di MDA lebih giat lagi untuk memberikan pendidikan dan bimbingan bagi anak-anak, terutama pendidikan agama. Sesuai data yang ada pada PGDI jumlah guru MDA di Kab. Simalungun sebanyak 782 orang. Namun jumlah yang menerima bantuan (insentif) baru sebanyak 543 orang. Olah karenanya diharapkan kepada Pemkab Simalungun juga memberikan bantuan kepada 241 orang lagi, harap Nurhaidah. Sementara, Bupati Simalungun dalam arahannya mengatakan, kegiatan silahturrahmi yang dilaksanakan adalah untuk mengetahui eksistensi MDA di Kab. Simalungun. Dimana MDA merupakan salah satu organisasi masyarakat yang bergerak dibidang pendidikan khususnya pendidikan agama bagi anak-anak. “ Tugas yang sangat mulia ini patut untuk dihargai dan didukung semua pihak,” tandas Zulkarnain. (a15)

Koperasi Harus Profesional Dan Cerdas SEI RAMPAH (Waspada): Pengurus dan anggota koperasi harus berani mencari peluang dan terobosan baru secara cerdas agar tidak tertinggal serta kalah bersaing dengan badan usaha lainnya. Hal itu ditegaskan Bupati Serdang Bedagai HT Erry Nuradi pada peringatan HUT ke-62 koperasi tingkat Kab. Sergai di Pantai Kuala Putri, Kec. Pantaicermin, Sabtu (15/8). Acara dihadiri Wakil Bupati H Soekirman, Plt. Sekdakab Sergai Haris Fadillah, Asisten Ekbangsos Aladin Berutu, Kadis Perindagkop H Aliman Saragih, Ketua Dekopinda Sergai H Adham Nuch. Menurut bupati, koperasi sebagai soko guru perekonomian bangsa dan manifestasi demokrasi ekonomi harus dapat meningkatkan

peran serta dalam berkontribusi terhadap ketahanan perekonomian nasional. Di tengah persaingan dunia usaha yang semakin ketat terutama menghadapi dinamika perubahan global, kata Erry, manajemen perkoperasian perlu lebih profesional. Pengurusnya harus bersemangat mencari peluang memajukan koperasinya. Peringatan HUT ke-62 Koperasi Kabupaten Sergai 2009 ini diisi dialog interaktif ratusan anggota koperasi Sergai dan Manajemen Bank Mandiri Syari’ah Sahala Parluhut S tentang perkreditan dan presentase budidaya ikan kerapu oleh Effendi salah seorang tokoh Kontak Tani Nelayan Andalan (KTNA) Sumut. (a07)

Gebrakan PB IKLAS Dapat Dukungan MEDAN (Waspada): Gebrakan dan langkah yang dilakukan Pengurus Besar Ikatan Keluarga Labuhanbatu Selatan (PB IKLAS) dan Pengurus Pusat Ikatan Pemuda dan Mahasiswa Labuhanbatu Selatan (PP IPMALABSEL) dalam membangun dan mencerdaskan masyarakat Labuhanbatu Selatan (Labusel) mendapat penilaian positif dari para kepala desa se kabupaten pemekaran baru itu. Pernyataan dukungan itu disampaikan Kepala Desa Mampang Kec. Kota Pinang M Romadon Nasution, SH ketika menghadiri acara syukuran setahun berdirinya PB IKLAS dan PP IPMALABSEL, akhir pekan lalu di Medan. “Saya secara dinas maupun pribadi sangat mendukung segala kegiatan dan program kerja yang dilakukan PB IKLAS dan PP IPMALABSEL. Kami tergabung dalam himpunan Kepala Desa se Kabupaten Labuhanbatu Selatan telah melihat

langsung peran kedua lembaga tersebut dalam turut memajukan masyarakat Labusel,” ujar Romadon. Romadon, yang juga Wakil Letua DPD Partai Golkar Labusel dan Sekretaris Dewan Pimpinan Kabupaten MPI Labusel mengatakan, salah satu bukti nyata yang telah diperbuat kedua lembaga itu yakni pelaksanaan Bimbingan Belajar (Bimbel) CPNS baru-baru ini diikuti 179 peserta. Menurutnya, apa yang diperbuat PB IKLAS dan PP IPMALABSEL juga berimbas positif bagi desanya yang kini dipercaya untuk mendirikan SMA 2 Kota Pinang percontohan di Desa Mampang. Tujuan pendirian sekolah percontohan itu tak lain adalah untuk mencerdaskan anak bangsa selaku generasi muda, cikal bakal pembentukan sumber daya manusia (SDM) yang handal bagi pembangunan Labusel di masa datang. (m07)

Ketua Baru IKLAB Medan Dilantik Setelah Idul Fitri MEDAN (Waspada): Ir. H. Subahri Ritonga MM yang terpilih kembali menduduki jabatan Ketua Ikatan Keluarga Labuhanbatu (IKLAB) Medan dan sekitarnya dilantik setelah Idul Fitri pada acara Halal bi Halal dan tepung tawar jamaah calon haji. Demikian Drs. Rivai Nasution MM dalam pembicaraannya dengan Waspada baru-baru ini. Rivai mengatakan, pada acara itu juga dilakukan syukuran atas terpilihnya penasehat IKLAB H. Abdul Wahab Dalimunthe, SH sebagai anggota DPR-RI. Ir. Subahri terpilih kembali menjadi Ketua Umum Ikatan Keluarga Labuhanbatu (IKLAB) Medan dan sekitarnya setelah dilakukan rapat formatur Musyawarah IKLAB Medan yang digelar di aula kediaman H. Abdul Wahab Dalimunthe SH di Komplek Tasbi Medan. Subahri yang juga Direktur Perencanaan dan Produksi PDAM Tirtanadi itu, dihunjuk secara aklamasi oleh anggota formatur untuk memimpin IKLAB Medan periode 2009-2011. Sidang formatur juga menghasilkan personalia pengurus harian IKLAB Medan periode 20092011, yakni Ketua 1 Drs. H. Syahminan Pasaribu, MM, Ketua 2 Drs. Rivai Nasution, MM, ketua 3 Drs. H. M. Fitriyus, SH, MM. Posisi Sekretaris Umum Dr Saidurrahman, MA, Sekretaris 1 Insan Khoirul Qolbi, SHI, Sekretaris 2 Syaiful A. Siagian, S.PdI dan Sekretaris 3 Rahmat AP Harahap, S.STP. Sedangkan Bendahara Umum H Usman Nasution, SE, MM, Bendahara 1 Ir. Ruslan Efendi Harahap, MM, Bendahara 2 Syarifuddin Elhayat dan Bendahara 3 Sofwan Tambunan, SH. Salah satu poin penting dalam musyawarah IKLAB Medan tersebut, yakni tetap bergabungnya

seluruh masyarakat asal Labuhanbatu di Kota Medan dan sekitarnya dalam satu wadah bernama IKLAB, meskipun secara administratif telah dimekarkan menjadi tiga kabupaten, yaitu Labuhanbatu Induk, Labuhanbatu Utara dan Labuhanbatu Selatan. Menurut Subahri, poin penting ini termasuk usulan dan saran dari penasehat IKLAB Medan H AbdulWahab Dalimunthe dan Bupati Labuhanbatu HT Milwan yang disetujui langsung oleh peserta musyawarah. Pada kesempatan itu, AbdulWahab menekankan, IKLAB Medan adalah organisasi kemasyarakatan yang berfungsi sebagai pengikat tali silaturrahim yang termanifestasi dalam bentuk pengabdian, bukan alat untuk kepentingan politik praktis seseorang atau kelompok tertentu.(m07)

Bawa Rekap Togel Ditangkap P. SIANTAR (Waspada): Diduga membawa rekapitulasi judi toto gelap (Togel), EM, 43, warga Jalan Saropa, Nagori Totap Majawa, Kec. Tanah Jawa, Kab. Simalungun ditangkap Sat Reskrim Polres Simalungun. “Kami mendapat informasi dari masyarakat yang menyebutkan EM diduga membawa rekapitulasi judi togel. Dari hasil penyelidikan, ternyata informasi itu benar,” sebut Kapolres Simalungun AKBP Rudi Hartono, saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Travolta, di Mapolres, Kamis (20/8). Saat digeledah, ditemukan pada EM barang bukti judi Togel berupa uang Rp396.000 yang diduga sebagai hasil penjualan angka-angka tebakan judi togel, satu pulpen sebagai alat tulis, dua lembar kertas rekapitulasi bertuliskan angkaangka judi Togel. (a14)

Tim Safari Ramadhan Pemkab Sergai Disahkan SEI RAMPAH(Waspada): Bupati Serdang Bedagai HT Erry Nuradi telah mengsahkan XVII Tim Safari Ramadhan 1430 Hijriah yang ditugaskan untuk melaksanakan silaturahmi kepada masyarakat ke berbagai masjid di 17 kecamatan se Kab. Serdang Bedagai dimulai Minggu, 23 Agustus hingga Kamis, 17 September 2009. Setiap Tim Safari Ramadhan dipimpin ketua tim dan melibatkan dari berbagai elemen, seperti tokoh masyarakat, TNI/Polri, Kejaksaan, Pengadilan Negeri, Pengadilan Agama, PNS Pemkab Sergai, tokoh agama, dan wartawan akan mengunjungi tiga masjid. Untuk tim I dipimpin Bupati Sergai HT. Erry Nuradi beranggotakan sebanyak 28 orang akan mengunjungi Masjid Agung Jami Sei Rampah, Masjid Istikmal Desa Pasar Bengkel, Kec. Perbaungan dan Masjid Al Falah Desa Baja Ronggi, Kec. Dolok Masihul. Tim II dipimpin Wabup H. Soekirman beranggotakan 19 orang akan mengunjungi Masjid Al Raudhah Desa Besar II Terjun, Kec. Pantai Cermin, Masjid Al Falah, Desa Penggalangan, Kec. Tebing Syahbandar dan Masjid Nurul Karim Desa Jati Mulia, Kec. Pegajahan. Tim III dipimpin Plt. Sekdakab Drs. H. Haris Fadillah, MSi beranggotakan 13 orang akan mengunjungi Masjid Baiturrahman Desa Sukajadi, Kec. Tg. Beringin dan Masjid Al Huda Desa Paya Bagas, Kec. Tebing Tinggi. Tim IV dipimpin Drs. M. Aladin Berutu beranggotakan 11 orang akan mengunjugi Masjid Al Ikhlas Paya Lombang, Kec. Tebingtinggi, Masjid Jami Desa Pon, Kec. Sei Bamban

dan Masjid Nurul Huda Tarean, Kec. Silinda. Tim V dipimpin Drs. Zainal Arifin beranggotakan 10 orang akan mengunjungi Masjid Nurul Iman, Desa Bogak Besar, Kec. Teluk Mengkudu, Al Muttaqin Desa Sei Kari, Kec. Kotari dan Masjid Nurul Iman Desa Pantai Cermin Kiri, Kec. Pantai Cermin. Tim VI dipimpin Drs. H. Rifai Bakri Tanjung, MAP beranggotakan 10 orang akan mengunjungi Masjid Al Hidayah, Desa Tebingtinggi, Kec. Tg. Beringin, At Taqwa Desa Marjanji, Kec. Sipispis, dan Masjid Al Ikhsan Desa Sei Buluh, Kec. Perbaungan. Tim VII dipimpin Ir. Yusran Safri, MSi beranggotakan 9 orang akan mengunjungi Masjid Al Amin Desa Pondok Tengah, Kec. Pegajahan, Masjid Besar Al Hidayah, Desa Karang Tengah, Kec. Serbajadi dan Masjid Al Islah Desa Pekan Sialang Buah, Kec. Teluk Mengkudu. Tim VIII dipimpin Ir. Siar Muhammad beranggotakan 10 orang akan mengunjungi Masjid An Nur Desa Kayu Besar, Kec. Bandar Khalifah, Al Hidayah Desa Limbong, Kec. Dolok Merwan dan Masjid Al Quba, Desa Bagan Kuala, Kec. Tg. Beringin. Tim IX dipimpin Erwin SE beranggotakan 10 orang akan mengunjungi Masjid Nurul Ikhsan, Desa Paya Pasir, Kec. Tebing Syahbandar, Masjid Jami, Desa Dolok Masango, Kec. Bintang Bayu dan Masjid Jami’ul Jihad Desa Marubun, Kec. Sipispis. Tim X dipimpin Ir. Megahadi Kristanto beranggotakan 9 orang akan mengunjungi Masjid Al Muttaqin Bintang Bayu, Masjid Amaliyah, Desa Bantan, Kec. Dolok Masihul, dan Masjid Al Muttaqin, Sei Bamban Estate, Kec. Sei Bamban. Tim XI dipimpin Drs. M. Zaki beranggotakan 9 orang akan mengunjungi Masjid Al Muttaqin Desa Sukadame, Kec. Sei Bamban,

Masjid Baitul Rahman, Desa Petuaran Hilir, Kec. Pegajahan dan Masjid Jami Desa Kotarih Baru, Kec. Kotarih. Tim XII dipimpin Ir. HM. Ramlan Matondang, MSi beranggotakan 10 orang akan mengunjungi Masjid Nurul Iman, Desa Banjaran Godang, Kec. Kotarih, Masjid Nurul Huda Desa Pematang Ganjang, Kec. Sei Rampah, dan Masjid Nurul Iman, Desa Pulau Gambar, Kec. Serbajadi. Tim XIII dipimpin Drs.OK.Henry beranggotakan 9 orang akan mengunjungi Masjid Besar Al Hidayah Dolok Merawan, Nurul Iman Mata Pao,Kec.Teluk Mengkudu dan Masjid Jami, Desa Gudang Garam, Kec. Bintang Bayu. Tim XIV dipimpin Ir.H.Aliman Saragih beranggotakan 9 orang akan mengunjungi Masjid Babul Jannah Sipispis, At Taqwa Desa Gelam Sei Serimah dan Nurul Hasanah Firdaus, Kec. Sei Rampah. Tim XV dipimpin H. Rapotan Siregar beranggotakan 10 orang akan mengunjungi Masjid Ar Rahman Desa Tg. Harap, Masjid Al Hidayah Desa Bah Sumbu dan Masjid Baitul Hidayah, Desa Bandar Tengah, Kec. Bandar Khalifah. Tim XVI dipimpin Ir. Safaruddin beranggotakan 9 orang akan mengunjungi Masjid Al Hidayah Tapak Meriah, Kec. Silinda, Masjid Nurul Ikhlas, Desa Pematang Kasih, Kec. Pantai Cermin dan Masjid Al Ikhklas Mainu Tengah, Kec. Dolok Merawan dan Masjid Darus Salam, Desa Dolok Sagala, Kec. Dolok Masihul. Tim XVII dipimpin Ir.M.Taufiq Batubara beranggotakan 10 orang akan mengunjungi Masjid Darus Salam, Desa Dolok Sagala, Kec. Dolok Masihul, Masjid Jamiatul Muslimin Desa Pagar Manik, Kec. Silinda dan Masjid Al Falah, Desa Paya Pinang, Kec.Tebing Syahbandar.(a07)

Sumatera Utara

20

Harga Daging Tembus Rp70 Ribu: Pedagang daging hari per tama punggahan, Kamis (20/8) di Tanjungtiram, Labuhanruku Talawi Batubara sepi. Padahal harga daging lembu yang mereka tawarkan sekira Rp70.000 - Rp.60 000. Menurut Badruddin, pedagang daging di pasar samping kantor Camat Tanjungtiram mengatakan, daya beli kurang jauh dibanding tahun sebelumnya, padahal harga hanya Rp70.000 sementara tahun lalu Rp75.000. Sementara ibu rumah tangga Huzaimah menyatakan, Kami hanya mampu membeli daging kupasan ditumpuktumpuk di atas tanah beralas plastik dengan harga Rp20.000 kami bisa juga merasakan daging menyambut bulan puasa. Waspada/Helmi Has

Mr X Ditemukan Di Perairan Pulau Mursala SIBOLGA (Waspada) : Sesosok mayat Mr X diduga berprofesi sebagai nelayan ditemukan terapung di samping sampan jenis kutuk-kutuk diduga milik korban di Perairan Laut Pulau Mursala Tapteng, Kamis (20/8). Informasi yang dihimpun

Waspada di ruang mayat RSUD Dr FL Tobing Sibolga di Jalan Dr Ferdinan Lumbantobing Sibolga dan pangkalan TNI AL Sibolga menjelaskan, mayat Mr X ditemukan tim patroli laut Lanal Sibolga dengan kondisi terapung disamping satu unit sampan berisi ikan hasil

tangkapan. Tim selanjutnya membawa mayat ke RSUD Dr FL Tobing Sibolga untuk divisum sedangkan kapal dan muatannya diamankan ke Mako Lanal Sibolga di Jalan S Parman Sibolga. Selain itu turut juga diamankan berupa tas dan kain sarung milik

korban di RSU FLTobing Sibolga. Sedangkan Ciri-ciri mayat berbadan agak kurus mengenakan celana jeans panjang dan baju kaos panjang warna kuning, mengenakan jam tangan, kulit hitam rambut beruban dan diperkirakan berumur 50 tahun. (a34)

Keluarga Korban Pembunuhan Minta Keseriusan Polres Dairi SIDIKALANG (Waspada): Keluarga korban pembunuhan Rosida Sianturi, 55, meminta Polres Dairi serius mengungkap kasus kematian ibu dimaksud yang terjadi Agustus 2008 di gubuk perladangannya di Desa Lae Tanggiang, Kec. Sumbul. Nasib Manalu, 25, putra korban ditemui di kediamannya, Kamis (20/8) mengatakan, sangat mengharapkan penegakan

hukum sehingga jelas siapa yang harus bertanggung jawab atas misteri itu. Diakui, menyusul tragedi itu, beberapa kali pihaknya telah dimintai keterangan oleh polisi. Bahkan, hal yang sangat memilukan, ayah mereka Togi Manalu akhirnya harus menerima tindak kriminal di kantor Polsek Sumbul agar mengaku sebagai orang yang membunuh.

Ayah saya dihujani pukulan oleh oknum polisi hingga pendengaran rusak berikut dengan wajah lembam-lembam. Kasus itu, sebelumnya sudah dilaporkan ke Propam Poldasu. Menurut Nasib, orang tua mereka tidak pernah mengakui perbuatan itu. Diungkapkan, kematian itu diketahui ketika dirinya tiba di gubuk perladangan di mana

Pembahasan R-APBD 2010 Tidak Langgar Aturan SIMALUNGUN (Waspada): Pembahasan Rancangan Anggaran Pendapatan dan Belanja Daerah (R-APBD) Kab. Simalungun tahun anggaran (TA) 2010 yang saat ini sedang dilaksanakan Pemkab dan DPRD Simalungun tidak melanggar aturan dan perundang-undangan berlaku. Hal itu ditegaskan Sekdakab Simalungun Mahrum Sipayung, di gedung DPRD Simalungun di Pamatangraya, Kamis (20/8) menyikapi adanya tudingan masyarakat maupun LSM yang menyebutkan pembahasan RAPBD Simalungun TA 2010 yang diawali dengan pembahasan rancangan KUA (Kebijakan Umum Anggaran) dan rancangan Prioritas Plafon Anggaran Sementara(PPAS)yangdilakukan Pemkab dan DPRD Simalungun seolah-olahdipaksakandankental nepotisme. “Tidakadaunsurpaksaandan nepotisme. Pembahasan RAPBD 2010 dilakukan demi efisiensi waktu agar pada Oktober ini R-APBD dimaksud sudah bisa dikirim ke Gubsu untuk mendapatkan klarifikasi,” tandas Mahrum. Menurutnya,prosesklarifikasi di Pemprovsu juga memakan waktu yang lumayan lama. Diperkirakan APBD baru bisa turun ke kabupaten setelah dua bulan. Dikatakan, jika proses pembahasan tidak dilaksanakan sekarang, maka APBD belum dapat

direalisasikan pada Januari 2010 dan pengaruhnya terhadap programpembangunansangatbesar. Mahrum menjelaskan, pembahasan R-APBD sebelum diPerda-kan sesuai surat Dirjen Keuangan No. S-287/PK/2009, prihal penyusunan APBD tahun 2010 yang ditujukan kepada gubernur, bupati dan walikota se Indonesia. Lebihlanjutdijelaskan,dalam surat itu tertuang agar proses penyusunan Perda APBD dapat dilakukan tepat waktu sehingga penyerapanAPBDsebagaistimulan dalam pembangunan daerah dapat segera terealisasi dengan baik dan tepat waktu pula. “ Jika merujuk surat Dirjen tentang penyusunan APBD 2010, seharusnya pembahasan rancangan KUA dan PPAS sudah harus

KABANJAHE (Waspada) : Dewarat Munthe, 56, warga Desa Tongging, Kecamatan Merek, Rabu (19/8) ditemukan warga dalam keadaan tewas dengan luka tusukan. Dua rekan korban Andi S dan SM, 60, mengalami luka serius dan saat ini mendapat perawatan di salah satu RSU setelah serombongan OTK ( Orang Tidak Dikenal) melakukan penyerangan. Mereka diserang malam

hari saat sedang bertugas jaga malam di proyek pelebaran Jalan Sikodon Kodon –Tongging, Kecamatan Merek. Pihak kepolisian resort Tanah karo masih terus menyelidiki motifnya dan pelaku pembunuhan dan penganiayaan terhadap ketiga warga Desa Tongging . Isu yang berkembang di masyarakat dari peristiwa pembunuhan menyebutkan kalau korban yang bekerja sebagai

selesai pada pertengahan Juli lalu. Jadi sebenarnya kita sudah terhitung terlambat. Namun meski sedikit terlambat, pihaknya akan bekerja keras agar keterlambatan sesuai surat Dirjen keuangan itu dapat dikejar,” terang Mahrum. Pengamatan Waspada di kantor DPRD Simalungun di Pamatangraya, proses pembahasan R-APBD Simalungun TA 2010 yang diawali dengan pembahasan KUA dan PPAS masih terus berlanjut bahkan sudah sampai kepada tahapan pembahasan ditingkat komisi. Informasi diperoleh, RAPBD Kab. Simalungun TA 2010 sudah dapat disahkan menjadi Perda pada 18 Sepetember 2009, terhitung 5 hari sebelum masa tugasanggotaDPRDSimalungun periode 2004-2004 berakhir.(a15)

Muskab III KNPI Tobasa Hari Ini BALIGE(Waspada): Pelaksanaan musyawarah kabupaten (muskab) III Komite Nasional Pemuda Indonesia Toba Samosir (KNPI Tobasa) sudah dipastikan hari ini, Jumat (21/8) di Hotel Ompu Herti Balige. Agenda muskab terutama membahas pemilihan ketua organisasi untuk periode 2009-2012. “Memang pelaksanaan Muskab KNPI Tobasa sempat tertundatunda karena banyaknya kesibukan -kesibukan para pengurus, namun sudah dipastikan akan terlaksana besok “kata Ketua KNPI Tobasa Herbet Sibuea didampingi ketua panitia Muskab Buala Napitupulu kepada wartawan di kantornya,Kamis (20/8). Ditanya agenda Muskab, Herbet mengatakan selain pemilihan ketua yang baru, wadah berhimpun organisasi kepemudaan ini juga telah sepakat membahas dan mendukung segala program pembangunan Pemkab Tobasa yang memajukan daerah bersama masyarakatnya. (a33)

Pengawas Proyek Jalan Tewas Dibunuh pengawas proyek peningkatan/ pelebaran jalan Tongging-Sikodon-kodon batas Dairi diduga ada berselisih paham dengan oknum warga . Kapolres Tanah Karo Agus Pranoto melalui Kasat Reskrim AKP Lukmin Siregar yang dihubungi membenarkan. Menurutnya, timnya tengah melakukan olah TKP dan menginterogasi dua orang saksi yang bekerja sebagai penjaga malam alat berat proyek. (a17)

