Issuu on Google+

Menag Tarik Dana Haji Rp23 Triliun Dari Bank PEKANBARU (Antara): Menteri Agama (Menag) Suryadharma Ali mengungkapkan sejauh ini pihaknya sudah menarik Biaya Penyelenggara Ibadah Haji (BPIH) sebesar Rp23 triliun dari sejumlah Bank Penerima Setoran (BPS). “Dana haji tersebut kemudian dialihkan ke kas Kementrian Keuangan dalam bentuk sukuk. Kondisi ini kemudian membuat banyak perusahaan perbankan yang dahulunya menyimpan dana haji menjerit, pasalnya dana haji tersebut nilainya tidak sedikit,” kata Suryadharma dalam pidatonya di acara peletakan batu pertama pertanda dimulainya pembangunan asrama haji Riau di Kompleks Angkatan Udara RI (AURI) Pekanbaru, Sabtu (25/2) sore. Upaya penyimpanan dana haji di Kementerian Keuangan (Kemenkeu) ini adalah bentuk upaya pemerintah dalam mencari cara guna membiayai defisit Anggaran Pendapatan dan Belanja Negara (APBN). Langkah penyimpanan dana di Kemenkeu ini sebelumnya diperkuat dengan diterbitkannya Surat Berharga Syariah Negara (SBSN). Adapun SBSN atau yang dikenal dengan istilah sukuk seri SDHI 2019 A, diterbitkan melalui penempatan dana haji yang dikelola oleh Kemenag pada SBSN dengan metode private placement. Lanjut ke hal A2 kol. 7

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Wage, 27 Februari 2012/4 Rabiul Akhir 1433 H

No: 23787 Tahun Ke-66

Terbit 24 Halaman (A1-8, B1-8-C1-8)

Harga Eceran: 2.500,-

Tangse Masih Terkurung

Waspada/Muhammad Riza

SEPANJANG 20 meter jalan negara lintas Tangse-Beurenue, Pidie tepatnya di tikungan Kuala Panteu putus yang menyebabkan hubungan transportasi terputus total disebabkan bencana banjir bandang di Tangse.

SIGLI (Waspada): Kondisi Kec. Tangse,Kab.Pidie hingga Minggu (26/2), masih porak poranda setelah daerah itu dilanda banjir bandang sehari sebelumnya. Jalan negara menghubungkan Beureunuen-Tangse terputus dan longsor terjadi di sejumlah titik menyebabkan hubungan trasportasi lumpuh total. Sedangkan evakuasi hanya bisa dilakukan dengan berjalan kaki dengan menempuh medan berat. Pantauan Waspada, Minggu (26/2), sejumlah alat berat dikerahkan Pemkab Pidie untuk mengatasi longsor dan memindahkan gelondongan kayu berukuran besar, serta mengarahkan jalur air ke tempat yang aman dari pemukiman penduduk. Data diperoleh tidak ada korban jiwa meninggal dunia, namun dua orang Lanjut ke hal A2 kol. 7

Protes Bakar Alquran Memanas Di Afghanistan

Dua Perwira AS Tewas

KABUL (AP): Protes pembakaran kitab suci Alquran makin memanas di Afghanistan. Gejolak itu, sampai Minggu (26/2) telah menewaskan 30 orang, termasuk empat tentara Amerika, sejak insiden tersebut dimulai Selasa lalu.

Menghadapi aksi yang semakin mengkhawtirkan itu, NATO dan pemerintah Inggris memanggil para penasehat internasionalnya dari berbagai kementerian Afghanistan, Sabtu malam setelah dua pe-

nasehat militer AS — seorang letnan kolonel dan seorang mayor — ditemukan tewas di kantor mereka akibat tembakan. Presiden Hamid Karzai kembali mengimbau agar masyarakat tenang.

“Sekarang waktunya untuk kembali tenang dan jangan biarkan musuh-musuh kita menggunakan situasi,” kata Karzai Minggu. Ditanya tentang pemanggilan mendadak para staf NATO, Karzai menga-

takan dia tidak memahami langkah tersebut. “Itu adalah langkah sementara pada saat rakyat Afghanistan marah atas pembakaran Alquran,” kata Karzai. “Kami tidak menentang ini,”

katanya menambahkan. Masih belum jelas siapa yang menembak kedua perwira tersebut di dalam kantornya di Kementerian Dalam Negeri Afghanistan yang dijaga ketat atau apakah penyerang-

nya berhasil ditangkap. Media Afghanistan melaporkan — tanpa memberitahu sumbernya — korban adalah perwira intelijen kepolisian . Lanjut ke hal A2 kol. 4

Pemprovsu Anggarkan Rp60 M Untuk Islamic Center MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho mengatakan, Pemerintah Provinsi Sumatera Utara mengalokasikan dana pembangunan Islamic Center pada APBD Tahun Anggaran 2012 sebesar Rp60 miliar. Hal tersebut dikatakan Gatot dalam sambutannya pada acara peringatan Maulid Nabi Muhammad SAW 1433 H di Masjid Raya Aceh Sepakat, Sabtu (25/2). Menurut Gatot, pembangunan Islamic Centre di Sumatera Utara sangat penting dan sudah menjadi kebutuhan pemberdayaan umat. Islamic Center menurutnya, memiliki banyak fungsi selain sebagai pusat kegiatan ibadah dan penguatan persatuan dan silaturrahim umat Islam. Lanjut ke hal A2 kol. 3

Seri Diskusi Tokoh ISI Waspada/Amir Syarifuddin

PLT GUBSU Gatot Pujo Nugroho memberikan sambutan pada peringatan Maulid Nabi Besar Muhammad SAW di Majid Raya Aceh Sepakat, Medan, Sabtu (25/2).

Abdul Mutholib menegaskan, pihaknya beriktikad baik terhadap mereka yang bersedia membantu. “Kami tidak ada menaruh curiga terkait persyaratan pencairan uang melalui rekening. Kami ini polos, kami beranggapan jika mereka bermain atas dana Rp200 juta itu, biarlah mereka yang mempertanggungjawabkannya kepada Allah SWT,” tambahnya.

MEDAN (Waspada): Anggota Komisi VI DPR RI Dr Chairuman Harahap, SH, MH (foto) menyatakan di tangan pemerintah daerah yang tidak memiliki visi yang kuat, otonomi daerah ternyata hampir tak bermakna apa-apa untuk kesejahteraan masyarakat. “Bussiness runs just like usual, urusan berjalan biasa-biasa saja, tak ubahnya Orde Baru yang sentralistik,’’ katanya dalam Seri Diskusi Tokoh yang digelar Institut Solusi Indonesia (ISI) di Ruby Room Lanai 25 Grand Swissbelhotel Internasional, Jl. S. Parman Medan, Sabtu (25/2). Pada diskusi yang mengusung tema ‘Visi Membangun Sumatera Utara 2013-2018’ itu menghadirkan Ketua DPW PPP Fadly Nurzal, SAg, dipandu Direktur ISI, M Ikhyar Velayati Harahap dan Koordinator Kajian Politik ISI Agus Marwan, SIP. Diskusi dihadiri sejumlah tokoh dari kalangan pimpinan Parpol, Ormas, akademisi, praktisi, LSM dan mahasiswa.

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Rp200 Juta Untuk Pengecatan Masjid Agung 6 Perwakilan Warga Sesalkan Pernyataan Pengurus Yayasan MEDAN (Waspada): Pihak Yayasan Masjid Agung mengakui telah menerima bantuan dari Pemprovsu senilai Rp200 juta. Keterangan ini bertolak belakang karena sebelumnya, yayasan mengaku tidak pernah mendapat bantuan dana APBD Pemprovsu. Namun, bantuan berupa uang tunai itu tidak pernah masuk ke kas yayasan, tetapi langsung diserahkan kepada kontraktor yang ditunjuk Pemprovsu untuk menangani

pengecatan Masjid Agung. “Dana yang dikirim ke rekening itu sebagai persyaratan yang diberikan oleh Pemprovsu kepada yayasan. Setelah dicairkan, uang tersebut langsung kami serahkan kepada pihak kontraktor yang ditunjuk oleh Pemprovsu. Kami tidak pernah menerima uang, kami hanya terima pengecatan itu, siap jadi,” kata Dewan Komisaris/Pengawas H. Abdul Mutholib Sembiring kepada Waspada, Minggu (26/2).

Al Bayan

Iman Abubakar Ash-Shiddiq

Visi Pemda Harus Kuat

Promosikan Sumut Di Denmark Dan Lithuania

Oleh Tgk H. Ameer Hamzah SEBELUM Islam ia termasuk orang kaya. Setelah Islam ia waqafkan semua hartanya untuk perjuangan Islam. Setelah wafat dia tidak mewariskan apa-apa untuk anakanaknya. Sahabat utama Rasulullah SAW adalah Sayyidina Abu Bakar Ash-Shiddiq. Beliau telah memberi keteladanan bagi para pemimpin yang datang kemudian. Beliau memimpin manusia untuk kejayaan di dunia dan kejayaan di akhirat. Beliau menjalankan amanah dengan istiqamah. Bersumpah demi Allah akan memerangi orang-orang yang membangkang dari manhaj Islami.

Lanjut ke hal A2 kol. 2

Waspada/Surya Efendi

DUTA Besar RI untuk Denmark dan Lithuania Prof Dr H Bomer Pasaribu, M.Si berbincang akrab dengan Wapemred Harian Waspada H. Teruna Jasa Said.

SUMATERA Utara dikenal memiliki khasanah budaya yang sangat menarik. Setiap kabupaten dan kota di Sumut memiliki kesenian dan budaya yang khas. Ini benar-benar kekayaan yang tidak ternilai. Dalam berbagai even budaya yang diselenggarakan, tidak jarang membuat turis mancanegara tampak berdecak kagum. Belum lagi objek wisatanya yang sungguh menakjub-kan, misalnya panorama Danau Toba yang memang sangat kesohor. Sejumlah turis merasa tidak cukup sekali mengunjungi Danau Toba. Sumut memang luar biasa. Promosikanlah Sumatera Utara. Keseniannya, Lanjut ke hal A2 kol. 4

Waspada/Surya Efendi

MENDARAT DI CADIKA: Warga menyaksikan seorang prajurit Kostrad melakukan pendaratan di lapangan Cadika, Medan Johor, Minggu (26/2). Latihan terjun payung sejak Kamis (23/2) yang melibatkan 230 prajurit ini dalam rangka memeriahkan HUT ke-51 Kostrad.