Ormas Harus Ikut Berpartisipasi Bangun Daerah BALIGE(Waspada): Dandim 0210 TU Letkol Arh Ramses Lumbantobing mengatakan organisasi masyarakat (ormas) anak ABRI (TNI / Polri ) harus ikut berpartisipasi membangun daerah bukan lagi menciptakan kerusuhan-kerusuhan , nanti masyarakat jadi membenci organisasi ini. “Para pengurus ormas ini merupakan keturunan orangtuanya yang dulunya pejuang, tingkah laku dan ciri khasnya harus sama seperti orangtuanya. Tidak lembek, tidak cengeng dan tidak pernah menyerah kepada keterbatasan untuk berperan mengisi pembangunan daerah,” kata Dandim dalam

sambutannya pada acara pelantikan/pengukuhan ormas anak ABRI Tobasa, di kompleks tugu DI Panjaitan Balige belum lama ini. Acara pelantikan turut dihadiri Ketua KNPI Tobasa Herbet Sibuea, Waka Polres Tobasa , jajaran kepala dinas/ kepala badan/kepala bagian Pemkab Tobasa, jajaran Kodim 0210 TU, tokoh pemuda, tokoh masyarakat dan tokoh agama. Sementara itu, Albert Marpaung yang baru dilantik meminta seluruh pengurus dan orang-orang yang berhimpun di dalamnya menggalang kesatuan dan persatuan dengan masyarakat sesuai dengan cita-

cita Republik Indonesia seperti yang diamanatkan UUD 1945. Begitu juga disampaikan Ketua PD II H Helmi Hasballah dan Bupati Tobasa Monang Sitorus yang mengharapkan organisasi itu ikut melaksanakan program-program kemasyarakatan. Dalam kesempatan itu, Bupati mengajak para pengurus dan anggota untuk turut serta melakukan program penghijauan dengan menanam beragam jenis pepohonan di lerenglereng Dolok Tolong Balige untuk mencegah terjadinya bencana-bencana alam dan timbulnya situasi alam yang baik. (a33)

kepala si ibu terlihat sudah dibacok. Uang dan perhiasan emas raib. Saat itu, ayah mereka berada di rumah. Yansi Simamora kakak ipar korban mempertanyakan, kenapa kasus sedemikian belum juga terungkap hingga satu tahun. Dia meminta, polisi menangangani secara proporsional tanpa melindungi siapapun pelaku. (a28)

Sambut Ramadhan, Sekolah Di Karo Libur BERASTAGI (Waspada): Menyambut Bulan Ramadhan 1430 H seluruh sekolah di Kabupaten Karo mulai tingkat SD, SMP dan SMA/MA serta SMK libur selama dua hari, Kepala Dinas Pendidikan Kabupaten Karo, diwakili Kepala Bidang Pendidikan Menengah Drs. Sugianta Ginting, ketika dihubungi Waspada via telefon Kamis (20/8) membenarkan itu. Dikatakan Sugianta Ginting, sesuai dengan kalender pendidikan semester ganjil tahun pelajaran 2009/2010 libur umum menyambut Bulan Ramadhan di lingkungan Dinas Pendidikan Kabupaten Karo telah ditetapkan selama dua hari dimulai hari ini, Jumat (21/8) hingga Sabtu (22/8) mendatang dan kegiatan proses belajar mengajar menurutnya akan kembali dilaksanakan seperti biasanya mulai, Senin (24/8). (css)

WASPADA Jumat 21 Agustus 2009

Sat Pol PP Sering Diintimidasi SAMOSIR (Waspada) : Menunjang kelancaran tugas pelayananmasyarakatkhususnyabagi aparatur pemerintah, pihak Sat Pol PP Kab. Samosir gencar me-

lakukanpenertibanaparaturyang berkeliaran saat jam kerja. Kasat Pol PP kab. Samosir Nurdin Siahaan,SH menjawab Waspada, Kamis (20/8) menga-

takan, pihaknya tidak pandang bulu melakukan penertiban bagi para PNS baik mulai dari Golongan II,III dan IV. Laporan hasil penertiban Sat

Pol PP diserahkan kepada Bupati Samosir, Inspektur dan Badan Kepegawaian Daerah, sebut Siahaan. (c10)

Sumatera Utara

WASPADA Jumat 21 Agustus 2009

Harga Kebutuhan Pokok Di Madina Naik PANYABUNGAN (Waspada) : Menjelang Ramadhan 1430 Hijriah ini harga berbagai kebutuhan pokok (sembako) mulai naik. “Meski pasokan sembako stabil, namun harga mulai naik sejak dua pekan terakhir,” kata Asmiah Nasution, 51, salah seorang pedagang sembako di Pasar Baru Panyabungan, Kamis (20/8). Ia mengatakan, naiknya harga dipicu meningkatnya permintaan terutama kebutuhan sehari-hari menjelang Ramadhan. “Hampir setiap tahun kebutuhan pokok naik menjelang Ramadhan dan Idul Fitri, setelah itu kembali stabil,” ujarnya. Hal yang sama juga disampaikan pedagang Amir Husin Lubis. Menurutnya, para pedagang memanfaatkan momentum umat Muslim menyambut Ramadhan dan Idul Fitri untuk mengejar keuntungan seba-

nyak-banyaknya. Meski demikian, kenaikan harga masih wajar karena belum mencapai 50 persen. “Saya yakin harga sekarang masih bisa dijangkau oleh masyarakat ,” kata ayah beranak tiga tersebut. Ia berharap, untuk menjaga kondisi harga agar tidak memberatkan masyarakat, perlu tindakan tegas Pemkab Madina, menertibkan permainan pasar agar jangan sampai menyengsarakan rakyat kecil. Kepala Dinas Perindag dan Pemod Madina A.Ansyari Nasution menjelaskan, kenaikan harga kebutuhan pokok dibarengi tingginya permintaan konsumen. Dijelaskan, untuk mengatasi agar harga kebutuhan pokok tidak terlalu mencolok, maka pihaknya bersama instansi terkait akan melakukan pengawasan langsung ke pasar–pasar. “ Misalnya kita menyurati Dinas Peternakan agar harga daging ayam daging ayam, sapi dan telur tidak terlalu tinggi harga

yang dikenakan pedagang,” jelasnya. Ansyari menambahkan, stok cukup sesuai dengan data Badan Ketahan Pangan Madina. “ Stok beras ini juga bisa aman dikarenakan beberapa kecamatan baru selesai panen,” ungkapnya. Pantauan di beberapa pasar tradisional, harga gula pasir Rp 7.500 per kg, ayam potong Rp 20.000 per kg , minyak goreng curah Rp8.000 per kg , cabai merah Rp20.000 per kg, bawang merah Rp16.000 per kg, daging sapi Rp. 80.000 per kg. Kemudian, ikan mas Rp 23.000 per kg, ikan laut segar Rp 23.000 per kg, tomat Rp 6.000 per kg , kol Rp2.500 per kg , wortel Rp5.000 per kg , kentang Rp7.000 per kg, sedangkan telur bebek Rp 1.300 per butir serta telur ayam kampung Rp.1.250 per butir. Sementara, harga beras lokal jenis Sibatubara Rp5.500 per kg, IR 64 Rp5.800 per kg dan C4 Rp 6.000 per kg.(a24)

IRT Hamil 9 Bulan Tewas Mencurigakan P.SIDIMPUAN (Waspada): Ibu rumah tangga (IRT) Marlina Br. Zebua yang hamil 9 sembilan bulan, warga Dusun Sopo Onggano, Desa KUD Langkimat, Kec. Simangambat, Kab. Padanglawas Utara, tewas bersimbah darah di samping rumahnya. Motif kematian korban hingga kini belum diketahui, namun ditemukan 13 tusukan benda tajam di sekujur tubuhnya. Kemudian pada kepala bagian belakang pecah akibat benturan benda tumpul. Abang suami korban (ipar korban) Tali Faudu Gulo dan Faozanolo Gulo menuturkan itu kepada wartawan, di Padangsidimpuan, Rabu (19/8) malam. Kata mereka, saat kejadian, Kamis (13/8), suami korban Yapaogo Gulo sedang bekerja. Diceritakan, saat kejadian itu Marlina yang hamil 9 bulan sedang menunggu waktu untuk melahirkan. Selama ini mereka tingal di kebun sawit milik pengusaha tempat mereka bekerja. Tapi karena sudah mendekati hari akan melahirkan, maka sudah tiga malam terakhir Marlina bersama suami dan anak-

nya tidur di rumah Faozanolo Gulo. Pasalnya, lingkungan tempat tinggal mereka sangat sepi dan takut bila melahirkan tidak ada yang menolong. Sementara, setiap paginya mereka berangkat lagi ke rumahnya di kebun dan malamnya kembali ke rumah Faozanolo Gulo. Kamis (13/8), Marlina bersama seorang anaknya berumur 3 tahun diantar sang suami ke rumah mereka di kebun. Selanjutnya Yafaogo Gulo pergi berkerja memanen sawit di kebun tokenya. Sedangkan istri dan anaknya tinggal berdua di rumah. Sekira pukul 15:00, usai memanen dan memuat sawit ke truk, Yafaogo Gulo kembali ke rumah. Namun dia sangat terkejut, karena begitu tiba di samping rumah, istrinya tewas bersimbah darah. Yafaogo menemui abangnya Tali Faudu Gulo dan memberitahukan tewasnya Marlina dalam kondisi menggenaskan, sedangkan anak mereka berusia 3 tahun berada dalam rumah. Mereka melaporkan kejadian itu ke Pos Polisi Simangam-

bat dan kemudian anggota pos turun ke tempat kejadian perkara (TKP) dan disusul anggota Polsek Binanga. Setelah melakukan olah TKP, jasad korban dimandikan dan ketika itu ditemukan 13 luka tusukan benda tajam di sekujur tubuh korban. Yakni, di bagian perut, leher, kepala dan organ tubuh lainnya. Mayat korban disemayamkan di rumah abang iparnya Faozanolo Gulo, dan atas seizin polisi mayat dikebumikan. Polsek Binanga sudah memintai keterangan 9 warga desa, Yafaogo Gulo (suami korban), Faozanolo Gulo, Anes Marpaung, Sinurat, Faozisokhi, Faogo Sokhi , Marpaung dan istrinya Br Siahaan dan Amawati Bulolo. Sementara, Kapolres Tapsel AKBP Pranyoto Harahap ketika dikonfirmasi, membenarkan. Saat ini pihaknya sedang berusaha mengungkap motif kejadian dan mencari identitas pelaku. Pranyoto mengimbau mengharapkan masyarakat tetap tenang dan segera melapor ke polisi apabila menemukan tanda-tanda mencurigakan. (a20)

Jelang Ramadhan

Peziarah Ramaikan Pekuburan Di Madina PANYABUNGAN (Waspada) : Tradisi menjelang bulan suci Ramadhan, pemakaman umum di Kab. Mandailing Natal ramai didatangi peziarah. Tidak mengherankan, menjelang pelaksanaan ibadah puasa Ramadhan jumlah peziarah ke Tempat Pemakaman Umum ( TPU ) meningkat. “ Ziarah kubur sudah mentradisi,” ujar Alpin Lubis di TPU di Kec. Kotanopan, Kamis ( 20/8). Menurutnya, pemakaman umum di berbagai desa sejak seminggu lalu sudah mulai dipadati peziarah dari berbagai penjuru, termasuk perantauan. Makam-makam yang tidak

pernah dikunjungi dan dirawat selain kotor dan ditumbuhi tumbuhan liar, juga nama pada batu nisan tidak terbaca. Seorang peziarah, Hasan dari Kota Medan kepada Waspada di Kota Panyabungan, Rabu (19/8) menuturkan, ziarah sarana bagi keluarga besarnya mengenalkan dan mengingatkan anak dan cucu pada kampung halaman dan kuburan kakek. “Ziarah menjelang Ramadhan dan Lebaran mengingatkan anak-anak, cucu-cucu, ada kuburan kakeknya di kampung,” ujarnya. Ia juga mengaku tidak hanya

menjelang Ramadhan dan saat hari Lebaran saja dia dan keluarga melakukan ziarah kubur. Seperti biasa, pembersihan TPU dilaksanakan masyarakat secara gotong-royong, sehingga peziarah tidak lagi perlu membersihkannya lagi. Menjelang Ramadhan, pekuburan umum desa ini kami bersihkan dengan gotong royong, sehingga peziarah dari berbagai penjuru tidak perlu lagi membersihkannya ,” ucap Zulkarnein Rambe salah seorang tokoh pemuda di Mompang, Kec. Panyabungan Utara. (a24)

DPRD Palas Yang Baru Dilantik Dapat PR SIBUHUAN ( Waspada): Massa aliansi Koalisi Mahasiswa dan Pemuda Padanglawas (KOMPAS) memberi PR kepada DPRD Kab. Padanglawas yang baru dilantik, terkait keberadaan PT SSL dan PT SRL yang diduga dalam operasinya mengandung unsur KKN. Koordinator Aksi Abdul Rahman daulay didampingi Sekretaris Syahruddin Daulay, Rabu (19/8) ketika melakukan demo di depan gedung DPRD Palas menyampaikan aspirasi, dan ketegasan pihak legislatif dan eksekutif terkait keberadaan PT SSL dan PT SRL. Menyusul kedua perusahaan raksasa yang bergerak di bidang pengelolaan hutan yang berada di wilayah Palas itu telah membuat keresahan bagi masyarakat kecil, seperti petani penggarap. Bahkan tidak sedikit petani yang lahan garapannya diserobot dan dikuasi perusahaan raksasa itu. Untuk itu massa KOMPAS meminta ketegasan pihak Pemerintah Padanglawas, DPRD bersama panitia khusus (Pansus) untuk menangani masalah keberadaan kedua perusahaan raksasa itu agar ditinjau kembali dan selanjutnya mencabut izinnya demi masa depan generasi masyarakat Padanglawas.

Padanglawas (DPP HIMPAS) Medan, Forum Pemuda dan Mahasiswa (FPM) Padanglawas, Ikatan Mahasiswa Padanglawas (IMA PALAS), Ikatan Mahasiswa dan Pemuda Padanglawas (IMPEDAS), Organisasi Pemuda Ngerap, Ikatan Pemuda, Pelajar dan Mahasiswa (IPEPMA) Padanglawas. Bupati dan Wakil Bupati H. Ali Sutan Harahap didampingi Sekdakab Drs. H. Syahrul Mulia Harahap, SH. MSi bersama Asisten II Kessos dan Ekbang, Drs. H. Gusnar Hasibuan serta Kadis Kehutanan, Ir. Soleman Harahap menyambut positif tuntutan massa KOMPAS. Dikatakan Sekdakab, pada intinya pemerintah daerah menyambut baik massa KOMPAS

dan akan menindaklanjutinya segera, termasuk melakukan musyawarah bersama tim Pansus. Kapolres Tapasel AKBP Drs. H. Pranyoto Harahap melalui Kapolsek Barumun AKP H. Herwansyah Putra kepada Waspada membenarkan adanya unjukrasa massa aliansi KOMPAS. Sementara DPRD Kabupaten Padang Lawas yang baru hari pertama kerja menyatakan kesiapan untuk memperjuangkan harapan dan keinginan masyarakat Padang Lawas yang disampaikan oleh aliansi massa KOMPAS. Massa pengunjukrasa disambut Ketua DPRD sementara H. Muhammad Rido Harahap bersama anggota dewan lainnya. (a32/crif)

21

Sumatera Utara

22 Panitia Pengadaan Barang Dan Jasa Diadukan RANTAUPRAPAT (Waspada): Panitia pengadaan barang dan jasa pada UPT Kualuh Barumun Dinas Pengelolaan Sumber Daya Air Sumatera Utara (PSDA) Tahun Anggaran 2009 dilaporkan ke penegak hukum. Pengaduan disampaikan Direktur UD Ayahanda H.Daiyat Nasution lewat surat tertanggal 18 Agustus 2009. Direktur UD Ayahanda menilai, proses tender pada instansi tersebut cacat hukum. Surat pengaduan dikirimkan kepada Kepala Kejaksaan Agung, Ketua KPK, Ketua KPPU, Gubernur Sumatera Utara, DPRD SU, Kejatisu, Kapoldasu, Kejari Rantauprapat dan Kapolres Labuhanbatu.

Dalam surat diuraikan, pengumuman lelang di media massa tidak sesuai dengan proyek yang tercantum dalam buku APBD TA 2009. Kemudian, panitia dinilai telah melanggar Peraturan Gubernur Tahun 2009. Dalam Pergub dicantumkan panitia harus melibatkan kepanitiaan daerah dan kenyataan kepanitiaan daerah tak dilibatkan. Karena itu, proses pelelangan itu harus diulang karena cacat hukum. H. Daiyat Nasution kepada Waspada, Rabu ( 19/8 ) mengatakan, tender ptoyek mesti diulang karena cacat hukum. Alasannya, proyek pelelangan di media massa tidak sesuai dengan daftar proyek yang tercan-

tum dalam APBD. Contohnya, dalam pengumuman di surat kabar disebutkan tanggul putus 2.500 meter, sedangkan dalam buku APBD tertulis peninggian 2.500 meter dan tanggul putus 50 m. ‘’Selain itu, seluruh penawaran yang dimenangkan bukan penawaran yang dibuat pemborong, melainkan yang dibuat oknum Dinas PSDA Sumut, dan saya bisa membuktikannya,’’ tegas Nasution . Ketua Panitia Pengadaan Barang dan Jasa UPT Kualuh Barumun Dinas PSDA Sumut Sinar Panggabean dan Kepala UPT Dinsyah Sitompul ketika dikonfirmasi, Rabu ( 19/8 ) tidak ketemu.(a26)

Tim Dakwah Evendi Ritonga Bersama Masyarakat Peringati Isra’ Mikraj KOTAPINANG (Waspada): Tim safari dakwah Drs.Evendi Ritonga, M.Pd, bersama masyarakat mengadakan peringatan Isra’ Mikraj Nabi Besar Muhammad SAW, sekaligus menyambut bulan suci Ramadhan, Minggu malam (16/8) di halaman Masjid Al- Furqon, Dusun Karangsari, Desa Sisumut, Kecamatan Kotapinang Labuhanbatu Selatan. Pantauan Waspada, tim datang dari Medan yakni Bangkit R, Syafwin Rambe S.Pd, ustaz H. Sutan Syahrir Dalimunthe, S.Ag sebagai penceramah. Malam itu kendati disiram hujan namun warga tetap tidak beranjak dari tempat duduknya, tekun mendengarkan siraman rohani dari ustadz Syahrir Dalimunthe yang juga merupakan al-hafiz (Penghafal Quran). Tampak hadir tokoh agama dari rumah suluk Desa Sisumut Khalifah Abd.Wahab Harahap, Khalifah Mhd.Basir/ Suroto, Da’i Mulkan Nasution, Kepala Desa Sisumut Idarsyah Harahap.

Ustadz Syahrir mengatakan, ada dua hal yang dikhawatirkan Nabi Muhammad SAW kepada umatnya nanti yakni: apabila umatku mendapat kemewahan, dia akan lupa kepada Allah SWT, karena asik dengan urusan dunia. Kemudian Rasul khawatir nanti yang mempelajari Kitab suci Al Quran itu bukan umat Islam saja tetapi umat non muslim. Hal ini kemungkinan sudah terjadi ucap ustaz, karena sudah banyak muslim Indonesia yang belajar pendidikan agama Islam ke Kanada, belajar Al Quran kepada guru yang bukan beragama Islam, katanya. Menurut Syahrir, di Labusel ini ditinjau dari segi ekonomi cukup lumayan, sebagai indikator ditandai dengan banyaknya jumlah jemaah haji setiap tahun. Tetapi kalau kita tinjau dari segi pendidikan, Kab Labusel masih ketinggalan dibanding dari daerah lain. Justru itu dalam memilih pemimpin saat Pilkada tahun 2010 nanti, pilihlah pemimpin

yang punya visi dan misi membangun pendidikan serta sosok yang sudah piawi pula dibidang pendidikan, katanya. Kepada Waspada, khalifah Mhd.Basir/Suroto minta kepada Drs.Evendi Ritonga M.Pd, agar mencalonkan diri pada Pilkada 2010 di Kab Labusel. Menurutnya sosok Evendi Ritonga, tidak diragukan lagi kepiawaiannya untuk membangun pendidikan. Evendi Ritonga dipandang punya segudang pengalaman dibidang pendidikan. Selain dia putra Labuhanbatu, dia juga sudah lama mengabdi di bidang pendidikan di Unimed, dan sudah menyandang gelar Magister Pendidikan. Menurut Suroto, sosok Evendi Ritonga mudah tanggap terhadap aspirasi masyarakat dia selalu bantu kaum duafa, peduli dengan syiar agama dan lagi pula masih energik.’’ Kami siap mendukung Evendi Ritonga,’’ tegasnya. (c05)

Waspada/Ist

25 TAHUN MENGABDI: Syahrul Aman Siregar dan sejumlah karyawan PTPN4 lainnya memperoleh penghargaan atas pengabdian dan prestasinya dari Dirut PTPN4 Ir H Dahlan Harahap, MSc dalam satu upacara sekaligus memeriahkan HUT ke-64 Kemerdekaan RI di lapangan Bah Jambi, Simalungun. Tampak dalam foto Syahrul menerima ucapan selamat dari sang Dirut atas 25 tahun pengabdiannya di PTPN4.

Melihat HUT RI Di Perusahaan Asing HUJAN yang mengguyur di pagi hari, membuat kawasan ini bertambah segar. Udara menjadi sejuk. Tak membuat tubuh jadi gerah. Tidak ada debu yang beterbangan. Namun cuaca cerah. Sang surya tetap memancarkan sinarnya. Hujan di pagi itu dirasakan benar-benar membawa rahmat bagi kawasan emplasmen PT Socfindo Kebun Tanah Gambus Kecamatan Limapuluh, Batubara. Walau hujan tadi sempat membuat panitia deg-degan dan sedikit cemas. Pasalnya hari itu bertepatan dengan 17 Agustus, hari keramat bagi negeri ini. HUT Kemerdekaan RI. Hujannya hanya berlangsung sekira satu jam. Pada pukul 07:30 hujan berhenti. Pagi Senin (17/8) itu suasana Lapangan Emplasmen Kebun Tanah Gambus memang tidak seperti biasa. Sejak pukul delapan, ribuan orang mulai numplek ke sini. Gemuruh suara drum band pun menggema memecah keheningan komplek perumahan karyawan Perkebunan PT Socfindo ini. Rentak langkah dan irama drum band yang dimainkan pelajar SD Negeri Tanah Gambus asuhan Kepala Sekolah, Eldawati, itupun ikut memeriahkan suasana. Manajemen PT. Socfindo Kebun Tanah Gambus memang sudah mempersiapkan rangkaian kegiatan dalam rangka puncak acara menyambut dan memeriahkan HUT RI ke 64 ini.

Acara berlangsung satu hari penuh. Dari pagi hingga sore harinya. Mulai dari upacara bendera memperingati detikdetik proklmasi 17 Agustus, perlombaan permainan rakyat, bazar kuliner hingga lucky draw bagi pengunjung stand bazar. Ketua panitia pelaksana H. Samali di sela-sela acara kepada Waspada menuturkan, sebelum acara puncak hari ini, berbagai kegiatan lain memeriahkan HUT RI ini sudah dilaksanakan. Mulai dua pekan lalu kita sudah gelar kegiatan perlombaan antar karyawan, Di antaranya cabang bolavoli, badminton, bola kasti, trup gembira, bayi sehat, rumah dan penitipan bayi indah. Kemudian domino batu dan tenis lapangan antar staf. Perlombaan diikuti karyawan dari empat afdeling dan pabrik yang dimiliki perusahaan kebun ini. Penyerahan hadiah pada pemenangnya dilaksanakan hari ini, ujar Samali yang juga manajer pabrik kebun Tanah Gambus ini didampingi unsur panitia lain Aprianto dan Iskandar. Sementara itu Pengurus Kebun Tanah Gambus H. Danang Bayu S mengatakan, pelaksanaan bazar kali ini lebih meriah dibanding tahun lalu. Kini diikuti 13 stand. Selain Karyawan Tanah Gambus sendiri, juga diikuti peserta dari desa sekitar kebun yang diwakili PKKnya. Di antaranya Perkebunan Limapuluh, Tanah Itam Ulu, Simpang Gambus dan Limapuluh. Upacara detik-detik proklamasi pun digelar. Diikuti seribuan peserta. Terdiri dari pelajar, staf, karyawan beserta keluarga. Bertindak sebagai inspektur upacara Danang Bayu S, orang nomor satu di kebun ini. Upa-

cara berlangsung khidmat. Para peserta dengan tekun mengikuti detik-demi detik jalannya upacara. Suasana sontak berubah, tatkala upacara usai. Dari khidmat menjadi penuh kegembiraan. Peserta upacara dan warga lain membaur satu sama lain. Berbagai lomba permainan rakyat digelar. Ada tarik tambang, lari karung, lari kelereng, lari balon, memindahkan ikan belut dan lainnya. Baik antar anak-anak maupun karyawan dan keluarga. Tak kalah meriahnya, suasana pada stand bazar yang terletak di sisi kanan lapangan. Ratusan warga memadati 13 stand yang ada. Berbagai hidangan makanan dan minuman tersedia disini. Antrian panjang terlihat pada setiap stand. Mereka yang belum sempat sarapan, atau haus usai upacara dan perlombaan dapat memanjakan tenggorokan disini. Semua berbaur dalam kegembiraan. Tak terlihat perbedaan status disini. Danang, sebagai orang pertama di Kebun PMA Belgia ini terlihat akrab dengan semua staf dan karyawannya. Ia keliling dari satu stand ke stan lain, dari satu perlombaan ke perlombaan lain. Sekali-sekali ia memberikan petunjuk dan masukan ke orangorang di sana. Begitulah terlihat akrabnya warga Kebun yang memiliki 900 lebih staf dan karyawan ini atau sekira 4.000-an jiwa bersama keluarganya. Setidaknya terlihat pada perayaan HUT RI ke 64 ini. “Ini lebih meriah dibanding Hari Raya pak”, komentar salah seorang karyawan kepada Waspada. Sahril

WASPADA Jumat 21 Agustus 2009

Pj. Bupati Labusel Ajak Warga Peduli Keamanan Lingkungan KOTAPINANG(Waspada): Mengisi kemerdekaan yang di harapkanpendiribangsasehingga tujuan kemerdekaan itu dapat di rasakan ini menjadi tanggung jawab yang harus dilakukan. Walau tanpa diminta, kita wajib me-

laksanakan tuntutan itu. Salah satunya peduli terhadap keamanan lingkungan. Demikian ungkapan yang disampaikan Pj. Bupati Labusel Ir. Hj. R. Sabrina pada malam syukuran dalam peringatan hari

Kemerdekaan, Senin (17/8) bertempat di rumah dinas bupati Labusel.”Keamanan sangatlah penting dijaga, kita mulai dari lingkungan sendiri dan akan menjadi tolok ukur rasa kepedulian termasuk tanggung jawab,”

terang Sabrina. Penjabat Bupati labusel juga memaparkan kondisi wilayah yang baru di mekarkan itu. Sebagaipenjabatbupatituntutanyang harus di laksanakan tugas penting. Salah satunya menambah

tenaga PNS yang masih sangat jauh dari kekurangan.Pemkab Labusel hanya memiliki sekitar 102tenagaPNS,semestinyatenaga itu berkisar 1000 lebih, tapi semua proses penambahan sudah di ajukankepemerintahpusat. (c01)

PARIWARA

23

Sumatera Utara

WASPADA Jumat 21 Agustus 2009

Per ertamina Kok P er tamina Ya Yang Ngurusi Petani Ngur usi P etani? Petani SIMPATI Panen Raya Ala Pertamina Milik Rakyat MENGAPA harus PT Pertamina dan apa hubungan Pertamina dengan petani, lalu mengapa tidak semua Badan Usaha Milik Negara gencar melakukan program ekonomi kerakyatan yang sangat menyentuh langsung dengan kepentingan masyarakat ekonomi lemah. Jika semua BUMN melakukan program seperti PT Pertamina, bukan mustahil perekonomian masyarakat yang berbasis dari UKM bahkan pertanian akan terus bangkit dan bermuara pada tingkat kesejahteraan masyarakat. Rasa penasaran dengan sejumlah pertanyaan ‘mengapa’ inipun dijawab Manajer Pemasaran BBM Retail Region I. “Bukan hal yang aneh kalau PT Pertamina bersentuhan langsung dengan masyarakat, terutama dalam mendongkrak perekonomian masyarakat.

“Pertamina Milik Rakyat” Suhermanto, Manajer Pemasaran BBM Retail Region I. PT Pertamina adalah milik rakyat, dan sudah sepantasnya PT Pertamina harus peduli dengan rakyat,” demikian Suhermanto dalam acara panen raya petani Desa Suka Beras, Kecamatan Perbaungan, Serdang Bedagai bersama PT Pertamina, Minggu (16/8). PT Pertamina adalah stakeholder nya pemerintah, sehingga apa yang dilakukan PT Pertamina harus benar-benar bisa memberikan arti penting bagi masyarakat di sekitar wilayah kerja PT Pertamina. “Pertamina bukan hanya mengurus minyak saja, namun semua sektor usaha bisa

dibantu Pertamina, sepanjang usaha yang dibantu benarbenar ditekuni dan bukan hanya sekedar hanya mendapat bantuan pinjaman, namun penggunaannya tidak tepat sasaran,” katanya. Seperti halnya masalah pertanian, ini merupakan hal yang harus diperhatikan PT Pertamina. Karena, di antara program yang ada di PT Pertamina salah satunya adalah peningkatan sektor pangan, yang sudah barang tentu bernuansa pada pertanian yang dikelola para petani. Jadi, panen raya yang dila-

kukan di Desa Suka Beras, Kecamatan Perbaungan, Serdang Bedagai, merupakan program PT Pertamina. Para petani di Desa Suka Beras yang tergabung dalam wadah SIMPATI (sentra informasi masyarakat dan petani) binaan PKBL Region I PT Pertamina. “Ini cukup membahagiakan kami (PT Pertamina), karena para petani di Desa Suka Beras telah membuktikan ketekunan dalam mengelola tanaman padi, sehingga apa yang diharapkan sesuai dengan keinginan untuk mencapai hasil panen yang memuaskan,” katanya. Dia berharap, ke depan petani Desa Suka Deras terus meningkatkan hasil panen padi. Jika saat ini panen raya menghasilkan 9 ton padi, di masa mendatang bukan mustahil akan mencapai puluhan ton hasil panen. Kuncinya, kata Suhermanto, petani harus lebih giat lagi dalam menyiasati hal-hal yang akan dilakukan dalam peningkatan mutu tanaman.“Yakinlah, jika petani telah menunjukkan hasil yang terbaik, Pertamina tetap terus memberikan ban-

PANEN RAYA: Dari kanan Asisten Manejer Program Kemitraan Korporta Pusat, Aminuddin, Manajer Pemasaran BBM Retail Region I Suhermanto, Plt Sekdakab Sergai, Haris Fadillah, Wakil Bupati Sergai, Soekirman, Gubsu Syamsul Arifin dan Bupati Sergai, HT Erry Nuradi, saat panen raya di Desa Suka Beras, Serdang Bedagai, Minggu (16/8). tuan pinjaman, sesuai dengan prosedur yang akan dipenuhi.” Seperti halnya pengembalian pinjaman dengan tepat waktu, karena pinjaman yang diberikan merupakan dana bergulir, yang sudah pasti masih banyak petani lainnya berharap akan mendapat bantuan pinjaman dari Pertamina.

Artinya, dengan tepat waktu pengembalian, maka petani lain yang mengajukan bantuan bisa mendapat pinjaman serupa, sehingga semua para petani bisa tertolong. Selanjutnya akan menghasilkan panen yang memadai, seperti halnya yang dilakukan para petani di Desa Suka Beras.

Sebagai perpanjang tangan pemerintah, PT Pertamina pun tak jemu-jemunya mengajak seluruh masyarakat untuk tetap mencintai produk dalam negeri, terutama produk-produk PT Pertamina. “Cintai produk dalam negeri, mari seluruh masyarakat Indonesia agar tidak jadi penon-

Selain Lihai Menanam Padi, Petani Juga Harus Bisa Menanam Kepercayaan

PUNYA PROGRAM SAMA:

Gubsu Syamsul Arifin diapit Bupati Sergai, HT Erry Nuradi dan Manajer Pemasaran BBM Ritail Region I, Suhermanto, serius membicarakan program ketahanan pangan pada acara panen raya di Desa Suka Beras.

Gubsu Takjub:

PT Pertamina, Pemprovsu Dan Pemkab Sergai Punya Program Yang Sama dalam Peningkatan Pangan SEJUKNYAhembusananginterasamenyusuk pori-pori ratusan orang yang sudah berkumpul di lintasan jalan perkampungan Suka Beras, Perbaungan, Serdang Bedagai, Minggu pagi . Jam di tangan menunjukkan pukul 09:00, serpihak air mulai turun dari langit. Kegelisahan pastiada,kononlagitiupananginsemakinkencang dan apalagi tak ada istilah kompromi, guyuran hujan bagai menuang air satu ember ke dalam lubang semut. SemuapanitiayangtergabungdariPTPermina Region I dan ratusan petani yang tergabung dalam SIMPATI mulai kelimpungan membenahi tataan kursi yang semula sudah tersusun rapi, kini harus kuyup tersiram hujan. “Ini rahmad Allah,” kata Koordinator PKBL Region I, OK. Khaidar Aswan. Pakaian form PT Pertamina yang dikenakannya sudah sudah melekat di badannya akibat tempekan air yang membasahi tubuhnya. Apalagi ketua panitia, Akhiruddin, yang juga Asisten Manajer Program Bina Lingkungan Regional I, mau tidak mau harus berhadapan dengan kubangan tanah yang sudah membubur akibat teraduk air hujan. Waktu terus bergulir, waktu sudah menunjukkan pukul 11:00, hujan mulai reda.Wajah-wajah yang tadinya menyimpan kegalauan, kini sedikit mulai terlihat mengumbar senyum. Semua perkakas termasuk kursi dan meja yang tadinya basah mulai diseka dan disusun kembali sebagaimana mestinya. Dari jauh suara serunai sayup terdengar. Para panitia mulai sontak dan terus melakukan perapian untuk menyambut tamu yang sudah terlihat di pelupuk mata. “Alamak hujan, macam mana mau dibuat udak kehendak Allah,” kata Bang Syamsul Arifin, Gubernur Sumatera Utara saat turun dari dalam mobilnya bersama rombongan Bupati Serdang Bedagai, HT. Erry Nuradi dan Wakil Soekirman, yang langsung sigap mengenakan sepatu boat karet yang lazim digunakan para petani. Sekelompok kaum ibu pun riang menabuh rebana sebagai arakan menyambut Gubernur masuk ke dalam tenda pertanda acara yang sejak tadi tertunda akibat guyuran hujan, kini pun sudah bisa dimulai. Takjub Kakinya tak sungkan lagi berjalan di atas tanah yang berlumpur menuju panggung saat dirinya dipanggil menyampaikan sambutan kepada ratusan petani dan warga Desa Suka Beras yang sudah berduyun dan mengelilingi tenda dan areal persawahan. “Ini menakjubkan,” kata Syamsul Arifin memulai sambutannya. Meski hujan deras dan angin kencang, tenda-tenda masih tetap berdiri, dan masyarakat masih antusias dan setia untuk berkumpul menyaksikan acara panen raya yang dilaksanakan PT Pertamina bekerjasama dengan Pemerintah Kabupaten Serdang Bedagai dan para petani SIMPATI Serdang Bedagai. “Salut kepada petani dan PT Pertamina begitu juga dengan pemerintahan Serdang Bedagai,” tandasnya seraya menyatakan suasana keakraban seperti harus dibina dan terus dipupuk, sehingga hubungan emosional antara rakyat dengan pemerintah semakin erat. Gubernur berkeyakinan, Pertamina tidak salah pilih membina para petani di Serdang Bedagai, karena daerah itu merupakan daerah swasembada beras di Sumatera Utara, sehingga bantuan

pinjaman yang diberikan PT Pertamina benarbenar tepat sasaran. “Ini yang kita mau,” katanya. Dia meminta petani harus berterima kasih kepada PT Pertamina salahsatu BUMN di negara ini yang sudah membuktikan kalau PT Pertamina benarbenar milik rakyat. Terlebih lagi, apa yang dilakukan PT Pertamina Region I merupakan implementasi program Gubernur Sumatera Utara “rakyat tidak lapar”. “Ini sejalan dengan program kita (Pemerintah Provinsi Sumut-red) dan begitu sejalannya dengan program pemerintah Serdang Bedagai dalam peningkatan lahan pertanian, dan ini harus terus dilakukan PT Pertamina,” ungkap Bupati Langkat dua priode itu. Di hadapan para petani, Gubernur, mengatakan, jika semua BUMN seperti PT Pertamina. “Saya yakin masyarakat petani akan terus terbantu, hingga akhirnya akan masuk kedalam pola hidup yang memadai termasuk dalam perbaikan ekonomi,” terangnya. DemikianjugakepadaPemerintahKabupaten Serdang Bedagai agar terus menyahuti program PT Pertamina yang menitik beratkan di sektor pertanian. Serdang Bedagai harus berterima kasih kepada PT Pertamina yang sudah menaruh perhatian di sektor peningkatan pangan kepada warga Desa Suka Beras, yang nantinya diharapkan menyusul desa-desa lainnya di Serdang Besagai. Sejalan dengan program PT Pertamina ini, kiranya pemerintah daerah harus lebih memperhatikan daerah-daerah lumbung pertanian, seperti halnya menjadikan lahan yang tidak produktif menjadi produktif, yang tujuannya akan meningkatkan produksi beras di Serdang Bedagai, umumnya secara nasional. Kalau pada panen raya kali ini di Desa Suka Berasmenghasilkanlebihkurang9ton,diharapkan ke depan petani bisa meningkatkan hasil panen hingga 12 ton per hektare dan Serdang Bedagai bisa mempertahankan daerah swasembada beras di Sumatera Utara. Jika hasil panen padi petani terus meningkat, Gubernur berkeyakinan para petani pun akan menjadi pahlawan dalam menghadapi krisis pangandiIndonesia.Kuncinya,petaniharusbenarbenar memahami hal-hal apa yang dilakukan dalam pola tanam, sehingga hasil panen sesuai apa yang diharapkan. “Saya sudah sering memenuhi undangan kegiatan yang dilakukan PT Pertamina, jadi sedikit tahu program-program PT Pertamina dalam bina lingkungan,” kata Gubsu. Dia juga meminta PT Pertamina bukan sekedar memberikan bantuan pinjaman, namun juga memberikan ilmu pengetahuan kepada binaannya, termasuk memberikan pelatihan dalam peningkatan SDM para binaannya. “Dan ini yang membuat saya salut kepada PT Pertamina,” kata Gubernur yang kini bergelar Dato’Seri Lelawangsa Hidayatullah sembari mengacungkan jempol. Menurutnya, PT Pertamina terus gencar melaksanakan programnya bahkan memperhatikan sejauhmana sumber daya manusiadalammengelolabantuanyangdiberikan kepada masyarakat. Bila perlu, PT Pertamina juga harus mengenal jenis-jenis pupuk apa yang sangat membantu pertumbuhan tanaman padi, atau PT Pertamina terus melakukan kerjasama dengan para ahli pertanian, sehingga apa yang harus diberikan kepada petani, PT Pertamina pun sudah memahaminya, terang Gubsu. ***

“SELAIN lihai menanam padi, petani juga harus menanam kepercayaan yang sudah diberikan PT Pertamina.” Kata Bupati Serdang Bedagai, Erry Nuradi pada acara panen raya petani yang tergabung dalam SIMPATI binaan PKBL Region I PT Pertamina, Minggu, (16/8) di Desa Suka Beras, Perbaungan, Serdang Bedagai. Perhatian PT Pertamina terhadap petani Serdang Bedagai merupakan atensi yang cukup berarti bagi Pemkab setempat, terutama dalam memberikan rangsangan bagi petani lainnya untuk mau terus bersaing dalam meningkatkan hasil di setiap musim panen. Bagi Pemkab Serdang Bedagai, kehadiran PT Pertamina bukan hanya di sektor pertanian, bahkan beberapa bulan yang lalu, Koordinator PKBL Region I, OK Khaidar Aswan bersama Akhiruddin, Asisten Program Bina Lingkungan juga sudah mensurvei lokasi objek wisata di Sialang Buah, Serdang Bedagai. “Mudah-mudahan perhatian PT Pertamina terhadap petani dan nelayan bisa memberikan motivasi untuk meningkatkan sektor-sektor yang ada di Serdang Bedagai,” kata Bupati

yang pada bulan Agustus ini memperoleh Satya Lencana Melati dalam bidang kepramukaan dan Satya Lencana Wira Karya untuk bidang keberhasilan pembangunan pendidikan, kesehatan dan pertanian. Bupati berterima kasih kepada PT Pertamina yang sudah berperan untuk meningkat hasil pertanian di Serdang Bedagai. Dan kepada petani Suka Beras, umumnya petani di Serdang Bedagai agar tetap menjaga kemitraan terutama dalam menjaga kepercayaan yang sudah diberikan PT Pertamina. Kiranya perhatian Pertamina ini bisa mempertahankan Serdang Bedagai sebagai salah satu daerah penghasil terbesar dan lumbung beras di Provinsi Sumatera Utara, karena dari angka sementara (asem) pada tahun 2007 produksi beras yang dihasilkan daerah ini mencapai 214.035 ton dan swasembada atau surplus sekitar 128.660 ton. Produksi beras yang dihasilkan Sergai harus dapat dipertahankan bahkan ditingkatkan para petani di daerah ini. Pemkab Sergai telah menetapkan sektor pertanian sebagai salah satu prioritas pembangunan disamping sektor lainnya seperti pendidikan, pariwisata dan industri.

Dikemukakan, upaya peningkatan produksi padi dalam rangka mempertahankan swasembada beras di Sergai dan untuk meningkatkan ketahanan pangan masyarakat dapat dilakukan melalui perluasan areal tanam. Apa yang disampaikan Gubernur Sumatera Utara dalam memproduktifkan lahan yang tidak produktif, Pemkab Sergai terus berupaya melakukan perluasan areal tanam dilakukan melalui peningkatan intensitas pertanaman dengan perbaikan jaringan irigasi, sedangkan peningkatan produktivitasnya dapat dilakukan melalui penerapan teknologi seperti penggunaan benih unggul, penggunaan pupuk berimbang, pengaturan penggunaan air, pengendalian hama secara terpadu dan perbaikan pasca panen. Untuk mencapai itu semua, maka perlu dukungan dan kerjasama nyata antara para petani, pemerintah daerah, pemerintah pusat dan para stakeholder. Untuk melindungi petani sebagai produsen padi Pemkab Sergai berupaya mendukung perbaikan jaringan irigasi, penggunaan sarana transportasi, menjamin tersedianya saprodi termasuk menyediakan tenaga penyuluh lapangan, ujarnya.

Diungkapkan Erry, Sergai dengan luas lahan sawahnya 39.091 hektare terdiri dari 32.666 sawah beririgasi dan 6.425 non irigasi, merupakan potensi yang cukup besar dalam meningkatkan kesejahteraan masyarakat terutama petani. Dari luas areal sawah itu, bila dimanfaatkan 2 musim tanam setahun dan dalam satu hektare menghasilkan 5 ton maka produksi padi yang dihasilkan dari Sergai mencapai sekira 390 ribu ton, dan produksi ini minimal harus dipertahankan dalam menyangga ketersediaan pangan dari daerah ini, tegas Bupati. Namun Bupati juga berharap selain menunggu ketersediaan pasokan pupuk bersubsidi, kepada petani diminta dapat membuat dan menggunakan kompos atau pupuk organik yang bahan bakunya dapat diperoleh di sekitar lahan pertaniannya. “Bahkan saya sudah mengetahui, beberapa bulan yang lalu, PKBL Pertamina Region I sudah melatih petani di Serdang Bedagai. Jika ada pelatihan berikutnya, seluruh petani Sergai kiranya dapat mengikuti pelatihan,” demikian Serdang Bedagai HT Erry Nuradi. ****

ton dalam negeri sendiri,” demikian Manejer Pemasaran BBM Retail Region I, Suhermanto di hadapan Gubernur Sumatera H. Syamsul Arifin, Bupati dan Wakil Bupati Serdang Bedagai, HT. Erry Nuradi, Soekirman serta Plt Sekdakab Sergai Harris Fadillah pada acara panen raya. **** Bupati Serdang Bedagai, HT Erry Nuradi

“Petani harus bisa menanam kepercayaan.”

Jika Petani Sudah Membuktikan, PKBL Pun Tingkatkan Perhatian “KITA akan terus berupaya meningkatkan mutu pelayanan, terutama dalam memberikan bantuan pinjaman kepada masyarakat yang berdomisili di wilayah kerja PKBL Region I PT Pertamina.” Demikian Koordinator PKBL Region I PT Pertamina, OK Khaidar Aswan, seusai panen raya, Minggu(16/8)diDesaSukaBeras, Perbaungan, Serdang Bedagai. Terpenting, katanya, semua para mitra binaan mengikuti aturan main, sehingga apa yang diberikan betul-betul bermanfaat bagi masyarakat, sehingga sesuai apa yang diharapkan PKBL dalam program bina lingkungan. Ditambahkan, sektor pertanian merupakan program PT Pertamina sebagaimana yang tertuang dalam Meneg BUMN, tentang ketahanan pangan. “Jadi jangankagetkalauPertaminaberkomunitas dengan para petani,” katanya. Disinggung masalah panen raya di Serdang Bedagai, Khaidar, mengatakan, jauh sebelumnya kegiatan ini sudah dikoordinasikan dengan pihak petani dan Pemerintah Kabupaten Serdang Bedagai. Bukan hanya di Serdang Be-

Koordinator PKBL Region I PT Pertamina, OK Khaidar Aswan dagai, PKBL Region I Juga mempunyai kelompok petani binaan di Kabupaten Deli Serdang. Diharapkannya, semua petani binaan agar mampu menunjukkan arti kehadiran PT Pertamina bagi petani. Sejauh ini PKBL Region I PT Pertamina terus gencar melakukan program yang berhubungan langsung dengan masyarakat usaha kecil menengah, petani, maupun home industri lainnya. “Jalannya program ini tidak semata-mata tergantung pada PT Pertamina, namun ma-

syarakatjugaberperanaktifdalam membantu program PT Pertamina, sehingga ada ikatan mitra yang tidak bisa diputuskan,” kata Khaidar. Soal target dari bantuan pinjamankepadapetaniataumasyarakat?“Target kita program berjalan baik, dan masyarakat memahami ketentuan pinjaman yang sudah disepakati yang jelas-jelas tidak memberatkan petani. Kita peduli dengan petani yang selama ini sering merasa kelabakan padahal sudah memasuki musim panen, mungkin saja dikarenakan harga penjualan gabah tidak memadai dengan hasil panen,’’ terang Khaidar. Menyangkut harga gabah, Khaidar, menambahkan, kalau PT Pertamina juga memikirkan masalah program resi gudang, yang tujuannya untuk menormalisasi harga penjualan gabah. Dengan demikian, kondisi perekonomian petani tetap stabil, sehingga tidak ada istilah “Petani rugi pada musim panen”, dan selanjutnya petani akan termotivasi untuk meningkatkan hasil panennya. PKBL Region I PT Pertamina, terus berupaya memberikan

TERIMA KASIH:

yang terbaik untuk peningkatan mutu pertanian di wilayah kerjanya. “Bagi kami adalah modal kepercayaan, dan kami yakin petaniadalahkomunitasmasyarakat hidup yang jujur,” katanya. Khaidar Aswan mengatakan, jika petani telah memberikan hal yang terbaik, berarti petani juga merupakan komponen untuk mendukung program PKBL Region I PT Pertamina, terlebih dalam menjalankan program ketahanan pangan. “Mari satukan niat untuk mendongkrak perekonomian masyarakat lemah dengan program ekonomi kerakyatan,” demikian Koordinator PKBL Region I PT Pertamina, OK Khaidar Aswan. ****

Ketua Sentra Informasi Masyarakat dan Petani (SIMPATI) Kabupaten Serdang Bedagai, berterima kasih Pemkab dan PKBL Region I PT Pertamina yang telah banyak melakukan program yang menyentuh langsung dengan masyarakat petani. Saya yakin masyarakat akan menanggapi hal ini secara profesional dan rasional. ‘’ Kita (SIMPATI) bersyukur masih ada perusahaan seperti PT Pertamina yang sudah memberikan kepercayaannya kepada para petani. Kepercayaan ini harus kita jaga,” ujar Syafrul Hayadi, yang bakal duduk di DPRD Serdang Bedagai pada periode 2009-2014.