PWNU Gelar Konferwil Rumah Dibakar, TNGL Kembali Dan Bakti Sosial MEDAN (Waspada): Konferensi Wilayah (Konferwil) XVI Nahdlatul Ulama Sumatera Utara akan digelar di Asrama Haji Pangkalan Masyhur Medan, 30 Maret hingga 1 April 2012. Sekira 2.000 nahdliyin (warga NU) akan menghadiri acara pembukaan Konferwil yang dijadwalkan setelah shalat Jumat (30/3). Konferwil akan dibuka Plt Gubsu Gatot Pujo Nugroho dihadiri unsur Muspida Sumut,

Wali Kota Medan Rahudman Harahap sebagai tuan rumah, dan diisi tausiyah Ketua Umum Pengurus Besar (PB) NU Prof Dr Said Aqil Siradj MA. Hal itu disampaikan Ketua Pengurus Wilayah NU Sumut H AshariTambunan didampingi Rois Suriyah PW NU Sumut Prof Dr H Pagar Hasibuan MA, Katib Suriyah Drs H Musaddad Lubis MA, Ketua Lanjut ke hal A2 kol. 7



BESITANG (Waspada): Situasi di Taman Nasional Gunung Leuser (TNGL) wilayah SPTN VI Resort Sekoci, Kec. Besitang, Kab. Langkat, kembali memanas setelah satu unit rumah milik seorang petani dibakar sekelompok orang tak dikenal, Sabtu (25/2) sore. Pembakaran rumah milik, Efendi Barus, 65, spontan Lanjut ke hal A2 kol. 6

Ada-ada Saja Setiap Tahun Menikah ADA beragam cara bagi tiap pasangan untuk mengungkapkan rasa cinta mereka terhadap satu sama lain. Namun tak jarang cara mereka tempuh untuk mengungkapkannya terkadang cukup unik. Seperti yang dilakukan pasangan suami istri asal California Amerika Serikat (AS) Lanjut ke hal A2 kol. 1

Waspada/Dewi Budiati Tj.Said

DI AUSTRALIA ada beberapa area yang selain bebas asap rokok juga bebas alkohol,lokasi itu masuk dalam katagori zona kering, diarea itu penggunaan alkohol sama sekali tidak diperbolehkan, bagi yang melanggarnya dapat ditindak dengan denda ribuan dolar bahkan hukuman penjara. Umumnya lokasi bebas alkohol dipasangi plang ‘Area Bebas Alkohol (seperti yang terlihat pada foto ini) . Lokasilokasi bebas alkohol ini biasanya berada di daerah tertentu seperti pelabuhan, taman kota,jalan-jalan lokal serta area publik yang tentunya telah dipilih dewan lokal setempat.

Serampang - From Sidimpuan to Denmark bah...! - He...he...he...

Hasil Sementara Polling Pilgub Aceh

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Legi, 27 Februari 2012/4 Rabiulakhir 1433 H z zNo: 23787 Tahun Ke-66

Terbit 24 Halaman (A1-8, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Waspada/Muhammad Riza

SEPANJANG 20 meter jalan negara lintas Tangse-Beurenue, Pidie tepatnya di tikungan Kuala Panteu putus disebabkan bencana banjir bandang jilid dua Tangse, Sabtu (25/2).

BEBERAPA warga Tangse korban banjir bandang terlihat panik saat mengungsi, Minggu (26/2).

Waspada/Muhammad Riza

Tangse Masih Terkurung Warga Serahkan Senjata SS-1 Dan 19 Amunisi SIGLI (Waspada): Seorang warga yang namanya dirahasiakan menyerahkan sepucuk senjata api jenis SS-1 berikut 19 amunisi, kepada polisi jajaran Polres Pidie, Minggu (26/2) siang.

Kasat Reskrim Polres Pidie AKP Jatmiko, kepada Waspada, mengatakan penyerahan senjata itu berkaitan dengan Operasi Kilat Rencong 2012. Warga yang namanya enggan disebutkan itu menyerahkan

senjata tersebut setelah kemarin mengetahui ada imbauan dari Kapolda Aceh untuk menyerahkan senjata. “Warga tersebut merupakan Lanjut ke hal A2 kol.1

SIGLI (Waspada): Kondisi Kec. Tangse, Kab.Pidie hingga Minggu (26/2), masih porak poranda setelah daerah itu dilanda banjir bandang sehari sebelumnya. Jalan negara menghubungkan Beureunuen-Tangse terputus dan longsor terjadi di sejumlah titik menyebabkan hubungan trasportasi lumpuh total. Sedangkan evakuasi hanya bisa dilakukan dengan berjalan kaki dengan

menempuh medan berat. Pantauan Waspada, Minggu (26/2), sejumlah alat berat dikerahkan Pemkab Pidie untuk mengatasi longsor dan memindahkan gelondongan Lanjut ke hal A2 kol.2

Menag Tarik Rp 12 T Dana Haji Dari Bank

Rumah Dibakar, TNGL Kembali Memanas BESITANG (Waspada): Situasi di Taman Nasional Gunung Leuser (TNGL) wilayah SPTN VI Resort Sekoci, Kec. Besitang, Kab. Langkat, kembali memanas setelah satu unit rumah milik seorang petani dibakar sekelompok orang tak

dikenal, Sabtu (25/2) sore. Pembakaran rumah milik, Efendi Barus, 65, spontan menyulut kemarahan ratusan petani. Para petani beramairamai mendatangi kantor BB TNGL yang saat itu ditempati sejumlah personil TNI. Petani

yang marah hendak melakukan pembakaran bangunan kantor, namun dapat decegah Kapolsek Besitang, AKP Sukerman bersama Kanit Reskrim Ipda Rohman, dan Lanjut ke hal A2 kol.6

PEKANBARU (Antara): Menteri Agama (Menag) Suryadharma Ali mengatakan, pihaknya tengah memindahkan Rp 12 triliun dana haji di sejumlah Bank Penerima Setoran (BPS) Biaya Penyelenggara Ibadah Haji (BPIH) ke dalam sukuk. “Alasan saya, cuma untuk menyelamatkan dana haji,” kata Suryadharma Ali pada acara peletakan batu pertama pembangunan asrama haji di Pekanbaru, Sabtu (25/2) petang. Ia mengatakan, sesuai aturan, jika ada bank mengalami bangkrut, dana haji yang tersimpan tak ada jaminan diganti utuh atau sepenuhnya. Untuk bank konvensional, penggantian maksimal hanya sebesar Rp 200 miliar. Lanjut ke hal A2 kol.3

Ada ‘Tanda-tanda’ ONH Bakal Naik Waspada/Muhammad Riza

KASAT Reskrim Polres Pidie AKP Jatmiko memperlihatkan sepucuk senjata SS-1 berikut 19 amunisi, setelah diserahkan seorang warga, Minggu (26/2).

Anak Luar Nikah Riskan

JAKARTA (Antara): Muslimat Nahdlatul Ulama menilai putusan Mahkamah Konstitusi mengenai status anak yang lahir di luar nikah sangat riskan, terutama jika dikaitkan dengan hukum Islam. Ke p a d a w a r t a w a n d i Jakarta, Minggu (26/2), Ketua Umum Muslimat NU Khofifah

Indar Parawansa mengakui putusan MK terkait dengan uji materi Pasal 43 UU Nomor 1 Tahun 1974 tentang Perkawinan sangat baik ditinjau dari sisi kemanusiaan dan administrasi negara. “Tapi niat baik ini bisa jadi

PEKANBARU (Antara): Menteri Agama RI, Suryadharma Ali menyatakan tantangan haji di tahun 2012 sangat berat, sehingga mungkin terjadi kenaikan ongkos haji yang disertai dengan tanda-tanda, termasuk kenaikan bahan bakar minyak. “Tanda-tanda kenaikan ongkos haji yang dimaksud ada tiga, diantaranya adalah berkaitan dengan pemondokan haji di tanah suci,” kata Menag di Pekanbaru, Sabtu (25/2). Untuk diketahui, katanya, bahwa di tanah suci Makkah terdapat sekitar 1.700 lebih pemondokan haji yang terletak tepat di sekitar Masjidil Haram. Lanjut ke hal A2 kol.6

Lanjut ke hal A2 kol.6

Sesalkan Jika Rosa Tak Dilindungi

JAKARTA ( Waspada): Lembaga Perlindungan Saksi dan Korban (LPSK) akan meninjau ulang pemberian perlindungan kepada saksi kunci sekaligus terpidana kasus suap Wisma Atlet Sea Games, Mindo Rosalina Manulang. Hal ini menyusul pernyataan kuasa hukum Rosa, Ah-

Imam Abubakar Ash-Shiddiq

KABUL (AP): Protes pembakaran kitab suci Alquran makin marak di Afghanistan, dan memaksa Presiden Hamid Karzai mengulangi imbauannya Minggu (26/2), agar masyarakat tenang. Imbauan itu disampaikannya dalam pidato nasional melalui televisi setelah protes maut terhadap pembakaran Alquran di satu pangkalan AS memasuki hari kelima. Aksi itu juga tidak mengindahkan permohonan maaf dari Presiden AS Barack Obama, dan sampai Minggu jumlah korban tewas tercatat 30 orang, termasuk empat tentara Amerika, sejak insiden tersebut dimulai Selasa lalu.

MEDAN (Waspada): Plt Gubernur Sumatera Utara, H Gatot Pujo Nugroho, mengatakan, Pemerintah Provinsi Sumatera Utara mengalokasikan dana pembangunan Islamic Center pada APBD Tahun Anggaran 2012 sebesar Rp60 miliar. Hal tersebut dikatakan Gatot dalam sambutannya pada acara peringatan Maulid Nabi Muhammad SAW 1433 H di Masjid Raya Aceh Sepakat, Sabtu (25/2). Menurut Gatot, pembangunan Islamic Centre di Sumatera Utara sangat penting dan sudah menjadi kebutuhan pemberdayaan umat. Islamic Center menurutnya, memiliki banyak fungsi selain sebagai pusat kegiatan ibadah dan penguatan persatuan dan silaturrahim umat Islam. Fungsi lain yang diemban di antaranya sebagai pusat pemberdayaan ekonomi umat yang sesuai dengan normanorma Islam, sebagai pusat pengembangan pendidikan Islam dan penerapan

Lanjut ke hal A2 kol.3

Lanjut ke hal A2 kol.1

Oleh: H Ameer Hamzah Sebelum Islam ia termasuk orang kaya. Setelah Islam ia waqafkan semua hartanya untuk perjuangan Islam. Setelah wafat dia tidak mewariskan apa-apa untuk anakanaknya.


SEORANG paramedis Afghanistan membawa seorang pemrotes yang cedera dalam satu unjukrasa anti-AS di Mehterlam, Provinsi Laghman, di timur Kabul, Afghanistan, Sabtu (25/2).

Protes Pembakaran Alquran Kian Marak

Dua Perwira AS Tewas

mad Rifai, kepada publik terkait salah seorang menteri yang meminta jatah fee 8 persen dalam sebuah proyek yang melibatkan Rosa. Meski demikian, Ahmad Rifai, menyayangkan pernyataan LPSK yang mengancam Lanjut ke hal A2 kol.6

Ada-ada Saja

Rp60 M Untuk Islamic Center

Al Bayan

SAHABAT utama Rasulullah SAW adalah Sayyidina Abu Bakar Ash-Shiddiq. Beliau telah memberi keteladanan bagi para pemimpin yang datang kemudian. Beliau memimpin manusia untuk kejayaan di dunia dan kejayaan di akhirat. Beliau menjalankan amanah dengan istiqamah. Bersumpah demi Allah akan memerangi orang-orang yang membangkang dari manhaj Islami. Seluruh jiwa dan raganya, harta dan kekayaannya telah diserahkan untuk Islam. Waktu belum Islam ia termasuk orang kaya raya, setelah Islam hartanya diberikan untuk perjuangan dakwah agama suci ini. Rasulullah pernah bertanya kepada Abubakar. Apa yang tersisa darimu Abubakar? Tidak ada ya Rasulullah, kecuali Allah Lanjut ke hal A2 kol.1


DALAM gambar yang direkam, Sabtu (25/2) malam, terlihat rumah kediaman, Efendi Barus, menyisakan puing-puing akibat dibakar orang tidak dikenal.

Setiap Tahun Menikah

Waspada/Surya Efendi

DUTA Besar RI untuk Denmark dan Lithuania, Prof Dr H Bomer Pasaribu, M.Si berbincang sangat akrab dengan Wapemred Harian Waspada H. Teruna Jasa Said saat acara syukuran B omer Pasaribu menjadi Dubes, yang dilaksanakan dalam acara bersahaja di Jalan Sei Belutu Medan.

Promosikan Sumut Di Denmark Dan Lithuania SUMATERA Utara dikenal memiliki khasanah budaya yang sangat menarik. Setiap kabupaten dan kota di Sumut memiliki kesenian dan budaya yang khas. Ini benar-benar kekayaan yang tidak ternilai. Dalam berbagai even budaya yang diselenggarakan, tidak jarang membuat turis mancanegara tampak berdecak kagum. Belum lagi objek wisatanya yang sungguh menakjubkan, misalnya panorama Danau Toba yang memang sangat Lanjut ke hal A2 kol.2

Ada beragam cara bagi tiap pasangan untuk mengungkapkan rasa cinta mereka terhadap satu sama lain. Namun tak jarang cara mereka tempuh untuk mengungkapkannya terkadang cukup unik. Seperti yang dilakukan pasangan suami istri asal California Amerika Serikat (AS) Susan dan Evan Money yang memilih untuk melangsungkan pernikahan setiap tahunnya. Pasangan itu awalnya hanya merencanakan untuk menikah satu kali saja, namun setelah menjalani perayaan pernikahan yang menurut mereka sangat romantis, Lanjut ke hal A2 kol.1

Serampang - From Sidimpuan to Denmark bah...! - He.... he....he....

Berita Utama


Janda Dua Anak Lawan Dua Perampok AP

CHANDRA Bahadur Dangi asal Nepal, dinobatkan sebagai orang terpendek di dunia oleh Guinness World Records dalam sebuah upacara yang berlangsung di Katmandu, Nepal, Minggu (26/2). Pria berusia 72 tahun tersebut memiliki ukuran hanya setinggi 21,5 inch (54,6 sentimeter), mengalahkan pemegang rekor sebelumnya Junrey Balawing asal Filipina yang memiliki tinggi 23,5 inchi (60 sentimeter).

Ada-ada Saja...

akhirnya mereka memutuskan untuk menikah di tempat yang berbeda setiap tahunnya. “Evan adalah seorang pria yang sangat romantis, dia benarbenar cinta sejatiku. Aku tidak pernah berpikir Aku akan hidup sebahagia ini. Ini adalah pernikahan ke 15 ku dengan Evan dan Aku belum pernah sebahagia ini sebelumnya,” ujar Susan seperti dikutip Daily Mail pada Jumat, (24/2). Pasangan ini tercatat telah melangsungkan pernikahan di 15 tempat yang berbeda. Di antaranya di atas balon udara, di sebuah hotel di Las Vegas, di sebuah peternakan di Fort Lauderdale dan di beberapa tempat lainnya. Susan mengatakan, mereka telah menikah di lima gereja yang berbeda dan pernikahan mereka dilakukan oleh 11 pendeta yang berbeda pula. “Pernikahan di pantai dengan lumba-lumba adalah pernikahan favoritku. Itu benar-benar adalah yang paling indah. Dan Aku tidak pernah bisa berhenti menangis,” ujar Susan. Sementara itu menurut Evan pernikahan favoritnya sama dengan istrinya, yakni, di sebuah pantai yang terletak di Hawai.“Melihat wajah Susan yang begitu gembira membuatku ikut bahagia,” ujar Evan. Tahun ini mereka berencana untuk melangsungkan pernikahan ke 16 mereka dalam sebuah pertandingan sepak bola di AS. “Melangsungkan pernikahan setiap tahun memang membutuhkan biaya yang sangat besar. Namun ini adalah cara yang romantis untuk merayakan cinta Kami,” tambah Susan.(ok/rzl)

Rp60 M...

konsep-konsep Islam secara integratif dan konprehensif, sebagai pusat jaringan kerjasama antara institusi Islam yang telah ada dan yang akan lahir. Sebelumnya penceramah Al Ustadz Drs Amiruddin MS mengatakan, masyarakat menginginkan kehadiran masjid yang representatif di Sumut, yang dapat dibuktikan dengan banyaknya elemen masyarakat yang berkenan membantu pendanaannya. Amiruddin mengungkapkan, sekitar 200 pengusaha yang merupakan etnis Minang yang ada di Sumut sudah berkomitmen ikut mendanai pembangunan masjid dengan masing-masing pengusaha berani menyumbang Rp100 juta. Peringatan Maulid yang diselenggarakan DPC II Aceh Sepakat tersebut dihadiri anggota DPD RI DR Rahmatshah, Wali Nanggroe Aceh Tgk Malek Mahmud Al-Haidar, Kapolda Aceh Irjen Pol Iskandar Hasan dan ratusan masyarakat Aceh yang ada di Sumut. (m28)


warga yang tinggal jauh di pedalaman. Sebelumnya, ia tidak mengetahui adanya imbauan itu. Begitu mendapat informasi, Minggu (26/2) pagi. Warga itu langsung menghubungi kami untuk menjemput senjata tersebut plus amunisinya berjumlah 11 butir,” papar Jatmiko. Senjata berikut 11 amunisi kini diamankan di ruang SatReskrim. Pihaknya terus melakukan razia siang malam untuk mencari senjata ilegal yang diduga masih disimpan atau digunakan warga. (b10)

Al-Bayan... dan rasul-Nya. Umar bin Khattab pernah menangis sejadi-jadinya ketika Abu Bakar wafat. Abubakar tidak meninggalkan sedikitpun harta untuk anak-anaknya. Beliau meneladani Rasulullah SAW yang tidak meninggalkan harta kepada putrinya Fatimah Azzahra. “Demi Allah Abu Bakar telah menyulitkan semua orang untuk menirunya”, kata Umar bin Khattab. Kalau Abubakar mau, beliau akan menjadi orang paling kaya, sebab beliaulah sebagai pemimpin (khalifah) pertama setelah wafat rasul. Kekuasaannya bukan tujuan untuk mengumpulkan harta, tetapi untuk menjaga iman manusia agar tidak terjerumus dalam dosa. Kalau Nabi menangis karena takut umatnya tersesat, Abu Bakar juga menangis karena masalah yang sama.”Jangan ada di antara kalian sesudah wafatku yang meninggalkan syariat Islam! Wahai Umar, wahai Usman, wahai Ali, wahai Thalhah, wahai Zubeir, jagalah Islam! Bandingkan dengan pemimpin masa sekarang. Sebelum menjadi pemimpin ia orang miskin, setelah menjadi pemimpin menjadi orang kaya. Setelah mati hartanya tinggal di dunia. Anak-anaknya kadang-kadang memperebutkan harta yang banyak. Sementara di alam barzakh ia menanggung siksa karena di dunia telah diJawaban Problem Catur, perbudak oleh harta duniawi.

TTS Dan Sudoku


Dari Halaman Sport. Jawaban Problem Catur 1. ......, Me1+. 2. Rh2, MxB. 3. MxM, RxB (Jika 3. Bb8+, KxB. 4. MxM, Kf5. Putih menyerah karena Menterinya sulit menahan promosi d2 sendirian).

Jawaban TTS: O R T A L A R A P O O R P O R E P O R T O D R O P T E E L I R P O R P O S P O R T




Jawaban Sudoku:

6 4 2 8 5 7 1 3 9

9 1 3 6 4 2 8 7 5

7 5 8 3 1 9 4 6 2

sepedamotornya raib. Korban warga Dusun III, Desa Paya Lombang, Kec. Tebingtinggi, Kab. Serdang Bedagai, selanjutnya membuat pengaduan ke Polsek Tebingtinggi. Menurut penuturan korban, saat kejadian ia baru dari Kota Tebingtinggi usai bermalam minggu. Saat menuju pulang, tiba di lokasi, dia dipepet dua pelaku mengendarai sepedamotor Vixon. Saat itulah ia terjatuh dan

sepedamotornya coba dirampas pelaku. Karena melakukan perlawanan, pelaku menghajar korban dengan membabi buta. Wajah korban babak belur dan bagian mata sebelah kiri membengkak. Sepedamotornya dibawa kabur. Kapolsek Tebingtinggi, AKP AE Harahap ketika dikonfirmasi wartawan, Minggu (26/2), berharap warga yang berpergian malam hari agar jangan seorang diri. (a11)