Bangga Punya Petani Mitra Binaan Yang Sudah Bisa Membuktikan Hasil Kerja

Khairuddin, Asisten Program Bina Lingkungan Regional I PT Pertamina, sebagai Ketua Panitia Panen Raya di Desa Suka Beras, Serdang Bedagai.

HASIL panen raya mencapai 9 ton yang dihasilkan petani Desa Suka Beras, Perbaungan, Serdang Bedagai cukup membanggakan PKBL Region I PT Pertamina selaku mitra binaan. Demikian disampaikan Ketua Panitia Panen Raya Petani SIMPATI dengan PT Pertamina dan Pemerintah Serdang Bedagai, Khairuddin, di hadapan Gubernur Sumatera, Syamsul Arifin, Manajer Pe-

masaran BBM Retail Region I Suhermanto, Asisten Manajer Program Kemitraan Korporat Pusat, Aminuddin, Bupati Sergai HT Erry Nuradi dan Wakil Soekirman serta para petani. Dijelaskan, saat ini petani binaan PKBL Region I PT Pertamina berjumlah 250 Kepala Keluarga, terdapat di 3 kecamatan, Perbaungan, Pegajahan dan Serba Jadi dan memiliki lahan pertanian seluas 640 Ha. Dia berterima kasih kepada

Pemerintah Kabupaten Serdang Bedagai dan petani SIM PATI yang terus menerus berkomunikasi dengan PT Pertamina, terutama dalam memberikan bantuan pinja-man kepada para petani. Program kemitraan ini harus terus ditingkatkan. “Jangan kita hanya mendengar petani sudah panen, namun program kemitraan yang terjalin tidak berjalan sebagaimana yang

diharapkan. Jika petani mitra binaan bisa menjaga kepercayaan, PT Pertamina, melalui PKBL nya akan terus menunjukkan pelayanan terbaik kepada masyarakat petani. Intinya, petani senang, PKBL pun bangga punya binaan petani yang dapat menjalankan program sebagaimana yang digencarkan PT Pertamina,’’ demikian Khairuddin. ***

Aceh 24

B. Aceh, Sigli, Bireuen, Lhokseumawe

LHOKSEUMAWE (Waspada): Setiap kali diguyur hujan sejumlah ruas jalan di ibukota Lhokseumawe khususnya Kecamatan Banda Sakti, sering terendam banjir bahkan hingga menggenangi rumah warga. Genangan air di sejumlah jalan kota, bisa mencapai setinggi lutut kaki orang dewasa membuat orang kewalahan melintas. Salah satu kawasan kota yang sering tergenang air, seperti kawasan jalan Desa Lancang Garam, Kecamatan Banda Sakti. Setiap kali turun hujan jalanan tergenang sampai lima jam lebih. Kondisi memprihatinkan ini sudah berlangsung lama di ibukota Lhokseumawe dan sampai sekarang belum ada upaya penanganan khusus untuk mengantisipasi banjir bila hujan turun lagi. Hal itu juga diungkapkan Kepala Desa Lancang Garam, Muslim AR, terkait banjir yang sering mengancam lingkungan rumah warganya setiap hujan turun.(b15)

SIGLI (Waspada): Jajaran Reskrim Polres Pidie menghentikan peredaran 10 kg ganja kering dan menangkap dua tersangka di Desa Gajah Mate, Kec. Simpang Tiga, Kamis (20/8) sekira pukul 04:20 dinihari. Kapolres Pidie AKBP Moffan, MK melalui Kasat Reskrim AKP Erlintang Jaya, kepada Waspada di ruang kerjanya kemarin membenarkan pihaknya menangkap Kam, 25, dan Is, 27, tersangka pemilik barang haram tersebut. Keduanya ditangkap di rumah Kam di Desa Gajah Mate, Simpang Tiga.

PANTONLABU, Aceh Utara (Waspada): Dal, 37, penduduk Desa Glumpang Umpueng Unoe, Kecamatan Tanah Jambo Aye, Aceh Utara, Rabu (19/8) sekira pukul 18:00 diringkus polisi. Lelaki itu diduga mencabuli dua bocah asal kecamatan sama. Keterangan yang dihimpun, aksi itu dilakukan Dal Selasa (28/7) lalu di gubuk kebun milik tersangka. Kedua bocah yang masih berumur 10 tahun yakni sebut saja Mawar dan Melati. Setelah menjalani pemeriksaan medis, bagian sensitif kedua korban positif mengalami luka robek. “Saya mengetahui keduanya dinodai ketika mendengar pembicaraan Mawar dan Melati dengan teman sebayanya, seraya memperagakan apa yang dilakukan tersangka. Ketika itu saya tersentak kaget,” kata keluarga korban. Selanjutnya, dia menanyakan kedua bocah tentang peristiwa yang dialami. Tapi korban memilih bungkam karena takut. Meski demikian, setelah dibujuk sejumlah tetangga Mawar dan Melati kemudian menceritakan perihal perbuatan asusila itu. “Kedua bocah lugu itu mengaku tak kuasa melawan tersangka apalagi Dal sempat mengancam membunuh jika menolak dan menceritakan kejadian itu ke orang lain,” imbuh keluarga korban sedih. Dikatakannya, keluarga korban termasuk orangtuanya amat terkejut mendengar cerita korban. Keluarganya kemudian mengadukan kejadian itu kepada aparat desa dilanjutkan ke Mapolsek Tanah Jambo Aye. Kapolres Aceh Utara AKBP Yosi Muhammatha melalui Kapolsek Tanah Jambo Aye, AKP Razali membenarkan mendapat laporan kasus dugaan cabul itu. “Kasus ini masih dalam proses penyelidikan,” kata Kapolsek AKP Razali.(cmus)

Pekan Ta’Aruf ST AIN Berakhir Tanpa Kekerasan KOTA LHOKSEUMAWE (Waspada): Tasrizal, Ketua Panitia Pekan Ta’aruf kampus Sekolah Tinggi Agama Islam Negeri (STAIN) Mali kussaleh Lhokseumawe, kepada Waspada Senin (17/8) mengatakan, Pekan Ta’aruf yang dilaksanakan pihaknya terhadap para ma-hasiswa baru berakhir tanpa kekerasan. Dikatakannya, Pekan Ta’aruf telah dilaksanakan selama tiga hari yakni mulai tanggal 13 hingga 15 Agustus. Jumlah masiswa baru yang ikut dalam kegiatan itu mencapai 861 oran g dari tiga jurusan yakni Tarbiyah, Dakwah dan Syari’ah. Dalam kegiatan itu, para mahasiswa diajari tentang seluk beluk kampus mulai dari cara mengisi KRS hingga beberapa hal penting lainnya. “Sama sekali dalam Pekan Ta’aruf tidak kita terapkan tindak kekerasan pada para mahasiswa baru. Mereka lebih kita arahkan kepada pengenalan kampus, sehingga mereka tidak tulalit pada saat mengisi lembaran KRS dan KHS,” sebut Tasrizal. Dikatakan juga, pentingnya Pekan Ta’aruf, karena pada saat sidang dilaksanakan di akhir semester nantinya, sertifikat diminta sebagai salah satu syarat. Penutupan pekan ta’aruf dilaksanakan oleh Husnaini Hasbi, Pembantu III Kampus ST AIN Malikussaleh Lhokseumawe.(cmun)

Jembatan Pusong-Kuala Tari Segera Dibangun SIGLI (Waspada): Pemkab Pidie berjanji membangun jembatan Pusong – Kuala Tari, Desa Jeumeurang, Kec. Kembang Tanjong dengan panjang dua kilometer. “Kita harus segara membangun jembatan antara Desa Pusong dengan Kuala Tari, Jeumeurang. Karena warga Pusong sudah menahun hidup terisolir,” kata Bupati Pidie Mirza Ismail dalam kunjungan kerja ke Desa Pusong, Kec, Kembang Tanjong, Jumat (14/8). Menurut Mirza, dalam waktu dekat petugas dinas terkait mulai bekerja, diawali melakukan pengukuran dan diharap masyarakat dua desa yang dipisahkan bibir pantai Selat Malaka dapat dengan antusias membantu petugas melaksanakan tugasnya tersebut. (b20)

Menurut Erlin, saat polisi melakukan penangkapan, Is salah satu tersangka menyerang petugas. Bahkan pistol petugas nyaris dirampas tersangka sehingga terjadi adu jotos. Dikatakan, sebelum kedua tersangka ditangkap, polisi yang menerima informasi dari masyarakat langsung melakukan pengintaian. Barang haram itu dibeli dari Lamteuba Aceh Besar dengan cara utang. Sebelum ditangkap keduanya sedang mengemas ganja itu di rumah Kam.(b20)

Polisi Perketat Pengamanan Di SPBU Dan Toko Mas

‘Terjebak Perangkap’, Truk Terjatuh Ke Alur Jembatan

Dua Bocah Dicabuli

Jumat 21 Agustus 2009

Dua Pelaku Dan 10 Kg Ganja Diamankan Polisi

Hujan, Sejumlah Ruas Jalan Terendam Banjir

ACEH UTARA (Waspada): Truk colt diesel BK 8275 BS terjatuh ke alur jembatan di Desa Meunasah Reudeup, Kecamatan Lhoksukon, Aceh Utara, Rabu (19/ 8) sekitar pukul 04.00. Warga, Kamis (20/8) mengatakan, peristiwa itu telah terjadi dua kali di jembatan tersebut. Diduga, mobil terjatuh ke alur jembatan akibat masuk ‘perangkap’ yang sengaja dibuat pemerintah. “Perangkap yang kami maksudkan di sini yaitu, pelebaran jalan yang dilaksanakan pemerintah tidak disesuaikan dengan jembatan yang ada. Karena itu, para sopir pada malam hari terjebak,” kata salah seorang warga Meunasah Reudeup. Untuk itu, masyarakat minta pemerintah memperlebar jembatan, agar peristiwa tersebut tidak terulang lagi. “Ini jelas kesalahan pemerintah. Kenapa jembatan tidak disesuaikan dengan lebar jalan. Kami menilai, pemerintah telah ‘memasang perangkap’ untuk para pengguna jalan,” katanya. Kata warga itu, Juhari, 47, sopir truk selamat namun Efendi, 18, meninggal dunia. Pantauan Waspada, selain di Meunasah Reudeup, ada tiga jembatan lainnya yang harus segera direnovasi agar peristiwa itu tidak terulang lagi, yakni jembatan dekat Mapolres Aceh Utara, jembatan depan PDAM Tirta Mon Pase Lhoksukon, dan jembatan dekat SMA N I Lhoksukon. “Kami harap ini jadi perhatian pemerintah,” pinta warga itu. Sementara itu Ir. Tanwir, Kepala Dinas Bina Marga Aceh Utara yang berhasil dihubungi Waspada, Kamis (20/8) menyebutkan, pembangunan jalan Medan-Banda Aceh tidak ditangani pihaknya, namun itu merupakan proyek yang bersumber dari APBN. “Ditangani Provinsi Aceh. Jadi ke sana saja konfirmasinya,” ucap Tanwir.(cmun)

WASPADA

Waspada/Muhammad Riza

BARANG BUKTI: Kasat Reskrim Polres Pidie, AKP Erlintang Jaya bersama seorang anggota Polres Pidie sedang menghitung barang bukti (BB) ganja siap edar seberat 10 kg yang berhasil di sita di Desa Gajah Mate, Kec. Simpang Tiga, Kamis (20/8).

Selama Ramadhan Murid Belajar Enam Kali ACEH UTARA (Waspada): Pasca Ramadhan 1430 H/2009, pelajar di Aceh Utara harus mampu berwudhuk dan shalat yang benar, kata Kadisdik, M. Jamil, M.Kes (foto), Kamis (20/8). “Para orang tua/wali pelajar dari semua tingkatan sekolah di kabupaten ini, saya harap jangan terkejut terhadap kegiatan di sekolah-sekolah se Aceh Utara kali ini. Hal tersebut hasil kordinasi semua pihak dan sudah saya instruksikan kepada seluruh jajaran Dinas Pendidikan, agar murid tetap belajar di bulan suci Ramadhan,” kata M. Jamil. Aktivitas belajar mengajar yang dimaksudkan Kadisdik Aceh Utara, bukan sebulan penuh. Tapi enam kali pertemuan antara guru-guru bidang studi agama dengan para murid. “Tiga kali pertemuan pada Minggu kedua dan tiga kali pada Minggu ketiga, sedang Minggu pertama dan keempat tetap libur total,” tandasnya. Rapat khusus Kadisdik dengan Unit Petugas Teknis Disdik (UPTD) yang

bertugas di kecamatan-kecamatan (27 tingkat kecamatan di Aceh Utarared), wajib menjalankan intruksi pengisian pendidikan agama di Aceh Utara pada bulan Ramadhan 1430 H. Materi pelajaran pertama yang paling penting, soal tata cara berwudhuk yang benar. Urutan kedua, kata dia, tata cara shalat wajib dan sunat. Lalu menghafal (hafiz) ayat-ayat Al-Quranulkarim yang pendek-pendek, menghafal hadist-hadist shahih dan do’ado’a pendek usai shalat. “Aktivitas ini dirangkum dalam pendidikan akhlaqulqarimah, dibarengi latihan-

latihan termasuk latihan membaca khutbah Jumat,” sebut Kadisdik Aceh Utara. “Saya programkan ini, melihat fenomena hafalan para pelajar di Aceh Utara, umumnya bagus. Sekali saja didengar lagu ‘Tak Gendong’ Mbah Sirip (alm) di televisi, anakanak di kota sampai pelosok desa mampu menghafal kata-kata (lirik) nya, ayat-ayat pendek kenapa tidak,” lanjut M. Jamil. Kadisdik tak menyalahkan anakanak termasuk para remaja yang cekat menghafal nama para bintang senetron, ketimbang nama Rasul. “Kita yang salah, kita tidak pernah memperkenalkan Rasul dan keunggulan para Rasul untuk diidolakan. Sementara ketokohan bintang senetron, karena hanya itu yang muncul di depan mata setiap saat.” Kepada para guru agama di sekolah-sekolah tingkat Tk, SD/MI, SLTP/ M Ts/SLTA/MA dan SMK juga kepada seluruh orang tua/wali murid/ siswa, diimbau terus menerus menyiasati kecerdasan anak-anak dan para remaja.(b10)

Budaya Rekonsiliasi Harus Terus Hidup Di Aceh BANDA ACEH (Waspada): Kelebihan masyarakat Aceh adalah selalu memiliki nurani damai, karena budaya Sayam dan nilai Islam, sehingga semua konflik yang terjadi berujung di meja perundingan. Pada masa DI/TII dan konflik terakhir yang terjadi di Aceh misalnya, juga berakhir di meja perundingan. Demikian Wagub Aceh Muhammad Nazar menjawab pertanyaan Waspada setelah Workshop Penguatan Damai yang dilaksanakan SERASI bekerjasama dengan USAID di Hotel Nanggroe, Selasa (18/8). Untuk memberikan terapi kepada dampak konflik maupun bencana yang pernah terjadi di provinsi paling ujung Pulau Sumatera itu, Nazar mengingatkan semua pihak agar mengetahui latar belakang Aceh sejak dahulu hingga sekarang, termasuk psikososial yang ditimbulkan karena perilaku keluarga dan masyarakat sendiri tanpa melibatkan orang lain, maupun psikososial yang timbul karena konflik luas, seperti perang melawan Kolonialisme Belanda, DI/TII, Perang Cumbok, sampai perlawanan sipil referendum. Semuanya, kata Nazar, kejadian itu telah menimbulkan dampak di antaranya destruksi sistem sosiocultural serta distorsi pemaknaan, pemahaman dan praktik agama yang akhirnya semakin parah dan menimbulkan kecurigaan dan meudarah ate (ber-darah

hati). Namun, tambah Nazar, jika hal itu telah diketahui maka akan sangat mudah untuk mengobatinya, karena orang Aceh pada hakekatnya memiliki kelebihan di budaya dan agama serta sejumlah kearifan lokal, termasuk Budaya Sayam dan peusijuek (tepung tawar), yang akhirnya baik kembali sehingga menjadi saudara. Bahkan, kata Nazar, tak jarang salah satu dari kedua belah pihak yang tadinya bermusuhan, bersatu dalam ikatan perkawinan. Sebuah hadihmaja di Aceh menyebutkan; ureung Aceh meunyo ka teupeeh, bu leubeeh han jipeutaba, meunyo hana teupeeh dumpeu jeut taraba. Maknanya; orang Aceh, jika sudah tersinggung, nasi lebihpun tak akan ditawarkan. Namun, jika tidak tersinggung apapun mau diberikan. “Ini dapat dilihat dari perilaku pimpinan masyarakat Aceh Tgk Daud Beureu-eh dahulu, ketika memiliki berhubungan dengan Soekarno, maka apapun dilakukan, termasuk mengorganisir emas, mengorganisir tentara Aceh untuk memperjuangkan Kemerdekaan Indonesia, termasuk mengorganisir pembelian pesawat terbang untuk disumbangkan kepada pemerintah pusat,” ulas Nazar. “Tapi, begitu beliau bersama pimpinan Aceh lainnya merasa ter-

singgung karena kebijakan pemerintah Indonesia di bawah kepemimpinan Soekarno yang menggabungkan Aceh dengan Provinsi Sumatera Utara tanpa memberitahukan terlebih dahulu kepadanya, maka Abu Daud Beureu-eh pun melawan dan memberontak,” sambung Nazar. Namun, ketika hal itu dimediasi dan bisa dijelaskan kembali dengan baik, maka masalah itu bisa selesai di meja perundingan. “Masyarakat Aceh adalah masyarakat yang sangat terbuka, transparan. Mereka tidak mau ditindas diinjak-injak. Masyarakat Aceh pada dasarnya tidak suka berperang, dan mereka juga tidak boleh diperangi, baik langsung menggunakan senjata maupun dengan kebijakan-kebijakan,” kata Nazar. Menurut Wagub Aceh, rekonsilisasi informal kearifan lokal Aceh hanya ada pada Khanduri Moklod (Kenduri Maulid), Khanduri Blang (Kenduri Sawah), Khanduri Nujoh (Kenduri tujuh hari orang meninggal) dan lain sebagainya. “Itu sangat efektif dan bisa dimanfaatkan. Jadi, tidak selamanya resolusi konflik itu dapat diterapkan seratus persen di Aceh, tapi harus dicampur baur dengan kearifan lokal setempat,” demikian Muhammad Nazar.(b09)

KOTA LHOKSEUMAWE (Waspada): Untuk mengantisipasi halhal tak diinginkan menjelang hari meugang dan lebaran Idul Fitri, polisi dari Mapolresta Lhokseumawe memperketat pengamanan di sejumlah SPBU dan Toko Mas. Hal itu dikatakan AKBP Zulkifli, Kapolresta Lhokseumawe kemarin. “Beberapa hal yang kita antisipasi yakni aksi perampokan dan tindak kriminal lainnya. Ini khusus kita lakukan di sepanjang lintasan Jalan Medan-Banda Aceh, mulai Kecmatan Samudera hingga Kecamatan Muara Batu,” sebut Kapolresta. Karena itu untuk mensterilkan beberapa titik sentral aktivitas masyarakat, Kapolres mengerahkan 100 personil bertugas memantau keamanan di titik yang telah ditentukan. Mengingat selama ini berbagai aksi kejahatan kerap terjadi di SPBU mau pun Toko Mas. “Ini kita lakukan atas dasar ini-

siatif sendiri sebagai bentuk kepedulian bagi masyarakat. Jika ada penjahat yang hendak melakukan aksi kriminal, tentu bisa diringkus dengan mudah. Dan tujuan utamanya adalah biar masyarakat tidak resah,” sebutnya, Kamis (20/ 8), di ruang kerjanya. Menjawab wartawan, hingga sekarang kondisi di lapangan berjalan tertib, aman dan lancar. Kegiatan ini didukung kesiapan setiap Mapolsek yang tersebar di beberapa kecamatan, baik di Aceh Utara maupun Kota Lhokseumawe. Beberapa hal yang dilakukan yakni peningkatan patroli di sejumlah titik rawan, dan aktif memantau arus mudik jelang H-1. Untuk itu, masyarakat diminta melaporkan ke pihak berwajib apabila melihat atau menemukan gerak-gerik mencurigakan, agar hal-hal yang tidak diinginkan tidak sampai terjadi.(cmun)

Meugang Kecil Daging Rp100.000/Kg BIREUEN (Waspada): Harga daging pada meugang kecil di Kabupaten Bireuen, khususnya di wilayah tengah dan timur senilai Rp100 ribu per kilogram. Antusias pembeli tinggi, demikian pantauan Waspada, Kamis (20/8). Di wilayah Matanggeulumpang Dua, Kecamatan Peusangan, Kecamatan Kota Juang, dan Kecamatan Kuta Blang, Kabupaten Bireuen, sejak selepas subuh masyarakat telah memadati tempat-tempat penjualan daging. “Kendati di tiga lokasi ini harga daging per kilogramnya pada meugang kecil senilai Rp100 ribu, namun antusias pembeli tinggi,” demikian Ahmadi, Sekretaris Imum Mukim Dusun Kuta Hoom, Kecamatan Kuta Blang yang ditemui di pasar ikan mini kecamatan ter-sebut. Menurut dia, di Kecamatan Kuta Blang, meugang kecil kali ini lebih tinggi bila dibandingkan dengan tahun lalu. “Tahun ini jumlah hewan yang dipotong kurang lebih 15 ekor, tahun lalu hanya 10 ekor.” Menurutnya, meugang kecil

bisa diartikan dengan meugang pegawai, karena pada meugang kecil banyak pegawai menerima jatah uang meugang. “Hingga sekira pukul 12:00 daging di pasar ikan mini Kuta Blang mulai mendekati habis, harga masih tetap Rp100 ribu per kilogram,” kata Ahmadi. Sementara Said, warga Matanggeulumpang Dua, Kecamatan Peusangan, Kabupaten Bireuen mengatakan, hingga sekira pukul 13:00 stok daging masih banyak, dengan harga per kilogram Rp100 ribu. “Tapi biasanya menjelang siang dan sore hari harga daging turun,” terang Said usai membeli daging di Matanggeulumpang . Rahmat, warga Bireuen kepada Waspada saat ditemui di pasar daging jalan rel kereta api menyebutkan, harga daging Rp100 ribu per kilogram. “Malah siang hari dengan cuaca mendung beberapa pedagang banting harga Rp80 ribu per kilogram, kalau sudah sore harga bisa turun lagi, apalagi bila hujan turun.” (cih)

Tanggulangi Genangan, Camat Bawa Surat Empat Kades Mukim Tengah PANTONLABU, Aceh Utara, (Waspada): Camat Tanah Jambo Aye, Aceh Utara, TM Yacob, SE membawa surat empat Kades di Kemukiman Jambo Aye Tengah yang meminta bangunan box calfer (plat beton), Kamis (20/8). Empat surat resmi geuchik/ kepala desa (Kades) di Kemukiman Jambo Aye Tengah tadi, masingmasing Kades Lhok Beuringen Abdul Murad Ishak, Kades Gampong (Desa) Matang Raya, M Ramli AB, Kades Gampong Lueng Tuha, Zulkifli Jalil dan Kades Matang Teungoh, M. Jamil Usman. “Surat itu sudah saya serahkan hari ini (Kamis kemarin-red), kepada Kadis Cipta Karya Aceh Utara, Ir. H. Arifin,” kata TM Yacob (Camat Tanah Jambo Aye) kepada Waspada, Kamis (20/ 8). Surat itu sebagai data lapangan yang menuntut pembangunan empat unit box calfer pada ruas jalan Gampong Lhok Merbo – Gampong Pucok Alue, selaku urat nadi perekonomian warga di Kemukiman

Jambo Aye Tengah yang membawahi 17 desa. “Box calfer itu bersifat sementara, untuk mencegah genangan salah satu sisi jalan agar kerusakannya jangan bertambah parah di musim penghujan tahun 2009 ini,” kata Camat. “Saya dan rombongan telah melihat secara kasat mata, Senin (10/8). Memang kondisi jalan di kemukiman ini sangat memprihatinkan, kalau tidak dikatakan hancur-hancuran. Pada hal jalan di lintas 17 gampong ini digunakan sehari-hari oleh ribuan masyarakat dan anak-anak sekolah,” ujarnya. Lokasi jalan terpaut antara 5 – 12 Km dari pusat ibukota Kec. Tanah Jambo Aye (Pantonlabu). Setiap pagi dilalui ratusan siswa SMA di kota Pantonlabu, sementara masyarakat umum menggunakannya untuk membawa komoditas hasil-hasil pertanian, sebaliknya transportasi sembilan bahan pokok rakyat dan bahan-bahan bangunan disupport melalui sarana hubungan tersebut.(b10)

Lhokseumawe Dan Aceh Utara Waspadai Antrak ACEH UTARA (Waspada): Untuk mewaspadai penyakit antrak, Dinas Peternakan (Disnak) Aceh Utara dan Pemko Lhokseumawe memeriksa sekitar 6.000 ekor hewan meugang menyambut bulan suci Ramadhan 1430 H. Antrak semacam penyakit hewan yang sangat berbahaya terhadap manusia yang mengkonsumsi dagingnya, sebagaimana pernah terjadi di Inggris. Bangkai hewan pengidap penyakit antrak ditanam tanpa dibakar, lalu di atasnya ditanam pohon pisang dan ketika

pisang itu berbuah dan dikonsumsi, satu keluarga warga Inggris mati mendadak, kata salah seorang pegawai Disnak Aceh Utara. Kepala Dinas Peternakan (Kadisnak) Aceh Utara, Drh. Rizal Binsari membenarkan, gejala hewan yang terkena penyakit itu antara lain keluar darah dari pangkal bulunya. Tapi menurutnya belum ada kasus antrak di Aceh. “Karena itu kita waspadai, kalau ada jangan sempat hewan sembelihan itu dikonsumsi

manusia,” katanya. Selain antrak, Disnak Aceh Utara maupun Pemko Lhokseumawe juga mewaspadai dua jenis penyakit hewan lainnya yang rentan mengintai ternak (Sapi maupun Kerbau), yang dagingnya dikonsumsi masyarakat, lebih-lebih saat tibanya hari meu-gang (hari motong) yang sangat sak-ral dalam adat istiadat di Aceh, yaitu penyakit PMK (Penyakit Mulut dan Kuku), serta penyakit BVD (Bofin Viral Deare) yang juga tidak kecil bahayanya. (b10)

Waspada/M Jakfar Achmad

JALAN BERLUBANG: Salah satu bagian jalan yang berlubang di Kemukiman Jambo Aye Tengah, Kec. Tanah Jambo Aye, Aceh Utara.