H Amri Tambunan Keynot Speaker Seminar PD Melayu Deliserdang MEDAN ( Waspada): H Amri Tambunan gelar Datuk Utama Wira Wangsa yang juga bupati Deliserdang akan menjadi keynot speaker pada seminar sehari yang digelar PD MABMI (Majelis Adat Budaya Melayu Indonesia) Kab.Deliserdang di Balairung Pemkab DS, Selasa(27/2). Seminar yang dihadiri Pemangku Adat Kesultanan Serdang Drs T.Ahmad Thala’a, zuriat Kesultanan Serdang, para orang besar kerajaan,Wazir, Datuk, Penghulu Adat, cende-

kiawan, para tokoh dan lintas etnis akan membahas dan mengusulkan agar Bandara Kuala Namu diberi nama Bandara Sultan Sulaiman Shariful Alamshah, Sultan Serdang yang selama hidupnya banyak berjasa bagi rakyat Deliserdang maupun Serdang Bedagai. H Syarifuddin Rosha selaku panitia didampingi Sahrul ‘Ayun’ Yunan dan Fahrurrozi di Medan Minggu(26/2) mengatakan, selain H Amri Tambunan, seminar menghadirkan pembicara dari akademisi dan intelektual dari USU dan

Unimed, antara lain Hj. T Silvana Sinar, Subilhar.Juga Kepala Angkasa Pura II. Menurut H Syarifuddin Rosha, seminar yang digelar PD MAMBI Deliserdang merupakan langkah –langkah dalam mewujudkan masyarakat Melayu semakin bermartabat serta mengeksiskan adat budaya bersimbol :Tak Melayu Hilang Di Bumi serta Sekali Air Bah Sekali Tepian Berubah. Untuk itu, nama Sultan Sulaiman Shariful Alamshah harus diwujudkan menjadi Bandara di Delissrdang. (m11)

Dua Perwira...

kepolisian . Militer AS belum menyiarkan nama-nama dari kedua korban perwira itu. Karzai mengatakan masih banyak orang yang belum tahu tentang penembakan itu.”Siapa yang melakukan ini dan apakah dia adalah seorang Afghanistan atau orang asing, kami belum tahu. Kami sedih dengan kejadian itu dan menyatakan dukacita yang dalam kepada keluarga korban,” katanya. Taliban menyatakan penembak adalah seorang simpatisan kelompok tersebut dan seorang temannya telah membantunya masuk ke dalam kompkleks untuk membunuh warga Amerika itu sebagai pembalasan atas pembakaran Alquran. Obama mendukung Presiden Obama mendukung langkah-langkah komandan NATO di Afghanistan untuk melindungi para petugas AS di sana setelah pembunuhan dua petugas AS di Kementerian Dalam Negeri. Obama juga menyambut seruan Presiden Hamid Karzai untuk tenang, kata Gedung Putih. Presiden berbicara dengan Jenderal AS John Allen setelah

NATO menarik semua staf yang bekerja di kementerian-kementerian Afghanistan menyusul serangan itu, yang terjadi di tengah protes kekerasan terhadap pembakaran lembar-lembar Alquran di satu pangkalan militer NATO di dekat Kabul. “Kami menyambut pernyataan damai Presiden Karzai pagi ini, dan seruannya untuk dialog dan tenang,” kata Gedung Putih dalam satu pernyataan Sabtu. “AS tetap berkomitmen untuk kemitraan dengan pemerintah dan rakyat Afghanistan.” Sehari sebelumnya, ratusan warga Afghanistan ikut mengambil bagian dalam aksi-aksi protes anti-AS di empat provinsi yang berbeda, kata pihak berwenang. Itu adalah hari kelima demonstrasi marah karena pembakaran Alquran yang menewaskan 24 orang. Tetapi seorang demonstran di Mihtarlam, di Provinsi Laghman timurlaut, bernama Abdullah, yang ada di kerumunan massa “sekitar 2.000 orang “ mengatakan: “unjuk rasa berubah menjadi kerusuhan dan mereka melemparkan batu ke istana gubernur. (m10)


Namun, jika dana tersimpan di sukuk, selama negara masih berdiri akan dijamin 100 persen oleh pemerintah. Di sukuk sendiri, dana haji yang sudah tersimpan saat ini sebanyak Rp 23 triliun. Dengan demikian, jika proses penarikan dana haji dari seluruh BPS BPIH selesai pada Februari 2012 ini maka jumlah dana haji yang tersimpan di sukuk mencapai Rp 35 triliun. Sisa dana haji yang ada di bank masih sekitar Rp 3 triliun. Menag mengakui penarikan dana haji dari BPS, baik bank konvensional BUMN

maupun syariah seperti di Bank Muamalat, telah menimbulkan kekecewaan di kalangan perbankan. Namun, menurutnya bank sudah cukup mendapat keuntungan dari dana tersebut dan penyelematan dana umat lebih penting. Tak setuju moratorium Menanggapi dipindahkannya dana haji dari BPS BPIH terkait adanya tudingan bahwa Kemenag tak mau menjalankan moratorium pendaftaran haji, menurut Suryadharma Ali, pendapat atau anggapan itu tidak tepat. Sebelumnya, Komisi Pemberantasan Korupsi (KPK) me-

minta Menag agar melakukan moratorium pendaftaran haji guna menghindari adanya kebocoran atau korupsi. Selain itu, moratorium dimaksudkan untuk menghindari penggelembungan dana haji dan kemudian disalahgunakan oknum Kemenag. Moratorium pendaftaran haji, menurut Menag, bukan solusi dalam pemberantasan korupsi. Jika memang dicurigai bahwa dana haji bakal disalahgunakan, atau berpotensi dikorupsi, menurut dia, maka bisa dicarikan jalan keluar dengan memberikan tenaga pendampingan.

nya H. Panusunan Pasaribu di Jalan Sei Belutu Medan, Sabtu (25/2). Di hadapan sejumlah wali kota dan bupati berbagai daerah di Sumut, Bomer Pasaribu mengungkapkan, seharusnya kerjasama sister city dilakukan dengan kota di negara maju, atau justru di negara super maju. ”Sister city seyogianya memang dilakukan dengan kota di negara maju, atau justru super maju. Bolehkah saya menjajaki salah satu kota di sana untuk sister city? Ya, saudara

kandung kota di sana dengan kota kita di Medan ini,” ujar Bomer pada acara yang juga dihadiri sejumlah tokoh eksekutif, legislatif, yudikatif, politisi, akademisi, tokoh masyarakat, pemuka agama dan pengusaha itu. Tentu saja, dengan ikatan kerjasama sister city, akan memudahkan untuk mengikat kerjasama saling menguntungkan antara dua kota, tidak saja di bidang ekonomi, pendidikan, juga di bidang lainnya seperti kebudayaan. Bahkan, momen

ini dianggap sangat pas untuk mempromosikan daerah di dunia internasional seperti di Denmark dan Lithuania. “Mulai Maret 2012, promosi tentang pariwisata terus dijajaki di Lithuania. Kita sekarang memang lagi punya nama, punya reputasi di mata Uni Eropa, karena negara-negara akreditasi kami memang anggota Uni Eropa,” ujar Bomer Pasaribu yang sudah mulai bertugas menjadi Dubes RI untuk Demark dan Lithuania sejak 1 Februari 2012. * Irham Hagabean Nasution

jang satu kilometer jalan hancur total. Di Desa Blang Malo satu unit jembatan ambruk akibat diterjang banjir. Keuchik Desa Kebun Nilam Mustafa Taib kepada Waspada mengungkapkan ekses dari bencana alam sebanyak 16 unit rumah hilang hanyut, di antaranya rumah milik Muhammad AR, 50, Abdullah Ali, 37 Nurlaili,Ruslan, 42,Adzwar, 35, Salman, 35,Sakdiah, 60,Basri. AG,37, Absah Makam, 70, Absah Ahcmad, 45, M. Jafar Sabi, 50, Khatijah, 60, Marhaban, 35, Abdurahman Abbas, 51,Ismail Yusuf, dan Salamah Saman, 35. Selain rumah, satu unit gudang PKK desa setempat hilang dan satu unit kilang kopi hanyut terseret bah. “ Ini data sementara. Jumlah ini bisa bertambah” katanya. Sekda Pidie M. Iriawan, selaku koordinator Posko bencana Kab. Pidie kepada Waspada mengungkapkan hubungan transportasi jalan yang masih terputus ditargetkan mulai normal sekira tiga hari ke depan. Saat ini pihaknya telah menurunkan

ratusan relawan dan belasan alat berat ke lokasi. Namun dalam usaha menerobos jalan yang putus itu, Pemkab banyak mendapatkan kendala. Antara lain medan yang berat dan banyaknya masyarakat yang lalu lalang untuk melihat kondisi sanak famili mereka yang masih terkurung. Masyarakat yang datang ke lokasi itu juga tidak membantu karena mereka hanya berdiri menyaksikan relawan bekerja. Bantuan Terus Berdatangan Banjir bandang akibat luapan sungai menyusul hujan deras yang melanda Kec. Tangse sejak sore hingga malam, Sabtu (25/2), mengundang banyak simpati dari berbagai kalangan dan terus mengirimkan bantuan untuk para korban. Pemkab Pidie Jaya sebagai kabupaten tetangga dekat dengan lokasi, hari itu juga menyerahkan bantuan untuk para korban. “Kita merupakan darah pertama yang mengirimkan bantuan untuk koban banjir bandang Tangse,” kata Bupati

Pidie Jaya, Drs HM Gade Salam, dalam percakapan melalui ponsel dengan Waspada, Minggu (26/2). Bantuan berupa beras, telur, ikan kaleng, minyak goreng, mi instan, daster, dan kaus kerah serta 150 orang relawan. Sementara Kacab PLN Pidie, Husaini, ketika dikonfirmasi menyebutkan sejak kejadian hingga sekarang, listrik untuk 4.819 pelanggan di Tangse padam total. “Saat ini, rekan PLN Area Sigli dan Rayon Beureuneun sedang memobilisasi untuk penanggulangan darurat,” terangnya. Ditanya berapa tiang listrik yang tumbang akibat banjir tersebut, dia menyatakan pihaknya belum menginventarisasi jumlah JTR dan pelanggan yang terkena mushibah. “Namun, untuk JTM sebagai urat nadi suplai energi listrik, yang terbawa arus ada 13 tiang atau 14 gawang JTM yang lokasinya terpencar di tujuh titik lokasi dan saat ini rekan-rekan PLN sedang fokus untuk yang ini dulu,” katanya. (b10/b04)