WASPADA Jumat 21 Agustus 2009

25

Langsa, Kualasimpang, Kutacane, Singkil

Lecehkan Profesi Wartawan Anggota DPRK Minta Maaf SUBULUSSALAM (Waspada): Meski sudah minta maaf kepada puluhan wartawan usai dilantik menjadi anggota DPRK Aceh Singkil, Selasa (18/8) di Gedung DPRK, pernyataan oknum anggota terhormat sangat disesalkan. Pasalnya, Frida Siska Sihombing dinilai melecehkan profesi wartawan dengan mengeluarkan kata-kata penghinaan. Demikian sejumlah wartawan di Kota Subulussalam kepada Waspada, Kamis (20/ 8), mengomentari pernyataan Frida dari PKB yang menyebutkan wartawan di daerah ini bodoh. “Semua wartawan gumbu-gumbu (baca: bodoh),” tiru seorang wartawan menyebutkan pernyataan Frida. Menurut mereka, nada penghinaan tersebut disampaikan Frida Siska, Kamis (13/ 8) di gedung DPRK Aceh Singkil usai gelar serah terima aset Pemko Subulussalam dari Pemkab Aceh Singkil. Seperti rekaman wartawan saat Frida Siska menyampaikan permohonan maaf, Frida mengaku kalau lontaran pernyataannya dilakukan di luar kesadaran. “Saya mengakui ada mengeluarkan kata-kata itu dan dengan

penuh rasa hormat saya minta maaf,” papar Frida di hadapan sejumlah wartawan cetak dan elektronik. Sesuai informasi, usai penyerahan aset, Frida menyebutkan kalau semua wartawan di daerah ini bodoh, kecuali hanya salah satu surat kabar terbitan Aceh. Akibatnya, insan pers di sana protes dan sempat berencana melaporkan kasus tersebut ke polisi. “Sebagai wakil rakyat dan cukup terhormat, tak pantas mengeluarkan kata-kata penghinaan, apalagi menyangkut profesi wartawan,” tandas Dauli Samosir, wartawan daerah liputan Aceh Singkil dan Subulussalam menambahkan, kalau namanya terhormat kata-kata yang disampaikan pun harus terhormat. Menyangkut permintaan maaf Frida, sejumlah wartawan mengaku maklum. Namun mereka dengan keras mengingatkan masyarakat agar lebih menghormati dan menghargai tugas-tugas para jurnalis. “Kasus anggota DPRK Aceh Singkil kepada wartawan hendaknya jadi pelajaran untuk semua pihak, sehingga tidak dengan seenaknya meremehkan wartawan.”(b33)

SPB U SPBU TUTUP: SPBU Lawe Kihing Kecamatan Bambel tutut tanpa aktivitas. Kelangkaan premium beberapa hari terakhir membuat pemilik kenderaan bermotor di Agara resah, terutama menjelang masuknya bulan suci ramadhan.

PKS LTP Bantu Kaum Duafa Dan Anak Yatim PENANGGALAN, Subulussalam (Waspada): Jajaran PKS Lestari Tunggal Pratama (LTP) Penanggalan Kec. Penanggalan, Subulussalam memberi bantuan puluhan kaum duafa dan anak yatim di sekitar Desa Penanggalan. 35 Orang penerima bantuan berupa sembako dan kain sarung, langsung diserahkan Mill Manajer PKS LTP Penanggalan, Lily Halimah Siregar disaksikan Camat, mewakili Kapolsek Penanggalan, Disnakertrans dan Kepala Desa Penanggalan di Gedung Pertemuan Lae Kombih Penanggalan, Kamis (20/8). Lily Halimah Siregar dalam sambutannya mengatakan, bantuan yang diberikan sebagai salah satu bukti kepedulian pihaknya terhadap masyarakat di sekitar dan diharap dapat dimanfaatkan dengan sebaik-baiknya para penerima. Pemberian bantuan ini menurut Lily juga terkait dengan penyambutan bulan suci Ramadhan 1430 H. Ke depan, Lily berjanji berusaha memberikan bantuan lain kepada

masyarakat sekitar, termasuk agenda pemberian bantuan alat-alat tulis bagi anak-anak sekolah yang kurang mampu di daerah ini. Sebelumnya Plt. Camat Penanggalan A. Saman Sinaga dalam sambutannya menyampaikan terima kasih kepada PKS LTP Penanggalan dan berharap sikap kepedulian sosial ini ke depan harus dapat terus ditumbuh-kembangkan. Hadir mewakili Dinas Tenaga Kerja dan Transmigrasi Syafrianda, mewakili Kapolsek Penanggalan Jarwa Susianta dan Kepala Desa Penanggalan A. Haris Bancin. Secara terpisah, Syafrianda kepada Waspada mengatakan, sumbangan berupa bingkisan yang diberikan PKS LTP Penanggalan sangat positif namun pemberian berupa uang, ke depan, diharapkan menjadi hal yang perlu mendapat perhatian. “Kalau bantuan uang, mungkin penerima akan lebih memahami ke mana dimanfaatkan,” sebut Syafrianda.(b33)

Waspada/Ali Amran

Warga Serbu SPBU, Duafa Datangi Kantor Bupati KUTACANE (Waspada): Khawatir tak kebagian premium memasuki hari meugang, pemilik kenderaan bermotor menyerbu SPBU dan galon penjualan bensin di Kutacane. Pantauan Waspada, Kamis (20/8), karena tak dibukanya SPBU di kawasan desa Lawe Kihing Kecamatan Bambel dan kekhawatiran warga tak kebagian premium, sejak pukul 08.00 warga mengalihkan perhatian menuju SPBU Kampung Melayu. Akibatnya, sampai pukul 14.00 antrian panjang ratusan kenderaan roda dua, roda tiga dan roda empat masih terlihat di area SPBU Kampung Mela-

yu yang jadi satu-satunya harapan pemilik ranmor mendapat pasokan premium. Wendi, salah seorang pemilik kenderaan roda dua mengaku, sejak pukul 09.00 telah mendatangi SPBU Lawe Kihing, namun SPBU tak dibuka akibat ketiadaan stok premium, dia bersama pemilik ranmor lainnya terpaksa mengalihkan tujuan menuju SPBU Kampung Melayu. Namun sayangnya, di SPBU Kampung Melayu pemilik kenderaan bermotor harus bersabar menunggu karena terjadinya antrian panjang. “Beberapa hari ini kelangkaan premium telah terasa, karena itu jika pun dibuka dan ada stok, hanya pada salah satu SPBU saja dan sangat terbatas, sebab itu sejak pagi hari kami telah mendatangi SPBU,” kata Wendi.

Sementara Amir menyebutkan meski masih bisa mengisi premium di galon pengecer yang tersedia di sepanjang jalan negara Kutacane-Medan dan Kutacane-Blangkjeren, namun harganya relatif mahal. Bahkan untuk satu liter premium, masih ada yang menjual Rp6.000 sampai Rp7.00 per liter. Duafa Sementara di lokasi di terpisah, puluhan kaum duafa yang mendatangi kantor bupati dan berharap mendapat bantuan untuk membeli daging meugang, terpaksa pulang dengan kecewa. Pasalnya, meski telah menunggu dari pagi sampai siang, puluhan kaum duafa yang datang secara berkelompok tak juga mendapat bantuan yang sangat diharapkan kaum ekonomi lemah tersebut.

LePSI Kaji Naskah Surat Sultan Samudera Pasai

Waspada/Khairul Boangmanalu

Lily Halimah Siregar, Mill Manajer PKS LTP Penanggalan saat menyerahkan bingkisan kepada salah seorang duafa Desa Penanggalan yang dilaksanakan di Gedung Pertemuan Lae Kombih Penanggalan, Kamis (20/8).

Artis Komedi Aceh Main Film Perdamaian BANDA ACEH (Waspada): Guna memperkuat perdamaian Aceh, banyak jalan dilakukan. Salah satunya lewat media visual berupa film. Karena itu, tak heran jika artis komedi Aceh pun ikut mengajak masyarakat memperkuat perdamaian. Film Perdamaian yang berjudul Rum’eh (senyum perdamaian) itu diluncurkan, Rabu (19/8) petang di Gedung AAC Prof. Dr. Dayan Dawood Universitas Syiah Kuala (Unsyiah) Banda Aceh. Film ini digagas kerjasama Forum Lembaga Swadaya Masyarakat (LSM) Aceh bekerja sama dengan Kerajaan Belanda dan Bank Dunia. Sekretaris Jenderal Forum LSM Aceh, Sudarman Alkatiry Puteh kepada Waspada, kemarin menyatakan, momentum peluncuran film tersebut terasa tepat, karena suasana Aceh yang masih memperingati empat tahun usia MoU perdamaian Helsinki. Dia mengatakan, pembuatan film terse-but terinspirasi dari latar belakang situasi Aceh, di mana tindak kekerasan dengan nuansa kriminalitas cenderung meningkat pasca MoU Helsinki. “Karena itu, berbagai kegiatan yang bertujuan memperkuat perda-maian perlu sesering mungkin dilakukan,” katanya. Menurut aktivis ini, situasi seperti itu dikhawatirkan bisa mengganggu proses penguatan perdamaian Aceh yang berlangsung. “Ini perlu dirawat sejak dini, agar perdamaian di Aceh terus bersemi di Aceh,” sebut dia. “Kita harus terus mengkampanyekan ini.” Sudarman menambahkan, kehadiran film Rum’eh diharapkan bisa menjadi cermin bahwa sebenarnya kondisi Aceh kini sudah benar-benar aman dan damai, dimana kegiatan ekonomi dan sosial masyarakat sudah

kembali normal. Sedangkan, penulis naskah dan ide cerita, Ayi Sarjev menjelaskan, ide cerita ini sebenarnya sudah muncul dua tahun lalu. Namun, baru sekarang ini bisa terlaksana dan bisa disaksikan mas-yarakat. Dia menyebutkan, film ini menceritakan kondisi kehidupan masyarakat Aceh pasca MoU Helsinki, khususnya di desa-desa. Kata dia, cerita dalam film yang berdurasi 75 menit itu diawali dengan indahnya kehidupan pasca MoU Helsinki. “Kita bisa melihat dari renyahnya senyum setiap warga dan aktivitas sosial ekonomi yang mulai menggeliat. Ini memberi ruang ekspresi lebih luas dengan perdamaian, sehingga bisa menghidupkan ekonomi Aceh,” paparnya. Kata dia, film ini berusaha menghadirkan kondisi terakhir di Aceh dalam bentuk komedi, serta memunculkan berbagai harapan yang masih menjadi dambaan masyarakat. Oleh karena itu, dalam film tersebut melibatkan kelompok “Eumpang Breuh” yang sangat diminati masyarakat Aceh. Sarjev mengatakan, pemilihan kelompok ‘Eumpang Breuh’ agar masyarakat lebih mudah memahami pesan-pesan perdamaian yang disampaikan dalam film tersebut. “Apalagi kelompok ini sudah sangat populer di Aceh,” sebut sinematografi Aceh itu. Karena mengusung ‘Eumpang Breuh’, praktis film yang disutradarai Ayah Doe tersebut dibintangi artis lokal seperti Joni Kapluk, Haji Uma, Mando Gapi, dan Yusniar. Bukan hanya itu, film in juga melibatkan sejumlah pekerja sosial luar negeri yang ada di Aceh. (b05)

LHOKSEUMAWE (Waspada): Lembaga Penelitian Sejarah Islam (LePSI) Lhokseumawe mengkaji naskah surat Sultan Zainal Abidin yang merupakan Sultan terakhir di Samudera Pase. Sekjen LePSI, Fauzan Effendi, Kamis (20/8) menjelaskan, naskah surat tersebut milik Sultan Zainal Abidin yang wafat pada tahun 923 Hijriah atau 1518 Masehi. Surat itu ditujukan kepada Kapitan Moran yang bertindak atas nama wakil raja Portugis di India. “Naskah fotografinya dapat disaksikan di Museum Negeri Aceh, sementara aslinya tersimpan di Lisabon, Portugal,” jelas Fauzan. Naskah itu memberikan banyak informasi sejarah tentang ihwal Samudra Pasai di awal abad ke-16, terutama menyangkut kondisi terakhir yang dialami kerajaan Islam pertama di Asia Tenggaran ini, setelah Portugis berhasil menguasai Melaka pada tahun 1511. Naskah surat berbahasa

Arab itu juga mencantumkan nama beberapa negeri atau kerajaan yang punya hubungan erat dengan Samudra Pasai, sehingga dapat diketahui pengejaan asli dari nama-nama negeri atau kerajaan tersebut. Seperti Nergeri Fariyaman (Pariaman), dan Mulaqat (Melakka). Naskah yang dikaji peneliti dari LePSI selama hampir dua bulan ini, sejauh yang kami tahu, belum pernah dikaji dan dengan demikian belum pernah dimanfaatkan dalam penulisan sejarah Samudra Pasai. “Rencananya kami akan mempublikasikan hasil kajian tersebut dalam beberapa hari ke depan. Hal ini sesuai arah dan tujuan LePSI sebagai sebuah lembaga penelitian yang mengkhususkan diri untuk meneliti serta mempublikasikan berbagai hasil penelitian kepada masyarakat luas. Harapannya ialah supaya dapat menambah wawasan sejarah kebangsaan dan keislaman bagi masyarakat umum, ter-

utama bagi kalangan generasi muda,” jelasnya. Selain itu juga ditujukan untuk menambah kesadaran akan pentingnya menjaga dan merawat warisan budaya, apa pun bentuk dan rupanya. Dan sebagaimana kita ketahui bersama, Aceh tidak hanya kaya dengan warisan kesenian tradisional tapi juga dengan khazanah intelektualnya yang perlu sekali dijaga dan dirawat sehingga generasi hari ini dapat melanjutkan kontribusi peradaban yang pernah disumbangkan generasi pendahulu. Untuk itu, LePSI dengan didukung oleh Pemerintah Kota Lhokseumawe berusaha semampu mungkin untuk dapat mendokumentasikan berbagai manuskrip (naskah atau kitab-kitab tulisan tangan) yang disimpan oleh perorangan dalam kawasan Lhokseumawe dan sekitarnnya, supaya kekayaan intelektual tersebut tetap terus diwarisi serta dapat dimanfaatkan oleh para peneliti, ilmuan serta lainnya.(b17)

“Kata pegawai yang kami temui, untuk tahun ini mungkin tak ada yang bisa diberikan Pemkab, karena itu kami terpaksa pulang dengan tangan hampa,” ujar salah seorang kaum duafa, kecewa. Nawi Sekedang, salah seorang pegiat LSM mengaku prihatin dengan masih berdatangannya kaum duafa ke kantor bupati dan kantor lainnya, meski hanya mengharap ban-

tuan meringankan beban membeli daging meugang. Padahal, bila ada kebija-kan, dana untuk kaum duafa itu bisa disisihkan dari dana Bazis. “Dana Bazis itu setiap bulan kan dipotong untuk PNS, bahkan dalam setahun jumlah totalnya mencapai satu miliar lebih. Lantas bila bukan kepada kaum duafa, ke-pada siapa lagi akan diberikan dana Bazis tersebut,” tanya Nawi.(b27)

337 CPNS TA 2008, Mendapat SK BLANGKEJEREN (Waspada): 337 Lulusan CPNS TA 2008, Kamis (20/8) mendapat SK yang diserahkan Bupati Gayo Lues H. Ibnu Hasim, S.Sos, MM di aula Balai Musara. 226 Tenaga pendidik ini terdiri dari 132 Golongan III dan 94 Golongan II. 45 Tenaga teknis terdiri dari 30 Golongan III dan 15 Golongan II. 61 Tenaga Kesehatan terdiri dari 22 Golongan III, 39 Golongan II ditambah 5 dari Tenaga Dokter Formasi Khusus. Bupati mengharapkan para CPNS bekerja di tempat yang telah ditetapkan dan harus profesional, mengutamakan kewajiban baru hak. “Saya mengharapkan para CPNS bekerja secara profesional, harus mengutamakan kewajiban sebagai pegawai negeri, baru hak,” harap bupati. Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Gayo Lues Maliki, SE di ruang kerjanya menjelaskan, sebelumnya usulan Pemda 341 orang dan yang keluar 332 ditambah 5 orang dari tenaga dokter dan 9 masih dalam proses administrasi. (cb01)

176 Mahasiswa AKPN Dan ASM Wisuda PEUREULAK, Aceh Timur (Waspada): 176 Mahasiswa/i Akademi Keuangan dan Perbankkan Nusantara (AKPN) dan Akademi Sekretaris dan Manajemen Nusantara(ASMN) Peureulak, Aceh Timur, Provinsi Aceh, Rabu (19/8) diwisuda. Proses akademis itu dipusatkan di Mesium H.T. Muhammad Thaeb Kota Peureulak, dihadiri unsur Muspida plus dan akademisi perguruan tinggi itu. Direktur AKPN Peureulak, Syamsul Rizal dalam sambutannya menyampaikan penghargaan setinggi-tingginya untuk seluruh staf akademik dan para dosen atas segala upaya dalam proses pembelajaran, sehingga AKPN yang telah terakreditasi dari BAN-PT itu berhasil mewisuda ratusan mahasiswanya. Dikatakannya, akreditasi tersebut merupakan pengakuan dari pemerintah, dimana AKPN Peureulak telah disejajarkan dengan perguruan tinggi negeri lainnya di Aceh. dan ijazahnya dapat diterima pada instansi pemerintah, swasta maupun badan Usha Milik Negara (BUMN). “Setelah upaya keras yang dilakukan bertahun-tahun mahasiswa/i telah sukses memperoleh gelar akademik sarjana ahlimadya dibidang perbankkan, dan kami selaku direktur mengucapkan selamat kepada para mahasiswa,” katanya seraya mengharapkan mahasiswa yang lulus tahun ini dapat mengaplikasikan ilmu di tengah masyarakat.(cmad/cmus)

Tim Safari Ramadhan Aceh Singkil Terbentuk SINGKIL (Waspada): Menyongsong pelaksanaan ibadah puasa 1430 H, Pemkab Aceh Singkil membentuk tim Safari Ramadhan. Kepala Dinas Syariat Islam Kabupaten Aceh Singkil Drs. H. Sanusi M.Ag kepada Waspada, Selasa (18/8) di kantornya Jl. Utama Pulo Sarok Singkil menyebutkan tim yang dibentuk dibagi empat kelompok melibatkan 161 peserta. Kelompok satu dipimpin Bupati H. Makmursyah Putra, kelompok dua dipimpin Wakil Bupati H. Khazali, kelompok tiga dipimpin Sekdakab Aceh Singkil H. Ridwan Hasan SH.MM dan empat dipimpin Dandim 0109 Singkil Letkol Czi Dadang Rusmana. Tim Safari Ramadhan kata Sanusi akan melakukan kunjungan, berbuka puasa dan shalat berjamaah bersama di seluruh masjid yang telah ditentukan.(cb02)

Bupati Doakan Anggota Paskibraka Jadi Pemimpin Daerah

Waspada/Muhammad Riza

MACAT: Sehari menjelang meugang bulan Ramadhan, sejumlah ruas jalan di Kota Sigli mulai macet, seperti terlihat, Kamis (20/8).