NATO dan pemerintah Inggr is memanggil para penasehat internasionalnya dari berbagai kementerian Afghanistan, Sabtu malam setelah dua penasehat militer AS — seorang letnan kolonel dan seorang mayor — ditemukan tewas di kantor mereka akibat tembakan. “Sekarang waktunya untuk kembali tenang dan jangan biarkan musuh-musuh kita menggunakan situasi,” kata Karzai. Ditanya tentang pemanggilan mendadak para staf NATO, Karzai mengatakan dia tidak memahami langkah tersebut. “Itu adalah langkah sementara pada saat rakyat Afghanistan marah atas pembakaran Alquran,” kata Karzai. “Kami tidak menentang ini,” katanya menambahkan. Masih belum jelas siapa yang menembak kedua perwira tersebut di dalam kantornya di Kementerian Dalam Negeri Afghanistan yang dijaga ketat atau apakah penyerangnya berhasil ditangkap. Media Afghanistan melaporkan — tanpa memberitahu sumbernya — korban adalah perwira intelijen

Serba “Por”

TTS Topik


kesohor. Sejumlah turis merasa tidak cukup sekali mengunjungi Danau Toba. Sumut memang luar biasa. Promosikanlah Sumatera Utara. Keseniannya, kebudayaannya. Sebab, Sumatera Utara memliki khasanah kebudayaan yang sangat menarik. Mari kita promosikan Danau Toba di luar negeri,” ujar Duta Besar RI untuk Denmark dan Lithuania Prof Dr H. Bomer Pasaribu, M.Si saat acara syukuran di rumah adik-

TEBINGTINGGI ( Waspada): Seorang janda beranak dua, Dewi Maya Hartati,27, nekat melawan dua perampok yang merampas sepedamotornya di Jalan Pondok Ringin, Desa Paya Bagas, Kec. Tebingtinggi, Kab. Serdang Bedagai, Sabtu (25/2) malam. Saat itu, Dewi melintas di kawasan tersebut mengendarai sepedamotornya BK 6282 NAP. Sedangkan kondisi Dewi, babak belur dihajar kawanan penjahat itu. Sedabgkan

4 2 9 5 6 3 7 1 8

1 8 5 7 9 4 3 2 6

3 7 6 1 2 8 5 9 4

8 3 4 2 7 6 9 5 1

2 9 1 4 3 5 6 8 7

5 6 7 9 8 1 2 4 3

Tangse... kayu berukuran besar, serta mengarahkan jalur air ke tempat yang aman dari pemukiman penduduk. Data diperoleh tidak ada korban jiwa meninggal dunia, namun dua orang warga dilaporkan luka-luka akibat terseret arus dan tertimbun tanah longsor. Informasi diperoleh Waspada dari Camat Tangse Jafaruddin, sebanyak 149 jiwa mengungsi di Blang Malo. Sedangkan 40 Kepala Keluarga (KK) warga Desa Kebun Nilam masih terkurung, dan sebagiannya berupaya melintasi medan berat untuk mencari logistik. Sementara data dari Camat, rumah yang hancur di Desa Blang Malo sebanyak delapan unit, di Desa Kebun Nilam sebanyak 17 unit, Desa Pulo Kawa sebanyak dua unit, dan Desa Ulee Gunong dua unit.” Total semuanya sebanyak 29 unit rumah hancur. Satu unit jembatan gantung di Desa Pulo Seunong terputus dan sepan-

Ada... “Nah jika seluruh pemondokan ini dilakukan pembongkaran, maka pemondokan bagi para jamaah haji Indonesia bisa lebih mundur lagi. Dan kalau pun mau tetap pada jarak yang sama, atau jarak yang lebih baik, maka biaya pemondokan akan jauh lebih mahal lagi,” kata Suryadharma. Tanda kedua terkait potensi kenaikan ongkos haji adalah, kenaikan harga bahan bakar minyak (BBM) baik secara global maupun di tanah air. Untuk diketahui, demikian Menag, bahwa pada tahun 2011 lalu, harga BBM itu masih berkisar antara 80 sampai 100 dolar AS per barrelnya. Sementara untuk tahun 2012 ini, katanya, posisi harga minyak sudah mencapai 190 dolar AS, dan hal demikian bisa menyebabkan ongkos

Sesalkan... akan mencabut perlindungan kepada Rosa itu. Menurut dia, ancaman tersebut merupakan bentuk pengingkaran terhadap upaya pemberantasan korupsi sebagaimana diatur pada pasal 1 ayat 3 UU Nomor 13 tahun 2006 tentang LPSK. “Ini menunjukkan bahwa setiap orang yang mengetahui, apalagi whistleblower harus dilindungi undang-undang. Bukan sebaliknya, mereka malah mencabut,”kataAhmad Rifai saat menggelar jumpa pers di kantornya, Jakarta, Minggu (26/2). “Kalau benar ada pencabutan, kami sangat menyayangkan.

Anak... justru menjerumuskan pada akhirnya,” katanya. Sebelum diuji materi, Pasal 43 Ayat (1) menyebutkan anak yang dilahirkan di luar perkawinan hanya mempunyai hubungan perdata dengan ibu dan keluarga ibunya. Sementara setelah diuji materi menjadi anak yang dilahirkan di luar perkawinan mempunyai hubungan perdata dengan kedua orang tua biologis dan keluarganya dapat mengajukan tuntutan ke pengadilan untuk memperoleh pengakuan dari ayah biologisnya melalui ibu biologisnya. Argumentasi yang melandasi keputusan ini, antara lain bahwa setiap anak adalah tetap anak dari kedua orang tuanya,

Rumah Dibakar... sejumlah anggota begitu menerima laporan tentang insiden pembakaran ini segera turun ke lokasi di kawasan tower guna melakukan cek tempat kejadian perkara (TKP). Malam itu, ratusan massa sudah berkumpul di depan kantor TNGL dan begitu melihat mobil double cabin yang ditumpangi Kapolsek tiba, massa langsung merapat. Selanjutnya aparat kepolisian bergerak menuju TKP dan diikuti ratusan warga. Dari TKP, petugas mengamankan barang bukti beberapa potong kayu sisa dari pembakaran. Setelah itu, polisi bergerak ke rumah berlantai dua yang terbuat dari papan. Di rumah kosong milik B. Sembiring, yang juga nyaris

WASPADA Senin 27 Februari 2012 haji naik. “Namun kita tidak pernah tahu, kapan kenaikan harga BBM dunia berimbas hingga ke dalam negeri. Bisa empat bulan mendatang bahkan bisa dalam waktu dekat ini,” katanya. Kondisi kenaikan BBM ini tidak hanya disebabkan krisis global, namun juga disebabkan konflik Iran dengan negara di Eropa dan Amerika. “Diketahui juga bahwa Iran mengancam akan menutup jalur perdagangan minyak, dan bahkan embargo minyak dan seterusnya dan seterusnya. Hal demikian bisa menyebabkan terus meningkatnya harga minyak dunia termasuk di Indonesia. Hingga akhirnya menyebabkan krisis ekonomi bahkan kenaikan ongkos haji tanah air,” ujarnya. Kemudian tanda-tanda ketiga, yakni nilai tukar rupiah terhadap dolar yang terus me-

nurun. “Untuk diketahui, pada tahun 2011 lalu, nilai tukar rupiah itu mencapai Rp8.300 sampai dengan Rp8.700 per Dolar AS. Namun sekarang sudah sampai diatas Rp9.000. Kondisi demikian juga bisa menyebabkan ongkor haji meninggi,” kata Menag. Kendati demikian, Menag berharap masyarakat di tanah air tidak kaget dan tidak perlu mengkuatirkan ketiga tandatanda yang diuraikan diatas. “Karena kami selaku pemerintah akan terus berusaha agar tidak terjadi kenaikan terhadap onkos haji,” ujarnya. Selama dana optimalisasi dan dana abadi umat itu masih mencukupi, demikian Menag, maka kenaikan ongkos haji akan disubsidi. “Nanti dengan dana abadi umat ini, kami akan menekan ongkos haji hingga tetap normal seperti biasanya,” kata Suryadharma.

Fungsi apa yang sebenarnya dilakukan LPSK,” tambahnya. Ji k a L P S K m e n c a b u t perlindungan terhadap kliennya, dia menduga, lembaga yang dipimpin Abdul Haris Semendawai itu ingin kasus dugaan tindak pidana korupsi yang diketahui Rosa tidak terungkap. “Kasus ini penuh dengan nuansa-nuansa lainnya sehingga timbul hal seperti ini,” ujarnya. LPSK, Rifai melanjutkan, seharusnya mendukung dan mengapresiasi tindakan Rosa yang melaporkan serta ingin membongkar kasus korupsi. Ketua LPSK Abdul Haris Semendawai sebelumnya mengatakan, akan meninjau ulang

perlindungan kepada Rosa. Menurut Semendawai, seharusnya Ahmad Rifai tidak menyampaikan menteri yang meminta jatah fee secara terbuka kepada publik, dan dapat dilaporkan secara diam-diam kepada Komisi Pemberantasan Korupsi. Karena yang dilakukan Ahmad Rifai justru akan membahayakan posisi Rosa. “Karena Rosa dapat menjadi target serangan balik dari pihakpihak yang keberatan atas pernyataan-pernyataan yang diungkap kuasa hukumnya. Jika itu sudah melalui persetujuan Rosa, maka perlindungan bisa dihentikan,” ujar Semendawai, Jumat (24/2).(vn)

terlepas apakah dia lahir dalam perkawinan yang sah atau di luar itu. Anak juga berhak memperoleh layanan dan tanggung jawab yang sama dalam perwalian, pemeliharaan, pengawasan, dan pengangkatan anak. Hal ini sesuai dengan UU Nomor 12 Tahun 2006 tentang Kewarganegaraan yang menyangkut hak asasi manusia (HAM). “Padahal, anak yang dilahirkan kurang dari enam bulan setelah akad nikah, menurut jumhur ulama tidak bisa dinasabkan kepada ayah biologisnya,” kata Khofifah. Konsekuensinya, anak yang lahir di luar perkawinan, tidak memiliki hak waris dan perwalian dari ayah biologisnya. “Kalau si anak hasil hubungan di luar nikah ini menikah

dan bapak biologisnya menjadi wali, maka tidak sah pernikahannya,” kata Khofifah. Oleh karena itu, Muslimat NU mendorong agar dilakukan koordinasi antara Kementerian Dalam Negeri, Kementerian Agama, Mahkamah Konstitusi, Majelis Ulama Indonesia, dan ormas Islam untuk mencari jalan keluar yang tepat dalam penataannya.“Agar terdapat sinergi antara hukum syariat dan hukum legal formal kenegaraan,” kata Khofifah. Lebih dari itu, lanjut Khofifah, pergaulan bebas yang dapat menjerumuskan pada perbuatan zina wajib dicegah. “Karena menimbulkan banyak kesulitan bagi anak sebagai individu maupun sebagai anggota masyarakat serta menimbulkan kekacauan nasab,” katanya.

dibakar, petugas menemukan beberapa bungkus daun ganja. Malam, para petani masih bertahan di kantor TNGL. Mereka membuka dapur umum. Warga terlihat sangat emosi dan mengutuk atas peristiwa pembakaran tersebut. Pada kesempatan itu, AKP Sukerman, mengimbau kepada warga agar tidak melakukan tindakan anarkis. Korban saat ditemui Waspada mengatakan, saat kejadian pembakaran, ia sedang bertandang ke rumah ketua kelompok pengungsi, Ramani, di Sei. Minyak. Ia mengaku baru mengetahui rumahnya sudah rata dengan tanah setelah menerima kabar dari warga. Efendi Barus menyatakan, dalam insiden pembakaran ini, ia kehilangan harta benda di antaranya, perhiasan kalung

emas seberat 15 gram dan uang tunai Rp7,5 juta. Menurut korban, total kerugian yang dideritanya Rp28 juta lebih. Korban dan Rahmani menerangkan, sesuai dengan kesaksian warga yang melihat, pelaku pembakaran berjumlah delapan orang, yakni tiga di antaranya berseragam kehutanan dan lima orang lainnya berpakaian sipil. “Para pelaku menumpang mobil patroli,” ujarnya. Kapolres Langkat, AKBP Erick Bhismo melalui Kapolsek Besitang, AKP Sukerman dikonfirmasi terkait insiden pembakaran ini menyatakan, kasus ini sedang dalam proses penyelidikan. “Kita sedang menggali keterangan dari saksi dan hari ini Kabag Ops Polres juga turun,” terangnya.(a02)


Berita Utama

WASPADA Senin 27 Februari 2012

Dirjen Otda: RUU Pilkada Antisipasi Politik Uang Segera Diusulkan Ke DPR Hasbi Nasution Ketua DPK IKAPTK DS

Waspada/HM Husni Siregar

KETUA Dewan Pengurus Provinsi IKAPTK Sumatera Utara H Amri TambunanbersamaWabupDeliserdangHZainuddinMarsmemberikan ucapan selamat kepada Drs H Hasbi Nasution yang terpilih sebagai ketua IKAPTK Deliserdang, Sabtu sore (25/2) di balairung.

H Amri Tambunan Keynot Speaker Seminar PD Melayu Deliserdang MEDAN (Waspada): H Amri Tambunan gelar Datuk Utama Wira Wangsa yang juga bupati Deliserdang akan menjadi keynot speaker pada seminar sehari yang digelar PD MABMI (Majelis Adat Budaya Melayu Indonesia) Kab.Deliserdang di Balairung Pemkab DS, Selasa(27/2). Seminar yang dihadiri Pemangku Adat Kesultanan Serdang Drs T.Ahmad Thala’a, zuriat Kesultanan Serdang, para orang besar kerajaan,Wazir, Datuk, Penghulu Adat, cendekiawan, para tokoh dan lintas etnis akan membahas dan mengusulkan agar Bandara Kuala Namu diberi nama Bandara Sultan Sulaiman Shariful Alamshah, Sultan Serdang yang selama hidupnya banyak berjasa bagi rakyat Deliserdang maupun Serdang Bedagai. H Syarifuddin Rosha selaku panitia didampingi Sahrul ‘Ayun’ Yunan dan Fahrurrozi di Medan Minggu(26/2) mengatakan, selain H AmriTambunan, seminar menghadirkan pembicara dari akademisi dan intelektual dari USU dan Unimed, antara lain Hj. T Silvana Sinar, Subilhar.Juga Kepala Angkasa Pura II. Menurut H Syarifuddin Rosha, seminar yang digelar PD MAMBI Deliserdang merupakan langkah –langkah dalam mewujudkan masyarakat Melayu semakin bermartabat serta mengeksiskan adat budaya bersimbol :Tak Melayu Hilang Di Bumi serta Sekali Air Bah Sekali Tepian Berubah. Untuk itu, nama Sultan Sulaiman Shariful Alamshah harus diwujudkan menjadi Bandara di Delissrdang. (m11)

Janda Dua Anak Lawan Dua Perampok TEBINGTINGGI (Waspada): Seorang janda beranak dua, Dewi Maya Hartati,27, nekat melawan dua perampok yang merampas sepedamotornya di Jalan Pondok Ringin, Desa Paya Bagas, Kec. Tebingtinggi, Kab. Serdang Bedagai, Sabtu (25/2) malam. Saat itu, Dewi melintas di kawasan tersebut mengendarai sepedamotornya BK 6282 NAP. Sedangkan kondisi Dewi, babak belur dihajar kawanan penjahat itu. Sedabgkan sepedamotornya raib. Korban warga Dusun III, Desa Paya Lombang, Kec. Tebingtinggi, Kab. Serdang Bedagai, selanjutnya membuat pengaduan ke Polsek Tebingtinggi. Menurut penuturan korban, saat kejadian ia baru dari Kota Tebingtinggi usai bermalam minggu. Saat menuju pulang, tiba di lokasi, dia dipepet dua pelaku mengendarai sepedamotor Vixon. Saat itulah ia terjatuh dan sepedamotornya coba dirampas pelaku. Karena melakukan perlawanan, pelaku menghajar korban dengan membabi buta.Wajah korban babak belur dan bagian mata sebelah kiri membengkak. Sepedamotornya dibawa kabur. Kapolsek Tebingtinggi, AKP AE Harahap ketika dikonfirmasi wartawan, Minggu (26/2), berharap warga yang berpergian malam hari agar jangan seorang diri. (a11)

Ada-ada Saja... Susan dan Evan Money yang memilih untuk melangsungkan pernikahan setiap tahunnya. Pasangan itu awalnya hanya merencanakan untuk menikah satu kali saja, namun setelah menjalani perayaan pernikahan yang menurut mereka sangat romantis, akhirnya mereka memutuskan untuk menikah di tempat yang berbeda setiap tahunnya. “Evan adalah seorang pria yang sangat romantis, dia benarbenar cinta sejatiku. Aku tidak

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur 1. ......, Me1+. 2. Rh2, MxB. 3. MxM, RxB (Jika 3. Bb8+, KxB. 4. MxM, Kf5. Putih menyerah karena Menterinya sulit menahan promosi d2 sendirian).

Jawaban TTS: Serba “Por”

TTS Topik






Jawaban Sudoku:

6 4 2 8 5 7 1 3 9

9 1 3 6 4 2 8 7 5

7 5 8 3 1 9 4 6 2

4 2 9 5 6 3 7 1 8

1 8 5 7 9 4 3 2 6

3 7 6 1 2 8 5 9 4

8 3 4 2 7 6 9 5 1

2 9 1 4 3 5 6 8 7

5 6 7 9 8 1 2 4 3

pernah berpikir Aku akan hidup sebahagia ini. Ini adalah pernikahan ke 15 ku dengan Evan dan Aku belum pernah sebahagia ini sebelumnya,” ujar Susan seperti dikutip Daily Mail pada Jumat, (24/2). Pasangan ini tercatat telah melangsungkan pernikahan di 15 tempat yang berbeda. Di antaranya di atas balon udara, di sebuah hotel di Las Vegas, di sebuah peternakan di Fort Lauderdale dan di beberapa tempat lainnya. Susan mengatakan, mereka telah menikah di lima gereja yang berbeda dan pernikahan mereka dilakukan oleh 11 pendeta yang berbeda pula. “Pernikahandipantaidengan lumba-lumba adalah pernikahan favoritku. Itu benar-benar adalah yang paling indah. Dan Aku tidak pernah bisa berhenti menangis,” ujar Susan. Sementara itu menurut Evan pernikahan favoritnya sama dengan istrinya, yakni, di sebuah pantai yang terletak di Hawai. “Melihat wajah Susan yang begitu gembira membuatku ikut bahagia,” ujar Evan. Tahun ini mereka berencana untuk melangsungkan pernikahan ke 16 mereka dalam sebuah pertandingan sepak bola di AS. “Melangsungkanpernikahan setiap tahun memang membutuhkan biaya yang sangat besar. Namun ini adalah cara yang romantis untuk merayakan cinta Kami,” tambah Susan.(ok/rzl)

Albayan ... Seluruh jiwa dan raganya, harta dankekayaannyatelahdiserahkan untuk Islam.Waktu belum Islam ia termasuk orang kaya raya, setelah Islam hartanya diberikan untuk perjuangan dakwah agama suci ini. Rasulullah pernah bertanya kepada Abubakar. Apa yang tersisa darimu Abubakar? Tidak ada ya Rasulullah, kecuali Allah dan rasul-Nya. Umar bin Khattab pernah menangis sejadi-jadinya ketika Abu Bakar wafat. Abubakar tidak meninggalkan sedikitpun harta untuk anak-anaknya. Beliau meneladani Rasulullah SAW yang tidak meninggalkan harta kepada putrinya Fatimah Azzahra.“Demi Allah Abu Bakar telah menyulitkan semua orang untuk menirunya”, kata Umar bin Khattab. Kalau Abubakar mau, beliau akan menjadi orang paling kaya,

LUBUKPAKAM (Waspada) : Direktur Jenderal Otonomi Daerah (Dirjen Otda) Kementerian Dalam Negeri (Kemendagri) Prof DR Djoehermansyah Djohan MA menjelaskan, akan ada perubahan-perubahan undang-undang pemerintahan daerah setelah mengikuti dinamika perkembangan di tengahtengah masyarakat. Ini antara lain untuk mengantisipasi money politic (politik uang). “Rancangan Undang-Undang (RUU) tentang Pilkada segera diusulkan ke DPR sehingga ke depan pelaksanaan Pilkada

Visi Pemda... Chairuman mengatakan, otonomi daerah itu adalah pemberian kewenangan bagi daerah untuk melakukan improvisasi secara lebih leluasa dan bertanggung jawab untuk mensejahterakan rakyat. Menurutnya, ruh otonomi daerah itu terletak di situ, termasuk pemangkasan mata rantai birokrasi yang berbelitbelitsehinggapembangunanbisa berjalan lebih akseleratif. “Kinikitabisamelihatdanmerasakan, daerah dengan potensi sumberdaya alam yang begitu besar sekalipun pun, seperti Sumatera Utara, tidak memberi kemudahan bagi rakyatnya untuk berharap lebih sejahtera. Itu karena pemerintah daerah masih terpaku dengan tradisi lama Orde Baru yang sentralistik,’’ ujar Chairuman yang disebut-sebut salah