SINGKIL (Waspada): Bupati mendoakan seluruh anggota Pengibar Bendera Merah Putih (Paskibraka) Kabupaten Aceh Singkil yang bertugas pada upacara peringatan detik–detik Proklamasi Kemerdekaan RI ke– 64 untuk menjadi pemimpin di daerah itu. Hal itu disampaikan H. Makmursyah Putra pada acara resepsi Senin (17/8) malam di pendopo Bupati Jl. Bahari Pulo Sarok Singkil. “Sebagai generasi muda penerus bangsa saya mendoakan anak– anak sekalian menjadi pemimpin daerah,” sebutnya. Dari 70 orang anggota Paskibraka Aceh Singkil tahun 2009, H. Makmursyah Putra berharap ada yang menjadi bupati, wakil bupati, Dandim, Kapolres dan pejabat untuk memimpin daerah ini. Hadir pada resepsi itu Wakil Bupati H. Khazali, Dandim 0109/Singkil Letkol Czi Dadang Rusmana, Wakapolres Aceh Singkil Kompol Ali Usman SH, dan lainnya.(cb02)

26 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM 4 CM

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 530i A/T Thn. ‘95. Black, mulus, VR 18”. BK 2 angka, sisa 19x... Hub. 061-77588500 DIJUAL JEEP TROOPER Pendek ‘84 Solar. BK Medan, Original, AC, Tape, Radial. Hub. 081 2646 3852

DAIHATSU Taft Ranger 4x2 Thn. 91. W. Biru met, Mls, AC DB, VR, BK. PS. Cantik. H. 45Jt/Nego. Hub. 0878 6886 5261

DAIHATSU Espass 1.3 Thn. 1996 W. Silver metalik. Pintu Sorong. BK Medan asli. Hub. 76654120 DAIHATSU Espass Th. ‘03 Warna biru met. AC DB, VR, BR, Injection Irit BBM cantik mulus. Harga Rp. 53 Jt/Nego. Hub. 0813 7027 6004 DAIHATSU Rocky Thn. 94/95 W. Hitam metalik. AC, Tape, VR, BR, BK Medan asli. PS. Body lempang, jamin mulus. H. Nego. Hub. 061-7760 9041

DAIHATSU Taruna CSX Thn. 2002. Biru metalic, BK Medan, AC, TV, Tape, Body mulus. Hub. 0813 9707 5605 OVER KREDIT MOBIL MURAH

DAIHATSU Espass Thn. 2004 mulus, kembali DP 19Jt. AC Dingin, Tape, TV, VR, Angsuran: 1,7Jt/35 bulan lagi. Cocok Untuk keluarga atau direntalkan, asuransi all Risk. Serius: 061-66477734 / 0813 9779 1077

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

ISUZU Panther Chalenger Th. 93. W. Biru metalic AC, Tape Kenwood. PS, PW, VR, BR, body sedang, mesin sehat. Jok kulit. H. Damai. Hub. 061-7620 9937

NEW DAIHATSU PROMO (DISKON + HADIAH) Xenia DP 15 Jt-an dan Angs. 2 Jt-an, Terios DP 20Jtan dan Angsuran 4 Jt-an. Luxio DP 7 Jt-an dan Angs. 4 Jt-an, Grand Max PU DP 7 Jt-an dan Angs 2 Jt-an. Hub. 0819 203 8742 / 061-77722561

MERCY Boxer ‘86 Hitam, mulus, Tape, CD, Sound System. Jarang pake. Mobil simpanan Rp. 45 Jt. Minat Hub. 0819 898868

“DAIHATSU PAKET MURAH”

Gran Max Pick Up ..DP 8 Jt’an Angs. 2 Jt’an Gran Max Mini Bus ...DP 15 Jt’an Angs. 3 Jt’an Luxio 15 D ...............DP 7 Jt’an Angs 4 Jt’an Xenia 1.0 Deluxe .....DP 12 Jt’an angs. 3 Jt’an Terios TX M/T ............DP 20 Jt’an Angs. 4 Jt’an Sirion D M/T ..............DP 20 Jt’an angs. 4 Jt’an Hub. WINDI HP. 0812 607 8052 Flexi (061) 77402067

DAIHATSU - MOBIL LEBARAN !!! Terios DP 21Jt. Luxio DP 7 Jt Xenia DP 17 Jt Pick Up DP 9 Jt Full Diskon + Hadiah Hub. Kalpin 0813 6109 2802

FORD Escape A/T. Thn. 2003. Silver Met, VR 18 Crom, BK Mdn Rp. 139Jt. Hub. 0812 6594 2789

# HINO P AKET MERDEKA # PAKET DP Ringan + Bunga Ringan. Gratis Bak Kayu dan Paket menarik lainnya. Hub. 061-766 981 86 0813 70 311 500

KIA CARENS II TAHUN 2005

SERIUS Hub. AGUSTINA (0852 7003 9888 / 7630 4788)

DAIHATSU Taft GT 4x4 Thn. 85. Sudah jadi (dibangun) lihat mobil dijamin tertarik, full sound sistem, velg cobra, Ban 31 cangkol 5 baru. PS, PW, CL, TV, Hrg. 60Jt. Nego. Hub. 0812 64777 088

ISUZU Panther Total Assy Th. 92. W. Abu metalik. AC, Tape, VR, BR, PS, BK Medan. Ban Baru. Body lempang, mulus. H. Nego. Hub. Jl. Letda Sujono Gg. Serasi No. 3 HP. 0813 9754 5210

DAIHA TSU B AR U PR OMO LEB ARAN !!! AIHATSU BAR ARU PROMO LEBARAN Gran Max PU............DP 8Jt-an, Angs 2 JT-an XENIA Li VVT-i.........DP 15JT-an, Angs. 3JT-an TERIOS TX VVT-i.......DP 23JT-an, Angs 4 JT-an Dapatkan Diskon Special & 3 T

Rp. 91.000 Rp. 104.000

PAKET DAIHATSU READY STOCK - Xenia VVT-I....DP Min 17 Jt-an - Pick Up Gran Max & Terios SUV... DP Min. 8 Jt-an & 23 J-an Sdh. trmask Angs 1, Grs. 3 Thn. & Ass. Allrisk Hub. TEDDY CAPELLA 77884663 / 0812 6325 656

Warna Hitam. BK Perpanjang. Kondisi mulus. Hub. 061-7756 1115 / 0813 6114 8120

DAEWOO / NEXIA ‘97 BK Medan, Siap Pakai. Mesin / Body Bagus. Hrg. 37Jt/Nego. Hub. 0813 6192 3201

7 CM 8 CM

MITSUBISHI BARU

Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319

MITSUBISHI LANCER EVO 3

Thn. 93. W. Hitam. Lengkap, sgt mulus, sehat. BK Medan asli, jarang pakai Hrg. 53Jt/Nego. Hub. (061) 77731399

9 CM Rp. 126.000 10 CM Rp. 140.000

TOYOTA Kijang Rover 1993. AC, VR, Tape, PW, Warna Abu2 met. D. Sedan mulus, siap pakai. Harga 47Jt. Hub. 0816 3130 912

TOYOTA KIJANG COMMANDO ‘93 Standard W. Biru. AC, BR, VR, RT, Mulus. H. Rp. 55 Jt. Nego. Hub. 0815 314 7717

DIJUAL BU TOYOTA Corolla DX Tahun 1982, warna hitam, mesin sehat, Harga Rp. 18,5Juta/damai. Hub. 0819 866 311.

TOYOTA Crown ‘89. Royal Saloon, Kulkas, Jok Elektric (Dpn Blkng). AC Triple Blower, Warna brown Impala (Original). BPKB 1 tangan (BK) Harga Nego. Khusus Peminat: 0812 6389 0999/ 061-7670 0007 (Bisa TT/OV. Kredit Avanza)

Gran Livina, X Gear, Xr, Xtrail, Serena, Navara, Latio, Bunga Rendah / DP Rendah/ Disc. Hub. 0812 6559 429 OPEL Blazer LT 2002 DOHC. Mulus, orisinil, W. Biru Mica, BK Medan, Tangan pertama, AC, Tape, Power, VR, BR, PWD, SL, PS, Cantik, siap pakai. H. 79 Jt Nego. Hub. HP. 0812 6477 946

TOYOTA Kijang Inova V Lengkap. Th. 2004 Bensin. Warna hitam, BK Medan asli. Harga 167,5Jt Nego. Peminat Serius Hub. 0812 6384 8050, 0813 6123 6076 Maaf TP. BU.

OPEL Blazer LT. 97. Mulus, orisinil, W. Hijau Tua. BK Medan lengkap. Siap pakai. H. 55 Jt. Nego. Hub. 0812 6477 946 Bisa Kredit.

OPEL BLazer Montera 2001. Mulus. W. Silver, BK Medan, AC, Tape, VR, BR, PWD, SL. Siap pakai. H. 60 Jt Nego. Bisa Kredit. Hub. 0812 6477 946

SUZUKI Carry Futura 1.3 dijual Thn. 94 Karoseri Alexander warna abu2 met. Masih tgn. pertama. Harga 35Jt/Nego. Hub. 0812 6000 9496 SUZUKI BALENO THN. 2000

W. Coklat muda met, AC, Tape, lengkap, mesin sehat. Body sgt. mulus. Orisinil, jarang pakai. Hub. 0813 7618 8118. Harga 80Jt/damai.

OVER KREDIT

SUZUKI APV 2007 Kondisi sangat baik. Asuransi All Risk Cicilan: 3.835.000 Udah byr 8x BK 101 Ok. Mdn Asli. Hub. 0852 6267 0302

SUZUKI Escudo 2.0 Thn. 2004. Coklat met, Plat BH. Rp. 122Jt. Hub. 0816 3113 953 DIJUAL 2 Unit Mobil Kijang Grand Extra Thn. 94 W. biru metalik. H. 71 Jt Nego. Kijang Grand Extra Thn. 95 W. Abu2 tua metalik. H. 74 Jt Nego. Hub. 0812 6443 004 / 7777 8725

TOYOTA Kijang Thn. 95 Jantan Raider G BK Medan. 1 Tangan, AC DB, Power Steering. Warna Hitam met. Peminat Langsung. Harga 59 Jt. Nego. HP. 0812 6044 363 TOYOTA Soluna XLi Dijual Cepat (BU) Thn. ‘03 biru met, BK Mutasi, AC, Tape, V. Racing. Mulus, a/n. Pendiri. Hub. 0813 6570 5526

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

TOYOTA Kijang Capsule Tipe New pemakaian 2001 W. Abu2 metalik. BK Mdn, AC, Tape, PW, CL, Remot, Ban Baru, Pelak import, mulus original BU. Hub. 0813 7572 1097 Mdn.

TOYOTA Corolla Twin Cam Dijual 1.600cc Th. 89 w. hitam lengkat AC, Tape, VR, BR, Hub. 0813 7024 9370

NISSAN PROMO LEBARAN

11 CM Rp. 165.000 12 CM Rp. 180.000

TOYOTA Kijang Super Long Thn. 94 A/C. TP. W. Abu2. Hub. 0852 7590 9601

WASPADA

TOYOTA Avanza G Th. 04 warna biru met. Hub. Jl. G. Krakatau Gg. berkat 1 No. 6 HP. 0813 6104 7788 TOYOTA KIJANG LSX THN. 2003 AC, Tape, VR, BR, Original Rp. 117 Jt/ Nego. Hub. 0816 310 4197 / 7790 5359 TOYOTA 100% BARU

AVANZA (READY),RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. AVANZA Dptkan Paket Lebaran Hub. 0813 7512 7297 - (061) 7795 1428

DIJUAL ANGKOT Mini Wampu Tr. 123 Daihatsu Espass Th. 2002. Mulus, cantik, siap pakai. Hub. 0852 6128 0060, 061-77663375

DIJUAL KIOS MOBIL Untuk Jualan. BK Hidup, sama isi semua. H. 12Jt Nego. Hub. 0812 6472 6918

xpress

Jumat, 21 Agustus 2009

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Bursa

TRUK GRATIS BAK KAYU Type 110 PS/130 PS DP Angs. Ringan. Oli Gratis. Info 0812 6426 2000

SERVICE/AKSESORIS MOBIL

Bursa

POWER STEERING

BUTUH UANG

ANDA BUTUH DANA

Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

AND AB UTUH D AN A TUN AI ??? ANDA BUTUH DAN ANA TUNAI Kontan dan Cepat, Jaminan BPKB Mobil Thn. ‘92 Up. Proses Cepat, BPKB Aman, Dana Langsung Cair. Hub. Mr. Yan’s: 061-91099966, 0815 344 70666

BUTUH DANA / KREDIT MOBIL

Jaminan BPKB Mobil Min Thn. 89, Truk & Pick Up Th. 93. Via Leasing, Angsuran bisa diketahui. Hub. (061) 7731 1945 / 0813 7000 0055 ANDA BUTUH DANA

Jaminan Sertifikat Rumah, BPKB dan Leasing Mobil. Proses Cepat. Hub.06177627838, 0852 758 79788 - 0811 65 7838 ANDA BUTUH DANA TUNAI

Jaminan BPKB Mobil/Sepeda motor, BPKB terjamin & Aman. Proses cepat, Data bisa dijemput, Bunga Ringan. Silahkan buktikan. HP. 061-66477734 / 0813 9779 1077

Bursa

SEPEDA MOTOR

PAKET MERDEKA SP. MOTOR SUZUKI All Smash DP 800rb + Hadiah Langsung All Shogun DP 1,3Jt + Hadiah Langsung All Spin DP 800rb + Hadiah Langsung Sky Drive DP 1,5Jt + Hadiah Langsung Satria FU 150 DP 3 Jt + Hadiah Langsung Menerima Tukar Tambah Semua Merek / Data Bisa dijemput. Hub. Dealer Resmi kami : SUN MOTOR (Depan Kodam 1 BB) Tel.: 8440241 / 77613995 - 0813 7592 6735

SUZUKI Spin 125cc ‘08 Rp. 8,5Jt. Mulus. Mesin bagus, jarang pake. Revo ‘07 kuning CW Rp. 8,5Jt. Jual salah satu. Hub. 0819 89 88 68

Bursa

RENTAL MOBIL IKHLAS RENT CAR

Dalam Kota: Innova G 300rb, Avanza G: 270rb Luar Kota: Innova G 350rb, Avanza G : 330rb Termasuk supir diluar BBM. Hub. 0852 61182 406

RENTAL MOBIL MURAH 1 hari - 200rb (sudah pakai supir). HP. 061-66477734 / 0813 977 91077 (Hanya Khusus Muslim)

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Specialist

Menerima Pemasangan Baru, Service dan Tersedia Sparepart Power Steering Hubungi: BOTAK SENG

Jl. Krakatau No. 58 Telp. (061) 4559108 - (061) 6641001

Bursa

ELEKTRONIK DI, JUAL ELEKTRONIC, BARU&BEKAS

TV, PS, DVD. SPK, Ampli, Handicam, Camera, Proyejtor, Laptop, Fax, AC, Kulkas, M. Cuci,Genset, Keyboard,dll. 1.TV 19” LCD Sharp, Aquos =3 Jt, 50” Proyejtion Toshiba= 6Jt, 34” Sony =2,5jt, 29” Baru Bekas, 900rb s/d 2,3jt, 14/ 21 Baru/Bekas, 300rb s/d 975rb. DVD Cina=270rb H. Teater LG=1,2jt. 2.PS 3=3Jt, PS 1=400rb, PS2=1,1jt, DVD Portable=975rb, 3.AC 1/2 - 1 Pk - 2Pk=1,3jt s/d 2,3Jt. 1Pk Windo=700rb, Air Cooler=975rb, Kulkas 1pt-2pt Jumbo = K. Box, K. Sokes=600rb s/d 2 jt. M. Cuci, 1 tb- 2 tb=, Baru/Bekas 600rb s/d 1,4Jt. Genset 4000 W = 2jt-9000 W=6,5jt - 7500 W=4,5Jt 4. Handicam, HI-8-Mihi DV-HD, Sony-JVC-Samsung 900rb s/d3jt. Camera: 4 Mp - 12Mp=500rb s/d 1,9jt. Laptop P3=2jt, Axioo 2 Core= 4,5Jt, Proyejtor HP=5jt, Fax=600rb. 5. Compo 4500W: Politron, ATW A = a.Rp.1,2jt. Ampli - Akualizer - Mixer - Spk: BMB, Harman Kardon, Yamaha, Keyboard, KN-7000 Yamaha DGX-630, dll. Hub. UD SENANG HATI 4577146 - 77073637, JL. SEKIP 67A,

NB: Jual/Beli/T.T. Baru/ Bekas. Terima, VISA / Master Card.

JUAL & BELI TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. Jl. Setia Budi No. 424B Dkt. Ring Road.

Service

ELEKTRONIK

AC

AC

MURAH / BARU

Hanya Rp. 2.090.000 + Pipa + Kabel + Garansi Cuci AC Rp. 20.000

NB: Bongkar Pasang, Tukar Tambah, Service

Hub. Sumatera Jaya Jl. Gatot Subroto 401 dekat Simpang Barat Tel. 6963 8880 - 77555550 HP. 0813 9730 5020

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat

AHLI TOSHIBA, SONY, LG, SAMSUNG, POLYTRON,

TV

SANYO, JVC, AKARI, SHARP, TV CHINA, DLL

Siap di Tempat, Murah, Bergaransi

HARIS, 77091118 - 0812 6311011

Bursa

ALAT MUSIK DIJUAL KEYBOARD

Jual, Keyboard, KN-7000, Yamaha GDX 630 Ampli/ Spk: BMB, Yamaha, Harman Kardon. Hub. 0813 6240 4002. Senang Hati, Jl. Sekip 67 A.

Bursa

PHOTO COPY

ZIDAN GAME PS GARANSI 13 BLN

PS2 BARU Rp. 1.250 ribu PS1 Rp. 350 ribu. HDD Rp. 1.795 Ribu. PS 2 RP. 850 Ribu, PS 2 + TV 21” RP. 1.500 Ribu. NB: Terima Service. Jual/Beli PS, PSP, Laptop. Tel. 77418902 Jl. Sei BT. Hari No. 2 / AR. Hakim 104

Alamat: Jl. Gatot Subroto Dalam No. 6J & 8 L Medan

HILANG / TERCECER TELAH HILANG

Bursa

KOMPUTER

OBRAL LAPTOP MURAH TERDAHSYAT 2009 Miliki Segera....!!! Laptop, ok Kwalitas import, merk terkenal. sep. Toshiba, Acer, HP, Dell Didesain dgn tampilan menarik sehingga lebih berkelas & bergengsi. Internet Wifi Connection, bluetooth, multimedia, komplit & sdh. siap pakai. Kunjungi Segera.....Mencoba sampai puas oke2 saja. - Medan Mall Lt. Dsr - 0812 6455 7274 Hrg. - Millenium Lt. Dsr - 0813 70711319 Mulai - Medan Plaza Lt. Dsr - 0812 6085 2666 - Paladium Lt. Dsr - 0813 7666 9353 - Aksara Lt. Dsr - 0813 9742 2213 - Binjai Super Mall - 0813 6125 4113

2

Jt-an

LAPTOP 2 nd - LX 300 + - LCD - PROJECTOR Toshiba Dell core2duo/1gb/160/wifi/DvdRW/m/L Rp. 4.9J *axioo 12 Inc-core2-2.0/1/160/Rw/WebCam/Wi . ..Rp. 4.55Jt acer Core2-2.0/1/80/dvdrw/Web/Cam/wifi...Rp. 4.5J *MSI Core2 1.6/512/80/Rw/Wifi/M/Lan Rp. 3.2Jt zyrex Core2 Duo 1.8/2Gb/120 Web Cam/Wifi Rp. 4.3 *MSI Core2 1.73/1Gb/80/Rw/Wifi/M/Lan Rp. 3.8Jt zyrex Core2 Duo 2.0/1Gb/160/Web Cam/Wifi Rp. 4,4 *Zyrex Core2Duo 2.0/1G/160/Rw/W.Cam/Wifi Rp. 4.5/Grs Hp CQ 40 AMD X2-2.0/1 Gb/250/W.Cam/ATI Rp. 4.8Jt *acer AMD X2-2.0/1Gb/160/W.Cam/NVDIA/DVDRW Rp. 4.8Jt 12 inc-X WareCore2-1.7/1 Gb/120/Web Cam/Rp. 4.4Jt *12 i n c-Xware Core2 1.8/1G/160/Rw/W.Cam/M/Lan Rp. 4.5Jt LCD-PROJECTOR Toshiba - LX 300 + Lengkap - Accesoris LAPTOP & PC-Murah - Cantik & Bagus.

1 Sertifikat Hak Milik No. M. 1005, SV No. 00886 An. Haji Sadikin. Desa Sidodadi R. Kec. Beringin, Kab. Deli Serdang.

TER CECER TERCECER

1 (Satu) Buah BPKB Asli STNK BK 3687 KG a/n. Siti Cairani. Alamat Jl. Raya Menteng Gg. Mangga No. 6 Medan Denai.

TELAH TERCECER

1 (Satu) buah BPKB dan STNK Sepeda Motor Honda NF 100 TD An. Makmur PA No. Mesin. HB 62 E - 1028 942 No. Rangka. MHIHB 62117K035659 Alamat Dsn. Nanasan DS Namo Teras Langkat.

HILANG BPKB

Mobil Toyota Soluna 1500 GLI 2002 BK 67 RR. a/n. Salbani Br. Pakpahan. Alamat Tasbi II Blok IV No. 118 Medan.

TELAH HILANG

DIJU AL HP BB BOLD 9000 MURAH DIJUAL

1 Buah STNK BPKB Sp. Motor Honda Tiger 2000 BK 2428 CJ. a/n. Kapten CPM Indra Bherti. 1 Buah STNK Mobil Mercedes BK 2 NG a/n. Antonius. Hilang di Jalan Darussalam. Bagi yang menemukan mohon hub. 0813 6179 7969

JUAL BLACK BERRY Storm 9500 Rp. 3,5 Jt

PERCETAKAN

Metro Star Com - Plaza Millenium Lt. 3 - Excalator belok kanan (tel.68796700) - Libur Buka

Bursa

KOMUNIKASI

Langsung dari Batam. Hanya Rp. 3.800.000. Harga nego. Pengambilan 4-10 Unit. Stock Terbatas & Beberapa BB LAINNYA. Hub.: Bpk. AMSYORI 0813 8525 7977

Bursa

Javelin 8900 Rp. 3,3 Jt, Bold 9000 Rp. 4,1 Jt Iphone 3G 16. GB Rp. 8 Jt & NOTE BOOK NOKIA ESeries NSeries GARANSI Pemesanan Diantar Telp: 0813.7034.6677

www.anekamodem.com

Modem 3.75G Sierra 885U, 875U, Hvawei E160, E169. Novatel 950, T-Flash, Mulai Rp. 4xxrb Call. 061-91150607

HarianWASPADA Tempat Iklan Anda

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA Untuk informasi lebih lengkap hub JL. JEND. GATOT SUBROTO NO. 198-A TEL. (061) 415 5678 - MEDAN JL. IR.H. JUANDA NO. 29-31 TEL. (061) 7350 777 - MEDAN JL. SEI BATANG HARI NO. 6 TEL. (061) 4555928 - MEDAN

TEL. (061) 4576602 FAX. (061) 4561347

Ekonomi & Bisnis

WASPADA Jumat 21 Agustus 2009

Ekonomi RI Hadapi 10 Tantangan akan terjadi. “Pembangunan ekonomi nasional 2010 menghadapi berbagai tantangan dari global dan domestik harus kita jawab dengan langkah-langkah tepat, terukur, nyata dan komprehensif,” ujarnya dalam pidato di Sidang Paripurna membahas RAPBN 2010 di Gedung DPR, Senayan, Jakarta, Kamis (20/8). Dikatakannya ada 10 tan-

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Bursa

PENDIDIKAN

PENDIDIKAN TENAGA KESEHATAN AKADEMI FISIOTERAPI SITI HAJAR MEDAN

SATU-SATUNYA TERAKREDITASI “B” DI SUMATRA

Ngapain kuliah lama-lama Program Pendidikan 1 Tahun

SUMATERA FLIGHT

PRAMUGARI STAF AIRLINE STAF CARGO

PENERIMAAN MAHASISWA BARU T.A. 2009/2010 PENDAFTARAN MULAI SEKARANG !!!

LEBIH MUDAH BEKERJA Informasi lebih lanjut hubungi: Kampus AKFIS SITIHAJAR MEDAN

Jl. Jamin Ginting No. 2 P. Bulan - Medan (dekat Kampus USU) Telp. (061) 3008.4600 - 7784.6199 C/P: 0812.6051.835 (Sulaiman) 0813.6159.6851 (Ani)

AKADEMI PERAWATAN

MALAHAYATI MEDAN

FASILITAS PENDIDIKAN: 1. Disediakan Informasi Kerja 2. Penempatan On The Job Training (OJT) 3. Pembimbingan dan Pendampingan Mahasiswa mulai kuliah, tes recruitment maskapai, sampai dengan tanda tangan kontrak kerja (bila lolos tes maskapai) 4. Seragam dan kelengkapannya 5. Disediakan Asrama ber-AC PERSYARATAN: 1. Min. Lulus SLTA / sederajat 2. Usia Maksimal 23 tahun 3. Tinggi Badan Putra Min. 165 cm 3. Tinggi Badan Putri Min. 158 cm 4. Berat Badan Proporsional 5. Pas Photo 2x3 & 3x4 berwarna @ 1 lbr 6. Foto Fullbody 3R 1 lbr

Layanan Informasi Kampus SUMATERA FLIGHT Jl. Jamin Ginting Padang Bulan Perum. Citra Garden Blok A5 No. 12-15 Medan Tlp. 061-76592592/SMS 081-375555465

Berdasarkan izin MENDIKNAS RI NO. 258/D/O/2008 MENERIMA MAHASISWA/I BARU T.A. 2009/ 2010 LULUSAN: SMU/ SMA/ SPK/ SMK/ MADRASAH ALIYAH

Kampus Akademi Perawatan Malahayati Jl. Cendrawasih No. 161 Sei Sikambing B Medan Telp. (061) 845.2445 E-mal: akper_malahayati_medan@yahoo.com

“TERAKREDITASI”

MENERIMA MAHASISWA/I BARU A. Program Sarjana (S-1) 1.Kesehatan Masyarakat (SKM) 2.Keperawatan (SKp)

B. Diploma-III (D-III)

1. Akademi Keperawatan (AKPER) 2. Akademi Kebidanan (AKBID) 3. Akademi Analis Kesehatan (AAK) 4. Akademi Analisa Farmasi & Makanan (AKAFARMA)

C. Menerima Lulusan:

Informasi selanjutnya & Pendaftaran:

Kampus Pendidikan Sari Mutiara Jalan Kapten Muslim No. 79 Medan Telp. (061) 847.6769 HP. 0813.6209.2630

POLTEKKES Dr. RUSDI PRODI D-III & D-IV FISIOTERAPI Berdiri Sejak 1987 Terakreditasi

PELOPOR PENDIDIKAN FISIOTERAPI DI SUMATERA Telah Meluluskan 19 Angkatan Yang Tersebar ke seluruh Indonesia Menerima Mahasiswa/i Baru T.A. 2009/ 2010

Angkatan: XXIII

Pendaftaran s/d Agustus 2009 Uji Tulis: Tgl. 24 Agustus 2009 Informasi/ Pendaftaran:

1. KAMPUS A

Jl. H. Adam Malik No. 140-142 Telp. (061) 661.4941

2. KAMPUS B

Jl. H. Sutan Oloan No. 1 Pondok Surya Telp. 846.4282 08.00-15.30 Wib setiap hari kerja

CP: 0852.9725.2579/ 0819.824.289/ 0812.1880.0269

(Dilengkapi Perangkat Pengajaran, Kunci Pembahasan u/ eksak, Listening u/ Bhs. Inggris)

A. KOLEKTOR (LK) B. KOLEKTOR/ EKSEKUTOR (LK)

Dengan syarat-syarat sbb: Ad. A & B. Pria, WNI, Umur max. 35 tahun, minimal tamatan SLTA, rajin, jujur, berwibawa dan sanggup mengatasi masalah di lapangan, diutamakan yang sudah berpengalaman dibidangnya minimal 1 tahun, harus memiliki kenderaan sendiri/ BPKB dan SIM C Surat lamaran di kirim langsung ke harian “WASPADA” lengkap dengan daftar riwayat hidup, pas photo 2 lembar, foto copy KTP, ijazah tamatan terakhir dan cantumkan no. Telp/ HP, selambat-lambatnya tanggal 25 Agustus 2009, dengan kode (SGR ‘09)

LOWONGAN KERJA RESMI KE >>> MALAYSIA <<<

Kilang Electronic terbesar di Malaysia: 1. TEXAS INSTRUMENT (M) SDN. BHD Ampang, Kuala Lumpur 2. FREESCALE SEMICONDUCTOR Sungai Way, Selangor 3. OSRAM OPTO SEMICONDUCTOR (M) SDN. BHD Bayan Lepas, Penang 4. STMicro Electronics (M) SDN. BHD Muar, Johor

PT. DHAFCO MANUNGGAL SEJATI

Bursa

LOWONGAN KERJA

DICARI Sgr 25 Lls SMU/ Sdrj U/dididik dan di slrkan menjadi Staff Airline Hub: Jl. KH. Wahid Hasim 92 Medan Tp. 4533875, 4569269 Jl. Karya Wisata No. 23 A Johor TP 7861690 Medan

DIBUTUHKAN SEGERA

Bidan utk klinik bersalin diutamakan yg sdh berpengalaman Hub. Ibu Hj. Farida Hanum Marbun HP. 0812.6039.6712 atau Telp. (061) 734.2968 LOWONGAN KERJA

Sebuah Perusahaan Jasa Outsourching Security membutuhkan tenaga kerja sebagai:

- MARKETING EXECUTIVE (A) - SECURITY (B)

Persyaratan: - Pria/ wanita tamatan min. SMU sederajat (A, B) - Usia max. 34 tahun (A, B) - Berpengalaman sebagai Marketing/ Pemasaran (A) - Berpenampilan menarik (A) - Berbadan sehat dan tegap (A, B) - Tinggi badan: - Pria: min. 168cm (B) - Wanita: Min. 160cm (B) Tinggi dan berat badan ideal - Mempunyai kenderaan sendiri (A) - Melampirkan Daftar Riwayat Hidup, Referensi kerja, Pas photo 3x4; 1 lembar (A, B) Lamaran diantar langsung ke:

WIRA SECURITY ORGANIZER

Jl. Jend. Gatot Subroto No. 325A Email: wirapradanamukti_wso@yahoo.co.id Telp. (061) 451.4008 - 415.7905 Fax. (061) 415.2041 (depan Berastagi Supermarket)

PAKET MERDEKA

Jl. Halat Ujung/ Megawati No. 30 Medan Telp. (061) 732.5534 (061) 734.0570

Bursa PROPERTY Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

Jl. Ileng Marelan

Jl. Sidodadi - Eka Surya - JOHOR

TAMAN GRAND PERMATA HIJAU TAMAN PERMATA HIJAU Type: 45/ 98, 55/98, 55x112 & 65/112 UANG MUKA HANYA 10 JUTA

DIJUAL

1. Rumah di Komplek Citra Menteng Blok A No. 05, LT. 13x11m, LB. 11x11m, 2 Lt, 3 KT, 3 KM, PLN, PDAM, Keramik + Perabotan, SHM 2. Tanah di Desa Sei Rotan - Deli Serdang Km. 13 depan Kampus Akper Harapan Mama, LT. 25x272,8m Serius hub. (061) 7714.3458 0812.6578.546

GARU RESIDENCE

HUNIAN MERIAH DENGAN KEINDAHAN DESIGN TROPIS MINIMALIS JL. GARU I - SM. RAJA - MEDAN

Hotline: IRFAN: 0813.6100.7012 - (061) 7791.2296 WIWIT: 0813.7606.2830 - (061) 7795.0955

Rk. 2½ Tkt, Lengkap IMB, SHM, Luas Bangunan 4x20m, Lt. Krmk, Tiap lantai 2 Km, Hal Kanopy, Samping bangunan bebas udara, PLN, Air PAM, Tersedia Sanyo dan Tangki air 1000 lt di Lt. 3, Tembok keliling, Alamat Jl. Menteng 7/ 39 B Samping Ktr Pos, Lokasi sgt strategis, Cocok bisnis/ kel. Hub. 08126047373 Harga Rp. 700 Jt/nego (TP) INDAH JAYA

Kami Bergerak dibidang Jasa Bangunan dan Siap Renovasi Rumah Anda. Dijamin Rapi dan Memuaskan Anda Hub. 0813 7543 1894 (R. BUDI) 2 RUMAH BARU SIAP HUNI: 1. Villa Palem Jari Indah, Jl. Persatuan II Desa Mulyo Rejo Jl. Medan Binjai, Km 11,5, Tipe 77 & 54 2. Jl. Irian Gg. Pembangunan Dalam No. 142 Kota Tj. Morawa Tipe 104/ 90, Bisa kredit Hub. 0813.96544.077 - (061) 9103.4955, Ada komisi agen

RUMAH Dijual, 3 KT: 3x4, 2 KM, RT: 4x5, RK: 4x8, 1 Garase 3x5, hal 2 mobil, Jalan utama, Uk. Tanah 7x22m, SHM, 300 meter dari UISU Hub. 0812.1046.7497

RUMAH DIJUAL

Rumah 2 Tingkat (Taman Kyota Blok C-6) Jl. Setia Budi/ Jl. Mesjid, Aman Security 24 jam Hub. 0813.7563.2174

DIJUAL RUMAH SIAP HUNI

Di Jalan Pasar I Sunggal, SHM Lengkap Rumah masih baru Harga 400 Juta, Bisa nego Hub. 0813.9767.1967 - 0812.6521.6868

RUMAH DIJUAL CEPAT Jl. Sei Sikundur No. 7 Medan Baru, 2 Tkt, LT. 14,5x25,5m, 7 KT, 6 KM, Dpr 2, Ltk Strategis, Dkt Medan Plaza, Harga nego Hub. 0813.6191.9366 HOME INDUSTRI

Rumah permanen keramik 3 kamar dan garasi. Luas tanah 430meter, keliling tembok, dapat dijadikan industri rumah tangga. Lingkungan hijau dan nyaman. Lokasi Jl. Pengabdian Gg. Satria Desa Bandar Setia Harga Rp. 325 Jt Hub. 0811.609.752

DIJUAL CEPAT 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka 9 Gedung Johor. Ukuran tanah 15 x 24 M2. Ukuran rumah 12 x 16 M2. Kamar 4 buah, Garasi 1 buah, SHM, IMB. Hub.0819 2112101

DIJUAL MURAH Rumah Permanen 8x20m, SHM KT 3, KM 2, Full keramik Jl. Letda Sujono Gg. Pembangunan No. 13, Harga 110 Jt Hub. Pangeran (061) 6690.3889

Segera daftarkan diri anda sekarang juga di:

PT. KARYATAMA MITRA SEJATI SIUP NO: KEP.645/MEN/2006

Jl. William Iskandar/ Jl. Pancing No. 41-42 Medan Telp: (061) 735.9868 *BEBAS BIAYA PENDAFTARAN*

SURYAMAS PROPERTY GROUP

Bursa

lai Rp. 20 Jt Mu atau Angsuran 1,6 jt-an*

Kebuh Sawit 9 Ha dan 4 Ha, 30 menit dari Rantau Prapat buah besar, terawat Hub. 0813.7006.6619 - 0811.656.728 0813.7637.7187 Letak Sipare-pare, Kec. Merbau

TANAH KAPLINGAN DIJUAL Daerah Kowilhan Namorambe, SK Camat 1. Jl. Pertanian Uk. 11x17, Harga Rp. 20 Jt 2. Jl. Madrasah Uk. 14x17, Harga Rp. 40 Jt Yang serius hub: (061) 7704.4550/ 0813.9719.9199

Surat Kabar Tercinta:

TANAH DIJUAL CEPAT

Harian

Tnh di tengah kota Medan, SHM, Uk. 51m (P) x 24m (L) Lok Jl. Suka Jaya (dekat Ktr Lurah Sukamaju) STM Kpg Baru, Sudah pagar beton keliling, Harga damai Peminat (Muslim) Hub. 0813.6362.1588

WASPADA Untuk informasi lebih lengkap hub

KEBUN K. SAWIT DIJUAL

TEL. (061) 4576602 FAX. (061) 4561347

Luas :125 Ha Lokasi :Ajamu - L. Batu Kondisi :40 Ha, Sudah menghasilkan dan 85 Ha TBM ke 2 (dua) Legalitas:SK Camat Harga :Nego Yg berminat dapat menghubungi: (TP) HP. 0813.7036.062

DEPOT AIR MINUM Kalau mau pasang murah dan bagus Belanja Barangnya Aja

Bursa

“P AND AN PUTIH” “PAND ANDAN

BUSANA / AKSESORIS

Hub. 081361 309280/ 77642 832

PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan

Service

Paket PAKET JULY KEJAR MERDEKA XENIA

Lokasi :

ALBANIA

Dp min. Rp 6jt/6bln(4x) Dapatkan Undian**

1:50 Orang saja

Grand Prize !!! Daihatsu XENIA

Tunggu apalagi...!

Harga naik!!! 1 Ags’09

Buruan!!! Stok

* Promo & Discount untuk Transaksi t’batas! Feb s/d Juli 2009 ** Syarat & ketentuan berlaku www.rivegamora.com

Pemasaran Hub:

V

Telp/Fax

:

061-7360695

Jl.Letda Sujono 38/12 Simp Jl.Mandala ByPass

Hotline: 085297100575/ /085270500061 081973048763/081260272755/081265492188

Bursa

Model Terbaru

SEGERA DIBANGUN !!!

HARGA PERDANA (u/8 unit pertama) !!!

Telp. 76352865 735.9504 ADA GARANSI

WC

Tumpat Sedot

KRISNA WATER PELUANG BISNIS

1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro

Jl. Setia Budi / Tj. Sari Telp.: Flexi:

WC WC

Rp. 22 Jt s/d 38Jt

8442271 77944642

Jl. Gatot Subroto Medan

M. SAFII

Rp. 230.000 / Tangki

HUB: 0812 6040 8948 0812 655 4890 061-7647 9447

UNTUK KONSULTASI HUB:

CINDY: 0812.6000.836 - 7787.0836

Hub. 8219951 Jl. Setia Budi No. 2

Menyediakan Mesin RO dan Yamaha Hubungi: CV. HYDRO UTAMA Jl. Kapt. Muslim No. 53-d Medan Telp. (061) 8457879 / (061) 77839790 HP. 0812 600 5410

TUMPAT/ SEDOT

77442112

Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725 Mobil. Sedot

Jl. Brayan Medan

PAK ADI HP.

ELDASOFT * Utk: - Toko - Bengkel - Swalayan - Produksi - Grosir * Garansi Seterusnya Single User 1 Juta Multi User 2 Juta SEMUA COMPUTER Telp. 0888.503.8877/ 0812.350.3536

MINI & EFEKTIF

Bursa

PERABOT TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802

JL. KARYA AMAL MEDAN JOHOR

Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Tgl. 15 Agustus ‘09 Pkl. 22.30 Wib (Live)

Hunian Asri, Nyaman & Strategis - Type 60/ 108 dan Tipe 65/ 126 - DP Dapat dicicil, Bisa KPR - SHM, Listrik, PDAM - Bonus 1 buah AC untuk pembelian di Bulan Agustus

DHARMA MUDA UTAMA PROPERTI

Contact Person: M. ZULFAN (061) 9137.9033 DEDI (061) 7675.0611

Call Center: 0818 090 73481

Menjual/ Menerima tempahan & reparasi ukiran Jepara, Kursi, Lemari, Alat-alat pengantin

Pengobatan Alat Vital H. Suhendar

Jl. Denai No. 205 HP. 0852.9708.6572 Cabang Tg. Morawa - L. Pakam Km. 18,5 No. 40 Telp. (061) 9123.5036 Medan

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

TANAH

MURAH SIAP BANGUN

BONUS LANGSUNG YAMAHA MIO !!* TANPA DIUNDI *selama masa promosi

SOLUSI TEPAT:

- MENCECILKAN PERUT BUNCIT - TETAP BERENERGI DI BULAN PUASA - GEMUK SETELAH MELAHIRKAN

ANDA TUMPAT - SEDOT

2. Air Pegunungan 6700 s/d 7000 Liter

KAPLING PERUMAHAN

Pasar 1 Setia Budi Jl. Pribadi 3 (depan Sekolah Namira) DP DAPAT DICICIL !!!

DIET SEHAT PUASA TETAP LANCAR (TURUN/ NAIK BERAT BADAN) 3 - 7 KG/ BLN

WC TUMP AT SEDO T TUMPA SEDOT

FURNITURE

- (061) 7771 9875 - (061) 7647 9447

PUASA PENUH ENERGI DENGAN NUTRISI

WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078 NARO SERVICE Jl. Sisingamangaraja

JEPARA

HOTLINE:

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161

SPRING BED DIJUAL MURAH

KHUSUS MUSLIM

�BISA KPR �BONUS PERABOT �UNIT TERBATAS

Bursa

PENGOBATAN

KONSTRUKSI

PELUANG BISNIS

Harga Ter Murah

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di...

PROGRAM COMPUTER

Kesempatan anda sangat besar !

AIR MINUM

DIJUAL

Bursa

Alam Bantan Indah Tahap III

Bursa

MATERIAL BANGUNAN

RAGAM

LOWONGAN KERJA RESMI KE MALAYSIA

Dibutuhkan Tenaga Kerja Wanita untuk di pekerjakan pada Perusahaanperusahaan Elektronics di Malaysia sbb: - ELNA PCB SDN. BHD di P. Pinang (Company Langsung) - MATCH TECHNOLOGY SDN. BHD di Melaka (Company Langsung) - ALL VISION TECHNOLOGY SDN. BHD di Melaka (Company Langsung) - JYE TAI PRECISION INDUSTRIAL SDN. BHD DI IPOH (Company Langsung) Syarat-syarat pendaftaran dan seleksi: - Wanita umur 18 s/d 30 tahun - Pendidikan minimal SMP/ sederajat - Membawa Foto copy Ijazah dan KTP masing-masing: 1 lembar - Pas photo berwarna ukuran 3x4: 2 lembar Fasilitas-fasilitas lain yang diberikan: - Asrama dan perlengkapannya - Transportasi dari asrama - kilang asrama - Perlindungan asuransi kecelakaan kerja 24 jam - Klinik kesehatan - Levy/ Pajak disubsdi oleh kilang 100% * Berangkat ke Malaysia naik Pesawat terbang * Biaya penempatan sebagian bisa di bayar melalui potongan gaji setelah kerja di Malaysia “SELEKSI DILAKSANAKAN SETIAP HARI KERJA”

UANG MUKA HANYA 10 %

Hotline: AIDA: 0812.6028.6248 - (061) 7719.8522 TUTI: 0813.9632.0898

JUAL CEPAT MURAH

Mau Pindah Rumah & Perabot, Hanya Rp. 360 Jt, Ring route Setiabudi Kompleks Villa Malina Hub. (061) 821.1488 - (061) 7780.5813

Type: 55/112, 65/120 Dekat Sekolah Yayasan Taman Harapan

FASILIT AS ASILITAS - Taman Bermain - Lap. Badminton & Jogging Track - Sertifikat, IMB, Listrik, PDAM - Security

DIJUAL CEPAT RUKO

produk tersebut diluncurkan 2004. Bertepatan adanya ajang bergengsi taraf internasional perlombaan perahu layar dari Darwin ke Ambon yang sudah berlangsung dari tahun 1976 sampai 1998 dan baru aktif lagi pada 2007 sampai 2009. Kuku Bima Energi yang merupakan minuman energi untuk memulihkan stamina sangatlah tepat menjadi sponsor acara ini. Karena perlombaan perahu layar dalam waktu lama dengan jarak tempuh yang panjang akan sangat menguras energi. Kuku Bima Energi merupakan salah satu minuman untuk penambah stamina.(rel)

TAMAN JOHOR MAS

FASILIT AS ASILITAS - Kolam Rekreasi & Taman Bermain - Lap. Tennis & Jogging Track - Mesjid - Sertifikat, IMB, Listrik, PDAM - Security

SURYAMAS PROPERTY GROUP

Ke Ambon

MEDAN ( Waspada): Kuku Bima Energi yang merupakan salah satu produk unggulan PT Sido Muncul mengadakan beberapa acara di Ambon. Kunjungan Kuku Bima Energi, barubaru ini, langsung dipimpin Direktur Utama PT Sido Muncul Irwan Hidayat . Disamping merupakan salah satu sponsor Darwin Ambon Yacht Race 2009, juga menggelar pertemuan grosir, kunjungan ke pasar dan sumbangan sosial eks korban bencana sosial di Ambon. Pada kehadiran kali ini tak lupa bintang iklan Kuku Bima Energi Dony Kesuma meramaikan road show. Road show Kuku Bima Energi di Ambon merupakan kali pertama sejak

PAKET MERDEKA

DAPATKAN SPESIAL DISCOUNT Discount Rp. 10 Jt s/d 15 Jt Untuk 4 Unit

TERIMA KOST

U/ Mahasiswi muslim dekat USU, UMA, Kmr Baru, Luas, Kmr mandi dlm di Jl. Abadi/ Perjuangan Setia Budi Medan Hub. (061) 7629.1648 - 0811.633.585

dengan meneruskan program-program pro rakyat. Keempat, menciptakan iklim investasi lebih baik dengan meningkatkan upaya penegakan hukum, harmonisasi UU kebijakan penanaman modal, mengatasi kemacetan pada masalah pertahanan dan tata ruang, dan perbaikan birokrasi diarahkan meningkatkan kualitas. (dtc)

DAPATKAN Spesial Discount di Agustus Rp. 20.000.000

Untuk Wilayah: SELURUH INDONESIA HUBUNGI: Telp. (0271) 733.994/ 723.036/ 723.046 HP. 081.744.0365 - 081.2153.5440 (no SMS) email: graha.pustaka@yahoo.com

DIBUTUHKAN SEGERA

Kuku Bima

Kedua, belajar dari krisis 1998 di Indonesia dan krisis ekonomi dunia saat ini, maka perekonomian Indonesia harus dibangun dengan bertumpu pada sumber pertumbuhan domestik dan berbasis kewilayahan. Ketiga, Indonesia masih perlu menciptakan lapangan kerja lebih banyak dalam rangka menurunkan tingkat pengangguran dan kemiskinan

an

1. D-III Kesehatan 2. SMU/ SMA/ SPK/ MAN/ SMK Semua jurusan Ujian Masuk Tgl. 24 Agustus 2009

SALES FREELANCE

Fasilitas/ Gaji: - Transportasi, Perobatan, Asrama, TV, Kulkas, Kipas Angin, Air, Listrik disediakan gratis - Minimal pendapatan RM 800 (Rp. 2.000.000) - LEVY SUBSIDI 100% (gratis) Pendaftaran setiap hari kerja Informasi dan Pendaftaran:

Informasi selanjutnya hubungi:

SARI MUTIARA

D•I•C•A•R•I UNTUK MEMASARKAN PRODUCT: BUKU LKS SD Per Bidang Study SMP, SMA, SMK BUKU UN SMP, SMA, SMK

Persyaratan: - Wanita umur 18 s/d 30 tahun - Pendidikan min. SLTP (sederajat) - Mendapat izin Orang Tua/ Wali - Sanggup dikontrak 2 s/d 3 thn

PENDAFTARAN: Mulai 1 Juni s/d 23 Agustus 2009 TESTING: - Gelombang I : 15 Juli 2009 - Gelombang II : 05 Agustus 2009 - Gelombang III : 24 Agustus 2009

PENDIDIKAN TENAGA KESEHATAN

tangan masih meliputi perekonomian Indonesia di 2010. Pertama pemulihan ekonomi dunia 2010 masih rapuh dan gejolak pasar uang, pasar modal, dan harga komoditas masih akan menyertai. “Oleh karena itu kita perlu memelihara stabilitas ekonomi nasional dengan merancang APBN 2010 yang memasukkan faktor risiko di dalamnya,” tandas Sri Mulyani.

DP

JAKARTA (Waspada): Meskipun fase krisis ekonomi global sudah mulai terlewati, namun pemerintah memperkirakan perekonomian Indonesia di 2010 masih diliputi oleh ketidakpastian. Menteri Keuangan sekaligus Menko Perekonomian Sri Mulyani mengatakan ketidakpastian perekonomian di 2010 adalah seberapa cepat dan kuat pemulihan ekonomi

27

Ada 373 Kapling Tinggal 10 Kapling, sekarang bisa kredit tanpa ada DP, Uk. 10x20: 200m2, SK Camat, Cicilan setiap bln hanya Rp. 750 Rb, Selama 36 bln, Lokasi depan terminal angkot Mars 70, hanya 500mtr dari Jl. Gatot Subroto Km. 13,8 Desa Sei Semayang Kec. Sunggal Hub. 0856.6400.6676 Flx. (061) 7694.3478 TANPA PERANTARA

Harian

WASPADA Tempat Iklan Anda

Hub.4576602

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan Mahar kekerasan, tambah Rp. 500 ribu kuat dan tahan lama dalam berhubungan

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhati-hati terhadap pengobatan sejenis yang mengaku-ngaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan

Telp. (061) 663.4220

Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB

Ekonomi & Bisnis 28 15 Bank Besar Kompak Turunkan Bunga JAKARTA (Waspada): Sebanyak 15 bank besar dalam negeri telah sepakat untuk menyesuaikan tingkat suku bunga dana pihak ketiga (DPK) agar selaras dengan tingkat suku bunga acuan atau Bank Indonesia (BI) Rate. Menurut Ketua Himbara dan Ketua IBI Agus Martowardojo, 15 bank besar tersebut sebelumnya telah mengadakan pertemuan yang difasilitasi oleh Bank Indonesia dalam membahas hal tersebut. “Sebanyak 15 Bank telah menyepakati untuk menyesuaikan tingkat suku bunga DPK-nya selaras dengan BI rate dan diperkirakan keselarasan dapat tercapai dalam jangka waktu 3 bulan kedepan,” ujar Agus, Kamis (20/8). Bank yang telah sepakat tersebut diantaranya, PT Bank Mandiri Tbk, PT Bank Negara Indonesia Tbk (BNI), PT Bank Tabungan Negara (BTN), PT Bank Rakyat Indonesia Tbk (BRI), PT Bank Danamon Tbk, PT Bank Central Asia Tbk (BCA) dan lainnya.