Rp200 Juta... Pihak yayasan tidak pernah mencari kontraktor untuk pemeliharaan seluruh bangunan yang ada di Masjid Agung. Semua bantuan di Masjid Agung ini diterima dalambentukbangunanyangsiap pakai. “Seperti bangunan kantor yayasan,inibantuandariPakRizal Nurdin.Wali Kota juga ada membantu dalam bentuk bangunan,” jelasnya. Menurut Abdul Mutholib, yayasantidakmengetahuijumlah biaya yang dikeluarkan untuk pengecatan Masjid Agung. “Bahkanpihakyayasantidaktahuuang itu bersumber dari APBD. Yang kami tahu, uang itu bantuan Gub-su pada masa Syamsul Arifin,” ujarnya. Sesalkan Sementara itu, enam dari 24 perwakilanwargayangbermukim di seputaran Masjid Agung Medan mendatangi Bumi Warta Waspada, Minggu (26/2) malam. Mereka adalah Nedy Lubis,Very Zano (mantan Ketua Remaja Masjid Agung Medan), Sofyanto,

Pemprovsu... Fungsi lain yang diemban di antaranya sebagai pusat pemberdayaan ekonomi umat yang sesuai dengan norma-norma Islam, sebagai pusat pengembangan pendidikan Islam dan penerapan konsep-konsep Islam secara integratif dan konprehensif, sebagai pusat jaringan kerjasama antara institusi Islam yang telah ada dan yang akan lahir. Sebelumnya penceramah Al Ustadz Drs Amiruddin MS mengatakan, masyarakat menginginkan kehadiran masjid yang representatifdiSumut,yangdapat dibuktikan dengan banyaknya elemen masyarakat yang berkenan membantu pendanaannya. Amiruddinmengungkapkan, sekitar200pengusahayangmerupakan etnis Minang yang ada di Sumut sudah berkomitmen ikut mendanai pembangunan masjid denganmasing-masingpengusaha berani menyumbang Rp100 juta. Peringatan Maulid yang diselenggarakan DPC II Aceh Sepakat tersebut dihadiri anggota DPD RI DR Rahmatshah, Wali Nanggroe Aceh Tgk Malek Mahmud Al-Haidar, Kapolda Aceh Irjen Pol Iskandar Hasan dan ratusan masyarakat Aceh yang ada di Sumut.(m28) sebab beliaulah sebagai pemimpin (khalifah) pertama setelah wafat rasul. Kekuasaannya bukan tujuan untuk mengumpulkan harta, tetapi untuk menjaga iman manusia agar tidak terjerumus dalamdosa.KalauNabimenangis karena takut umatnya tersesat, Abu Bakar juga menangis karena masalah yang sama.”Jangan ada di antara kalian sesudah wafatku yang meninggalkan syariat Islam! Wahai Umar, wahai Usman, wahai Ali, wahai Thalhah, wahai Zubeir, jagalah Islam! Bandingkan dengan pemimpinmasasekarang.Sebelum menjadi pemimpin ia orang miskin, setelah menjadi pemimpin menjadi orang kaya. Setelah mati hartanya tinggal di dunia. Anakanaknya kadang-kadang memperebutkan harta yang banyak. Sementaradialambarzakhiamenanggungsiksakarenadiduniatelah diperbudak oleh harta duniawi.

lebih efektif, jauh dari berbagai masalah yang membuat rusaknya moral masyarakat termasuk praktik politik uang,” ujarnya. Dijelaskan, dalam perbaikan iniakandapatmemunculkanpimpinan berkualitas yang pada gilirannya pemerintahan akan lebih efektif dan tidak terganggu seperti yang terjadi di beberapa daerah. Pernyataan ini dikemukakan Prof Djoehermansyah yang juga Ketua Dewan Pengurus Nasional Ikatan Keluarga Alumni Pendidikan Tinggi Kepamongprajaan (DPN-IKAPTK) Pusat pada pengukuhandanpelantikanDewan Pengurus Kabupaten Ikatan Keluarga Alumni Pendidikan Tinggi Kepamongprajaan (DPKIKAPTK) Deliserdang periode

2011-2016 di Balairung Pemkab Deliserdang di Lubukpakam, Sabtu (25/2) sore. HadirpadapelantikanBupati Deliserdang H Amri Tambunan, Wabup H Zainuddin Mars, unsur Muspida, Kakan Kemenag DeliserdangDrsHDurBrutuMA,pimpinanSKPDjajaranPemkabDeliserdang,utusanPemkabSer-dang Bedagai,unsurDPPIKAPTKSumut, Camat,KepalaDesa/Lurahse-Deliserdang serta undangan lainnya. Selaku Ketua DPN IKAPTK Pusat Prof DR Djoehermansyah Djohan MA menjelaskan hingga saat ini kepengurusan IKAPTK telah terbentuk di 15 provinsi dan akan terus berlanjut ke seluruh provinsi di Indonesia. Ketua DPP IKAPTK Sumut

yang juga Bupati Deliserdang dalam sambutan tertulis disampaikanDRArsyadLubismengatakan kehadiran IKAPTK diharapkan dapat memberi kontribusi bagikemajuanbangsadannegara dalam semangat abdi praja dharma satya nagara bakti di tengahtengah tantangan yang semakin besar seiring dengan derasnya arus perubahan yang melanda bangsa kita dewasa ini. Kepengurusan DPK IKAPTK Deliserdang Ketua,Wakil;DrsHHasbiNasution, DrsSarigunaTanjungMsidanDrs H Citra Efendi Capah MSP, Sekretaris,Wakil;DrsMAbduhRizaliSiregarMSi,KristinaHelenSiagiandan Bendahara,Wakil;MunaLubisS.Sos, IsmailSSTP,dibantubidang-bidang lainnya.(a06)

seorang calon kuat Pilgubsu 2013. Dikatakan, reformasi ekonomi dan reformasi hukum telah dilakukan,tetapidiamenilaireformasi birokrasi berlangsung lambat. Sejalan dengan Chairuman, Fadly Nurzal menunjuk urgensi penempatan prioritas sehingga pembangunan daerah tepat sasaran. Apa saja ada di sini, baik dilihat dari potensi SDA maupun potensi SDM. Prioritas diperlukan di tengah fakta kompleksitas permasalahan pembangunan. Baginya prioritas Sumatera Utara saatinisebaiknyadiletakkanpada pembangunan infrastruktur, kesehatan dan pendidikan. “Selama ini berbagai potensi yang sangat lengkap itu belum bisa dimanfaatkan secara maksimal. Hingga saat ini yang menjadi primadona PAD masih bertumpu pada Pajak Kendaraan Bermotor (PKB) dan Bea Balik Nama

Kendaraan Bermotor (BBNKB),”kataFadlyyangjugadisebutsebut sebagai tokoh yang bakal meramaikan bursa Pilgubsu mendatang. “Pembangunaninfrastruktur itusangatpenting,takhanyajalan, namun juga ketersediaan listrik, pelabuhan dan lainnya, agar para investornyamandanmaumasuk ke Sumut untuk menanamkan modalnya,” katanya. Potensi lainnya yang sangat besar, kata Fadly, yakni di sektor perkebunan. “Sumut memiliki perkebunan kelapa sawit yang sangat luas baik yang dikelola BUMN maupun swasta nasional dan PMA, namun manfaatnya tidak banyak dirasakan masyarakat Sumut. Penyebabnya, seluruh pajak dari perkebunan ini ditarik ke pusat dan daerah tidak mendapat jatah sama sekali,” ujarnya. (m07)

Rumah Dibakar...

Saman Kano, Sakwan Lubis dan Muklis Wahab. ‘’Kami keberatan dengan pernyataan pengurus Yayasan Masjid Agung Medan yang terbit di Harian Waspada edisi Sabtu (25/2), seolah-olah menyebut warga di sekitar masjid tersebut yangmengendalikanperparkiran, membuat onar, pencurian dan pengrusakan kendaraan. Ini jelas pencemaran nama baik. Justru kami mendukung Masjid Agung bebas parkir,’’ tegas Very Zano. Atas tuduhan yang tidak benar dan terkesan buang badan itu, mereka mengharapkan pihak Yayasan Masjid Agung menyampaikan permintaan maaf. Tidak Pernah Di tempat terpisah,Wali Kota Medan Rahudman Harahap mengatakan, pihaknya tidak pernah memberikan bantuan kepada pengelola Masjid Agung. Pasalnya, masjid tersebut masih dikelola yayasan. Jika diserahkan kepada Pemko Medan, Masjid Agung akan dikelola dengan baik. Rahudman menegaskan, selamaMasjidAgungdikelolaoleh yayasan,PemkoMedantidakakan memberikan bantuan. Secara Menyeluruh Sebelumnya, Sekretaris MUI Sumut Prof HasanBaktiNasution berharap agar persoalan bantuan yang bersumber dari APBD untuk Masjid Agung dapat diselesaikan secara menyeluruh, agar duduk persoalannya menjadi jelas.

“Harus diselesaikan, “ kata Hasan Bakti seraya menjelaskan bahwa, Abdullah Syah sedang berada di Malaysia. Sedangkan seorang jamaah Masjid Agung, Sugiri mengucapkan terima kasih kepada Harian Waspada terkait pemberitaan perparkiran. Hal itu sebagai bentuk perhatian media massa terhadap keresahan jamaah Masjid Agung. Sebab, orang yang memarkirkan kendaraannya di halaman Masjid Agung bukan untukmelaksanakanshalat, tetapi untuk berbelanja. Evaluasi Kebijakan Sementara itu, Wakil Ketua DPRDSU Sigit Pramono Asri, meminta pengurusYayasan Masjid Agung menghentikan polemik tentanghalamanmasjiddijadikan areal parkir. Caranya dengan mengevaluasi kebijakan yang salah tersebut. Bukan dengan memberi keterangan yang akan menyudutkan mereka. Berbicara melalui telefon seluar, Minggu (26/2), Sigit Pramono Asri, mengaku kecewa membaca pernyataan pengurus Yayasan Masjid Agung di Harian Waspada edisi Jumat (24/2). Anggota dewan dari Partai Keadilan Sejahtera (PKS) ini menilai, pernyataan yang disampaikan para pengurus tidak lebih hanya sebagai pembelaan diri. Kamis pekan lalu pimpinan Harian Waspada menugaskan beberapawartawanuntukmeng-

Promosikan Sumut...