Penurunan suku bunga simpanan ini dilakukan agar cost of fund bank-bank tersebut bisa turun, sehingga suku bunga kredit bisa diturunkan seperti yang menjadi harapan masyarakat dan para pelaku usaha. Saat ini meskipun BI Rate sudah turun hingga berada di posisi 6,5 persen, namun ratarata suku bunga kredit perbankan masih berada di posisi 12 persen ke atas. “Betul sekali, kita baru ketemu. Kesimpulannya kita sepakat dan bukan intervensi BI. Penurunannya single digit, dilaksanakan segera dalam 3 bulan ke depan untuk deposito,” ujar Dirut BRI Sofyan Baasir. Menurutnya, hal tersebut merupakan keinginan dari perbankan sendiri. “Jika ada yang melanggar, nanti BI tindak lanjuti,” imbuh Sofyan di Gedung BRI. Dekan Fakultas Ekonomi Universitas Indonesia, Firmanzah menilai perlunya Bank Indonesia membuat suatu aturan pengendalian suku

bunga perbankan. Tujuannya, agar tidak terjadi selisih terlalu lebar antara BI Rate dengan suku bunga bank. “BI perlu membuat suatu aturan yang mengendalikan suku bunga agar tidak terjadi mismatch seperti yang sekarang terjadi,” ujar Firmanzah usai menghadiri acara Citi Enterpreneurhip Award di Hotel Sari Pan Pacific, Jakarta, Rabu (19/08). Penurunan BI Rate hingga saat ini belum diikuti dengan penurunan suku bunga perbankan. BI sendiri saat ini sedang melakukan kajian mendalam soal ini. Rencananya, BI akan memanggil bankirbankir nasional guna membahas soal itu pada 20 Agustus 2009. Menanggapi hal itu, Firmanzah mengatakan peraturan tersebut hendaknya mengatur lebih lanjut tentang batasan suku bunga. “Misalnya untuk suku bunga deposito, BI harusnya mengatur mengenai suku bunganya. Untuk Deposan besar suku bunganya

berbeda tergantung dari jumlah dananya,” kata Firmanzah. Jadi, ujar Firmanzah, lebih baik suku bunga tersebut dipatok atau ditentukan saja oleh BI berdasarkan sebuah Peraturan Bank Indonesia (PBI). “Dan lebih jauh BI juga harus mengontrol pergerakan suku bunga perbankan sesuai dengan BI Rate,” jelasnya. Sebelumnya Deputi Senior Gubernur BI, Darmin Nasution juga mengatakan bahwa BI mempunyai kewenangan untuk mematok suku bunga perbankan. Namun BI belum akan menggunakan kewenangannya ter-sebut. “Kita akan pilih langkahlangkah yang tidak menimbulkan komplikasi tambahan,” ujar Darmin. Untuk sementara, lanjut Darmin, pihaknya masih akan terus berbicara dengan duduk bersama kalangan perbankan terkait masalah suku bunga ini.(dtc)

Swiss Siap Buka Data Nasabah Pengemplang Pajak ZURICH (Waspada): Bankbank di Swiss terkenal dengan keteguhannya dalam memegang data rahasia nasabah-nasabahnya. Termasuk nasabahnasabah diduga mengemplang pajak. Pemerintah AS pun sempat dibuat kesal oleh masalah tersebut. Namun kini pemerintah AS bisa berlega hati karena berhasil mencapai kesepakatan dengan pemerintah Swiss untuk membuka sejumlah informasi dari para pengemplang pajak AS yang memiliki rekening di UBS. “Kesepakatan itu akan membuat IRS menerima sejumlah informasi belum pernah diterima sebelumnya tentang nasabah-nasabah yang memiliki neraca di UBS,” jelas International Revenue Service

dan Departemen Kehakiman AS dalam pernyataan bersamanya, seperti dikutip dari AFP, Kamis (20/8). Berdasarkan kesepakatan itu, informasi tentang sekitar 4.450 rekening nasabah UBS milik warga AS akan mulai diserahkan kepada pemerintah AS. “Kesepakatan ini mempertahankan hak pemerintah AS, jika hasilnya secara signifikan lebih rendah dari yang diharapkan dan hal-hal lainnya gagal untuk mencari penyelesaian judisial selayaknya, termasuk mengambil langkah untuk mendorong kepatuhan masyarakat,” demikian pernyataan bersama tersebut. Pekan lalu, pemerintah AS dan UBS melakukan finalisasi

atas penyelesaian di luar pengadilan untuk mengakhiri masalah kerahasiaan pajak yang sangat sensitif. Di bawah UU Kerahasiaan Perbankan Swiss, bank-bank di Swiss dilarang untuk membocorkan setiap informasi tentang nasabahnya kepada pemerintah atau pihak ketiga. Kecuali dalam menyangkut kriminal. Swiss dan UBS mendapatkan tekanan dari AS setelah kasus penggelapan pajak muncul di pengadilan Florida tahun lalu. Pada Juli 2008, UBS mengumumkan telah menghentikan sementara jasa perbankan di luar negeri untuk warga AS sehubungan dengan adanya penyidikan tersebut. IRS dan Departemen Kehakiman AS menyatakan bah-

wa proses kesepakatan itu akan dimulai dengan permintaan IRS kepada pemerintah Swiss untuk mendeskripsikan rekening-rekening akan dicari informasinya. Pemerintah Swiss selanjutnya meminta UBS untuk memberikan informasi tersebut kepada IRS. “IRS akan menerima informasi atas rekening dari berbagai jumlah dan tipe,” demikian pernyataan tersebut. Sesaat setelah mencapai kesepakatan tersebut, pemerintah Swiss juga sepakat untuk menjual 9 persen sahamnya di UBS. “Pemerintah telah memutuskan untuk segera mengakhiri komitmennya ke UBS,” ujar Departemen Keuangan Swiss. (dtc)

Kredit BTN Untuk RSh Naik 73 Persen JAKARTA (Waspada): Pertumbuhan kredit Bank Tabungan Negara (BTN) hingga Juni (semester II) 2009 untuk pembiayaan Rumah Sehat Sederhana (RSH) mencapai Rp3,3 triliun (73 persen) dari target Rp4,4 triliun. “Penambahan target kredit untuk RSH tidak ada masalah, apalagi kalau program IPO (initial public offering) bisa berhasil tahun ini,” kata Wakil Dirut Bank BTN Evi Firmansyah di sela peluncuran layanan Gadai Emas Syariah BTN dan peresmian 5 kantor cabang di beberapa daerah difokuskan di Cirebon, Kamis (20/8). Sedangkan penyaluran Kredit Pemilikan Rumah (KPR), menurut Evi, telah mencapai Rp7,8 triliun dari target minimun Rp12 triliun. Pihaknya mengharapkan untuk tahun

ini pertumbuhan kredit akan merncapai 25 persen atau sekitar Rp14 triliun. Tahun ini, lanjut Evi, BTN mentargetkan pertumbuhan 20 kantor cabang syarih di seluruh Indonesia. “Nah, dari 20 cabang ini kita mentargetkan pertumbuhan kreditnya masing-masing Rp10 miliar,” tuturnya. Tujuan pertumbuhan kantor syariah BTN, kata Evi, untuk bisa mengoptimalkan potensi pasar syariah di Indonesia yang porsinya masih besar. “Berdasarkan data dari Bank Indonesia (BI) potensi pasar syariah di Indonesia baru tergarap 5 persen,” jelasnya. Disinggung mengenai suku bunga yang tetap tinggi, Evi mengatakan memang akan terasa bagi konsumen rumah

Tim Stabilitas Pangan: Harga Sembako Stabil Memasuki Puasa JAKARTA (Waspada): Tim Stabilitas Pangan Pemerintah menyatakan, harga-harga kebutuhan pokok masyarakat memasuki bulan puasa-lebaran secara umum relatif stabil. Hal ini berdasarkan dari perubahan harga-harga kebutuhan pokok antara Juli dan Agustus 2009 tidak menunjukkan gejolak harga. “Secara umum harga kebutuhan pokok menjelang Ramadhan relatif stabil,” kata Deputi Menko Perekonomian Bidang Pertanian dan Kelautan Bayu Krisnamurthi melalui pesan singkatnya Kamis (20/8). Bayu mengatakan Tim Stabilisasi Pangan Pokok Kementerian Koordinator Ekonomi telah mengumpulkan data harga 20 bahan pokok dengan basis data BPS dari 66 kota telah dikonfirmasi dengan data harian Departemen Perdagangan di delapan kota. Bayu menuturkan sampai dengan 19 Agustus 2009, persentase perubahan harga rata-rata Agustus terhadap Juli 2009 yaitu beras murah stabil (- 1.31 persen), beras umum stabil (+ 0,12 persen), daging ayam ras stabil (+ 0,1 persen), minyak goreng stabil (+ 0,69 persen), gula pasir naik (+ 4,8 persen), terigu stabil (- 0,02 persen), cabai rawit turun (- 12,2 persen), cabe merah stabil (+ 0,08 persen), bawang merah turun (9,94 persen), kedele stabil (+ 0,09 persen), telur ayam ras naik (+ 4,76 persen), ikan bandeng stabil (+1,02 persen), ikan kembung naik (+ 3,71 persen).(dtc) Harga Emas Di Medan Jenis

Kadar

Harga

London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp304.000 Rp290.000 Rp260.000 Rp230.000 Rp165.000 Rp100.500

lapisan bawah atau dengan harga setara Rp200 juta. “Tapi untuk konsumen rumah seharga Rp300 juta ke atas tidak terlalu mengeluh, asal mendapat more service atau layanan lebih,” ujarnya. Sementara pengembang hunian bersusun maupun tapak masih menunggu turunnya bunga KPR/KPA (Kredit Pemilikan Rumah/ Apartemen) hingga berada di level 10 persen untuk mempercepat penyelesaian proyek-proyeknya. “Kami akan berupaya mempercepat serah terima

kepada pembeli kalau tingkat bunga KPR/KPA turun di bawah 10 persen,” kata Chief Executive Office (CEO) PT.Bakrieland Developmen, Hiramsyah S. Thaib. Menurutnya, selama semester I tahun ini banyaknya calon konsumen pembeli rumah yang menahan diri di Semester 1 karena tingginya bunga KPR saat itu diharapkan segera merealisasikan keinginannya untuk memiliki rumah di semester II mengingat tingkat bunga yang semakin murah.(j03)

Antara

NELAYAN TAK MELAUT: Seorang nelayan warga Desa Pusong Kecamatan Banda Sakti Lhokseumawe Propinsi Aceh melintas di depan puluhan kapal boat, Kamis (20/8). Sejak Rabu ratusan kapal boat nelayan tidak melaut dalam rangka mengahadapi Meugang Ramadhan di Aceh.

Harga Daging Melonjak Ke Rp70 Ribu Per Kg M E D A N ( Wa s p a d a ) : Harga daging sapi untuk kebutuhan masyarakat pada H-1 menjelang bulan suci Ramadhan diperkirakan para pedagang pasar tradisional akan naik mencapai Rp70 ribu per kg. Menurut Adi, salah seorang pedagang daging sapi di Pusat Pasar Medan, Kamis (20/8), harga daging sapi saat ini telah naik dari Rp60 ribu per kg menjadi Rp67 ribu per kg di tingkat pedagang eceran. Harga tersebut diperkirakan kembali bergerak menjadi Rp70 ribu per kg hari ini bulan suci Ramadhan seiring meningkatnya kebu-

tuhan masyarakat secara bersamaan terhadap daging sapi saat Ramadhan, sebutnya. Sementara itu Wahid pedagang daging sapi lainnya di Pusat Pasar tersebut juga mengatakan hal sama, harga daging saat itu telah menjadi Rp67 ribu per kg diperkirakan dapat mencapai Rp70 ribu per kg. Perkiraan itu mengingat kenaikan harga Rp60 ribu per kg menjadi Rp65 ribu per kg terjadi saat omset pedagang stabil, sedangkan pada H-1 Ramadhan omset pedagang diperkirakan meningkat tajam sehingga besar peluang harga akan naik, katanya. Sementara itu stok daging

salah stimulus APBN. Majalah Forbes menempatkan Sri Mulyani pada urutan ke-71 dalam daftar 100 wanita berpengaruh di dunia. Urutan pertama kembali diduduki oleh kanselir Jerman Angela Merkel. Untuk masuk kategori 100 wanita paling berpengaruh ini bukan sekedar selebriti ataupun kepopulerannya namun lebih ke pengaruhnya. Forbes menilai Sri Mulyani bisa tegas memberantas korupsi di Departemen Keuangan yang dipimpinnya. Forbes menyebutkan, departemen tersebut selama ini dianggap sebagai departemen paling korup. Sri Mulyani juga dianggap memudahkan UU investasi dan menciptakan insentif pajak. Forbes menuliskan, Sri Mulyani dinilai telah sukses mendorong penggunaan mata mata uang lokal ketimbang dolar AS untuk perdagangan

Valuta Asing Di Medan Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

10.055 8.225 9.664 16.748 1.389 110,43 7.230 14.523 3.300

10.035 7.925 9.287 16.305 1.283 105,88 7.000 14.123 3.000

di Medan hingga saat ini masih cukup untuk melayani kebutuhan masyarakat, hal tersebut dapat dilihat hingga pukul 16 petang para pedagang masih banyak melayani masyarakat, sebutnya. Pasokan daging ke Pusat Pasar menurutnya berasal dari peternak lokal sebelumnya melalui proses penyembelihan di Rumah Potong Hewan (RPH) dan telah sesuai ketentuan pemerintah. Sementara hingga saat ini para pedagang belum ada menemui masuknya daging illegal dan daging impor lainnya yang masuk tanpa melalui aturan pemerintah, sebutnya.

Ayam Kondisi sama juga terjadi pada daging ayam, harga ayam boiler per kg saat ini naik dari Rp16 ribu per kg naik menjadi Rp18.500 per kg. Harga tersebut diperkirakan kembali bergerak khususnya pada H-1 Ramadhan mencapai Rp20 ribu per kg seiring naiknya permintaan masyarakat saat itu. Menurut Kadir pedagang ayam di Pusat Pasar, naiknya harga merupakan hal biasa terjadi khususnya menjelang bulan suci Ramadhan, sehingga tidak ada hubungannya dengan persediaan ayam saat ini dalam posisi cukup.(m40)

Pesta Rakyat Simpedes BRI Di Berastagi Meriah BERASTAGI (Waspada): Pesta Rakyat Simpedes dan penarikan undian Simpanan Pedesaan (Simpedes) BRI Kantor Cabang (Kanca) seSumut semester I 2009 BRI Kanwil Medan mempercayakan BRI Kabanjahe sebagai penyelenggara, Sabtu-Minggu (15-16/8) di Open Stage Berastagi berlangsung meriah. Untuk tingkat regional penarikan undian Simpedes yang serentak dilakukan BRI se-Sumut di Berastagi. Hadiah utama sebesar Rp100 juta diraih Azhari Harsah (Medan Iskandar Muda). Hadiah ke II sebesar Rp50 juta diraih Fenny Rinanchy (Medan Iskandar Muda). Hadiah ke III Rp25 juta diraih Asna Sitorus dan hadiah hiburan masing-masing Rp5 juta diraih sejumlah nasabah ber-

bagai Kanca di Sumut. Sedangkan penarikan undian Simpedes untuk Kanca BRI Kabanjahe dengan hadiah utama satu mobil Xenia diraih nasabah BRI cabang Saribudolok, Riahma Saragih. Hadiah kedua, Suzuki Thunder 125 diraih Ratnawaty Br Surbakti (Berastagi). Hadiah ketiga, Suzuki Shogun FL 125 SD diraih Jantipanus Saragih (Saribudolok) dan Evarianta Ginting (Tiganderket). Hadiah keempat, Suzuki Smash FK 110 SCD diraih Painem (Berastagi) dan Rajudin (Mardinding). Hadiah kelima, Suzuki Smash FK 110 SD diraih Murni Br Bangun (Berastagi) dan Edison Ginting (Simpang Empat) dan sejumlah hadiah lainnya berupa TV, mesin cuci, lemari es, tape dan hadiah hiburan diraih masing-masing

Sri Mulyani Cerah Ceria Masuk Daftar 100 Wanita Berpengaruh NAMA Menko Perekonomian yang juga Menteri Keuangan Sri Mulyani Indrawati kembali masuk dalam jajaran 100 wanita paling berpengaruh di dunia. Meski peringkatnya turun dari 23 ke 71, namun hal itu tetap saja membuat wajah Sri Mulyani cerah ceria. Ditemui usai memberikan pandangan umum RAPBN 2010 dalam rapat paripurna di Gedung DPR RI. Jakarta, Kamis (20/8), Sri Mulyani tidak memberikan banyak komentar. Namun wajah Sri Mulyani tampak cerah ceria dengan senyum yang mengembang saat ditanya komentarnya mengenai hal tersebut. “Itu sih cuma.. ada pengaruhnya nggak buat kamu?..,” ujar Sri Mulyani sambil tertawa. Ia tidak memberikan komentarnya lebih lanjut soal peringkat ini. Sri Mulyani lebih memilih mengomentari ma-

WASPADA Jumat 21 Agustus 2009

di Asia di tengah krisis. Ia juga dinilai mampu mewujudkan swap bilateral 15 miliar dolar AS dengan China sehingga bisa memudahkan importir membayar barang-barang dari China dengan yuan langsung, tanpa dolar AS. Sri Mulyani juga dianggap mendorong kampanye Jepang melawan program nuklir Korut dan prakarsa PBB atas Afghanistan. Merdeka Kemerdekaan bagi seorang Menteri Perekonomian Sri Mulyani Indrawati adalah membebaskan rakyat Indonesia dari kemiskinan. Dan untuk mencapainya, hal itu bukan saja menjadi tugas pemerintah dan BUMN. “Arti kemerdekaan adalah suatu misi untuk membangun negara karena kalau kita merdeka dari penjajahan berarti kita harus merdeka dari kemiskinan,” kata Sri Mulyani di Gedung Menko Perekonomian. Menurut Sri Mulyani, kemerdekaan ini harus diisi dengan kompetisi kepandaian dan ilmu pengetahuan serta harus bisa mengatasi berbagai hal yang masih mengancam satu kesatuan bangsa Indonesia dan mengurangi kesejahteraan rakyat. “Semua tentunya harus dilakukan bersama-sama untuk keselamatan rakyat. Bukan

hanya BUMN, tapi juga swasta dan seluruh masyarakat dengan meningkatkan kinerja sehingga bisa berkontribusi bagi perekonomian kita. Itu kita harapkan.” ungkapnya. Sri Mulyani menyatakan, untuk tahun 2010 pemerintah akan berjuang untuk mencapai pertumbuhan ekonomi antara 5 hingga 6 persen. Namun ia menambahkan, saat ini pihaknya harus melihat terlebih dahulu perkembangan ekonomi semester I tahun ini. “Kondisi semester I tidak seburuk seperti yang dibayangkan, dan semester ke-dua kita akan hati-hati, meskipun dari sisi pendapatan pada sektor investasi kita harus tetap pantau dengan baik. Lebih dari lima persen bukanlah sesuatu yang tidak mungkin, namun kita akan terus melihat dari faktor yang menyumbangnya,” paparnya.(dtc)

nasabah berbagai Kanca. Pesta Rakyat Simpedes dan penarikan undian Simpedes yang dibuka Bupati Karo Drs DD Sinulingga itu, diisi dengan beragam kegiatan khusus menyambut HUT Proklamasi RI ke 64. Di antaranya lomba lari goni, perlombaan tari tradisional Karo, busana dan pengantin Karo, panjat pinang, perlombaan anakanak, pemeriksaan dan pengobatan gratis, panggung hiburan, pesta kembang api, pawai keliling kota Berastagi dan akuisisi Simpedes. Juga dilaksanakan berbagai kegiatan sosial, di antaranya memberikan bantuan sarana-prasarana belajar siswa SD, SMP dan SMA. Bantuan ke rumah-rumah ibadah. Sedangkan program kemitraan bina lingkungan (PKBL) baru terselenggara sejak 2009 dengan menyerahkan bantuan

6 set sarana kesehatan kepada 6 Puskesmas di Karo, langsung diserahkan Pimpinan Wilayah (Pinwil) BRI Medan Zainuddin Mappa kepada Bupati Karo Daulat Daniel Sinulingga. Pinwil Zainuddin Mappa dan Pinca BRI Kabanjahe Made Antara Jaya menjelaskan tabungan masyarakat berupa Simpedes di Tanah Karo cukup baik dan berkembang. Akhir Desember 2008, tabungan Simpedes sebesar Rp188.908 miliar dari jumlah penabung 47.595 orang dan meningkat pada akhir Juni 2009 menjadi Rp196.534 miliar dari jumlah 48.869 penabung. Data itu menunjukkan perkembangan yang cukup baik. Dalam kurun waktu 6 bulan meningkat sebesar Rp7.626 miliar. Sedangkan total simpanan di BRI posisi Desember 2008 mencapai Rp218.320 miliar dari jumlah 50.334 penabung.(c06)

Pinbuk Dorong Ekonomi Masyarakat Kecil MEDAN (Waspada): Pusat Inkubasi Bisnis Usaha Kecil (Pinbuk) Indonesia perwakilan Sumatera Utara bertekad membangun paradigma baru dan menjadikan lembaga itu dipercaya masyarakat sekaligus mampu mendorong pertumbuhan perekonomian masyarakat kecil. ’’Tekad kita menciptakan paradigma baru bagi Pinbuk menuju Indonesia yang lebih maju dan sejahtera. Tentunya kita harus mampu berperan aktif dan bekerja sama dengan pemerintah dalam mewujudkan dan meningkatkan perekonomian umat,’’ ujar Direktur Pinbuk Indonesia Perwakilan Sumut M Ramadhan, di Medan, Senin (17/8). M Ramadhan baru saja terpilih secara aklamasi sebagai Direktur Pinbuk Indonesia Perwakilan Sumut periode 2009-2013 pada musyawarah kerja yang dilangsungkan di Kisaran, Kabupaten Asahan, 12-13 Agustus lalu. Didampingi Direktur Pinbuk Indonesia Kota Medan Daud Sagita Putra, dia mengaku telah menyiapkan sejumlah terobosan penting, diantaranya menciptakan organisasi yang terpercaya serta merekonsiliasi potensi pengurus dan pemangku kepentingan demi membangun paradigma baru yang dimaksud. Menurut dia, yang penting

dilakukan adalah pencitraan yang baik melalui perbaikan manajerial organisasi. Salah satu upaya yang dilakukan adalah dengan menerapkan tertib administrasi dan transparansi pengelolaan organisasi. ’’Hal penting lain yang juga harus dilakukan adalah menciptakan harmonisasi antara lembaga Pinbuk dengan instansi pemerintah, lembaga keuangan dan lembaga-lembaga sosial yang ada,’’ katanya. Untuk menciptakan Pinbuk yang handal dan profesional, dia juga bertekad meningkatkan intensitas pembinaan dan pendidikan dengan membangunan lembaga pembinaan dan pelatihan di Pinbuk Indonesia Perwakilan Sumut. ’’Kita akan membuat buku panduan serta manual pendidikan dan pelatihan Pinbuk dan BMT (Baitul Maal wal Tamwil/koperasi syariah-red) se Sumut,’’ ujarnya. Dia menyebutkan, sebagai lembaga yang bergerak di bidang keuangan dan bisnis kecil, Pinbuk harus mampu menerapkan sistem keuangan dengan prinsip keterbukaan dan akuntabel. Lembaga yang didirikan Bank Muamalat bersama Majelis Ulama Indonesia (MUI) dan Ikatan Cendikiawan Muslim Indonesia (ICMI) pada 1995 itu juga harus mampu memberikan keadilan dan keseimbangan dalam pengembangan BMT.(h03)


waspada jumat 21 agustus 2009