yangjugadihadirisejumlahtokoh eksekutif, legislatif, yudikatif, politisi, akademisi, tokoh masyarakat, pemuka agama dan pengusaha itu. Tentusaja,denganikatankerjasamasistercity,akanmemudahkan untuk mengikat kerjasama salingmenguntungkanantaradua kota,tidaksajadibidangekonomi, pendidikan,jugadibidanglainnya seperti kebudayaan. Bahkan, momen ini dianggap sangat pas untuk mempromosikan daerah di dunia internasional sepertidiDenmarkdanLithuania. “Mulai Maret 2012, promosi tentang pariwisata terus dijajaki di Lithuania. Kita sekarang memang lagi punya nama, punya reputasidimataUniEropa,karena negara-negara akreditasi kami memanganggotaUniEropa,”ujar Bomer Pasaribu yang sudah mulai bertugas menjadi Dubes RI untukDemarkdanLithuaniasejak 1 Februari 2012. Irham Hagabean Nasution

hadiriundangankhususpengurus Yayasan Masjid Agung. Pihak yayasan yang hadir, seperti Ketua Dewan Komisaris H.Abdul Mufholib Sembiring, Ketua Umum Prof. Bachtiar Fanani Lubis, Penasehat H.Bachtiar Djafar, Ketua III Husna Harahap, Sekretaris Umum H.Abdul Rahim Harahap,Wakil Sekretaris Suriono dan Wahid Nazri. Namun,pihakyayasanmasih juga tidak mau mengakui telah salahmembuatkebijakanitu.Yakni dengan pernyataan, tidak tahu secara pasti jumlah uang yang diperoleh dari pungutan parkir setiap bulannya. Yayasan juga mengaku tidak pernah mematok tarif kendaraan yang parkir di halaman rumah Allah itu. Bentuknya hanya infaq dan sadaqah. Yayasan juga sangat keberatan dituding telah melakukan bisnis. Rp300 juta Begitu juga dengan bantuan dana APBD, menurut Sigit, Pemprovsu beberapa kali pernah mengucurkan dana. Selain yang telah diberitakanWaspada, dana APBD yang dikucurkan Rp200 juta pada tahun 2010, Sigit juga mencatat APBD Perubahan tahun 2004 pernah dikucurkan untukMasjidAgungyaknisebesar Rp300 juta. Disebutkan Sigit Pramono, bantuan Rp300 juta itu memang tidaklangsungditerimapengurus Yayasan.Bantuandiberikanuntuk pengerjaan lantai yang menghubungkantempatwudhukdengan teras masjid serta pembuatan pagar. Bantuan ini diserahkan melalui pos Biro Perlengkapan. Berkaitandengankoreksiyang disampaikan masyarakat melalui media massa,Wakil Ketua DPRD SumutSigitPramonoAsri,meminta pengurusYayasan Masjid Agung untukmenghentikanpolemik.(h02/ m22/m46/m50/m37/m12)

kebudayaannya.Sebab,Sumatera Utaramemlikikhasanahkebudayaan yang sangat menarik. Mari kita promosikan Danau Toba di luar negeri,” ujar Duta Besar RI untuk Denmark dan Lithuania Prof Dr H. Bomer Pasaribu, M.Si saat acara syukuran di rumah adiknya H. Panusunan Pasaribu di Jalan Sei Belutu Medan, Sabtu (25/2). Di hadapan sejumlah wali kota dan bupati berbagai daerah di Sumut, Bomer Pasaribu mengungkapkan, seharusnya kerjasama sister city dilakukan dengan kota di negara maju, atau justru di negara super maju. ”Sister city seyogianya memang dilakukan dengan kota di negara maju, atau justru super maju. Bolehkah saya menjajaki salah satu kota di sana untuk sister city? Ya, saudara kandung kota di sana dengan kota kita di Medan ini,” ujar Bomer pada acara

Dua Perwira... Militer AS belum menyiarkan nama-nama dari kedua korban perwira itu. Karzai mengatakan masih banyak orang yang belum tahu tentang penembakan itu.”Siapa yang melakukan ini dan apakah dia adalah seorang Afghanistan atau orang asing, kami belum tahu.Kamisedihdengankejadian itudanmenyatakandukacitayang dalam kepada keluarga korban,” katanya. Taliban menyatakan penembak adalah seorang simpatisan kelompok tersebut dan seorang temannya telah membantunya masuk ke dalam kompkleks untuk membunuh warga Amerika itu sebagai pembalasan atas pembakaran Alquran. Obama mendukung Presiden Obama mendukung langkah-langkah koman-

dan NATO di Afghanistan untuk melindungi para petugas AS di sana setelah pembunuhan dua petugasASdiKementerianDalam Negeri. Obama juga menyambut seruan Presiden Hamid Karzai untuk tenang, kata Gedung Putih. Presidenberbicaradengan Jenderal AS John Allen setelah NATO menarik semua staf yang bekerja di kementerian-kementerian Afghanistan menyusul serangan itu, yang terjadi di tengah protes kekerasan terhadap pembakaran lembar-lembar Alquran di satu pangkalan militer NATO di dekat Kabul. Tetapi seorang demonstran di Mihtarlam, di Provinsi Laghman timurlaut, bernama Abdullah,yangadadikerumunanmassa “sekitar2.000orang“mengata-kan: “unjuk rasa berubah menjadi kerusuhandanmerekamelemparkanbatukeistanagubernur.(m10)

menyulutkemarahanratusanpetani. Para petani beramai-ramai mendatangikantorBBTNGLyang saatituditempatisejumlahpersonil TNI. Petani yang marah hendak melakukanpembakaranbangunan kantor, namun dapat decegah Kapolsek Besitang, AKP Sukerman bersama Kanit Reskrim Ipda Rohman, dan sejumlah anggota begitu menerima laporan tentang insiden pembakaran ini segera turun ke lokasi di kawasan tower guna melakukan cek tempat kejadian perkara (TKP). Kapolres Langkat, AKBP Erick Bhismo melalui Kapolsek Besitang, AKP Sukerman dikonfirmasi terkait insiden pembakaran ini menyatakan, kasus ini sedang dalam proses penyelidikan. (a02)


Orang Terpendek Di Dunia KATMANDU (AP): Seorang jompo Nepal berusia 72 tahun yang tingginya kira-kira seukuran anak balita, Minggu (26/2) dinyatakan sebagai pria terpendek di dunia yang ukurannya belum pernah tercatat sebelumnya. Seorang dokter dan pejabat GuinnessWorld Records mengukur Chandra Bahadur Dangi (foto) untuk mempertegas ukuran tingginya 54,6 cm. Pejabat Guinness Craig Glenday menyerahkan pada Dangi dua sertifikat yang menyatakan dia menjadi pria terpendek dunia yang masih hidup sampai saat ini dan dia adalah pria terpendek dunia yang tercatat dalam 57 tahun sejarah Guinness. (m10)

PWNU Gelar... Panitia Konferwil Drs H Mhd Hatta Siregar SH., MSi, dan Sekretaris Drs H Abdullah Nasution kepada wartawan di kantor PW NU Sumut, Jalan Sei Batanghari Medan, Sabtu (25/2). Konferwil XV NU Sumut ini, kata Ashari, mengambil tema “Meningkatkan Khidmah Nahdliyyah Sumut di Tengah Pluralitas Bangsa yang Sejahtera, Demokratis dan Bermartabat”. Untuk itu, Konferwil akan diisi cermah Ketua Umum PB NU Prof Said Aqil Siradj bertajuk“AktualisasiWawasan AhlussunnahWaljamaah dalam Kehidupan Berbangsa”. Juga ada ceramah “Strategi Pengembangan Ekonomi Umat Berbasis Syari’ah”. Konferwil ini, tambah Ashari, digelar sehubungan akan berakhirnya kepengurusan PW NU Sumut periode 2007-2012 pada Maret mendatang. Tujuan konferwil antara lain mengevaluasi program kerja periode 2007-2012 sebagai dasar menentukan kinerja NU Sumut lima tahun ke depan. Forum bahstul masail dan penyusunan program kerja mewarnaijalannyaacaradenganmelibatkanseluruhstakholder,seperti ulama dan pimpinan pondok pesantren. “Agenda lainnya adalah memilih dan menyusun pengurus PW NU Sumut masa khidmat 2012-2017,” ujar Ashari Tambunan didampingi Wakil Ketua Panitia Upar Pulungan SH, Wakil Sekretaris Emir Elzuhdi Batubara SH, Wakil Sekretaris Pengarah Drs H Khairuddin Hutasuhut, dan Bidang Bakti Sosial Ir Baharuddin Berutu. Ditanya tentang bursa calon ketua tanfidziyah (eksekutif-red) dan Rois Suriyah (pimpinan tertinggi), Ashari menyatakan, tradisi NU lebih mengedepankan mengusung kriteria ketimbang nama figur calon. Dia berharap konferensi yang diikuti 350 peserta dari unsur wilayah, PB dan 32 pengurus cabang (PC) itu, tradisi seperti itu tetap mewarnai Konferwil XVI NU Sumut, sehingga terhindar dari hiruk pikuk money politics (politik uang). Pra-Konferwil Sementara, Ketua Panitia H Mhd Hatta Siregar dalam kesempatan itu mengatakan, sebelum pelaksanaan Konferwil, panitia menggelar sejumlah kegiatan pra-konferensi. Antara lain bahtsul masail diniyah ulamapesantrendiPadangLawasUtarapada25-26Maret.Silaturahmi alim ulama, tokoh dan kader NU Sumut di aula PW NU Sumut 23 Maret mendatang. Juga ada kerjasama penertiban aset tanah NU Sumut dengan Badan Pertanahan Nasional (BPN). Memberikan bingkisan kepada petugas kebersihan di tiga kecamatan di Medan. Rapimnas Lembaga Takmir Masjid Regional Sumbagut di Medan. Panitia menerbitkan profil tokoh dan ulama NU Sumut sertaWarta NU Sumut.(m13)

Menag Tarik... Penempatan ini, merupakan tindak lanjut dari penandatanganan nota kesepahaman bersama (MoU) antara Menkeu dan Menag pada 22 Oktober 2009 lalu, tepatnya tentang Tata Cara Penempatan Dana Haji dan Dana Abadi Umat dalam SBSN dengan metode ‘private placement’. Menurut Menag, upaya tersebut adalah untuk membenahi aliran dana haji yang selama ini “tercecer” dibanyak perbankan sehingga sulituntukmelakukanpengontrolandanbahkanrentanmendatangkan kerugian besar bagi negara. “Seluruh dana tersebut sudah dan akan diambil dari sejumlah bank agar tidak tersebar dibanyak bank. Uang tersebut akan disimpan dalam bentuk sukuk di Kemenkeu,” katanya. Sampai dengan hari ini, dana yang dikumpulkan sudah mencapai Rp23 triliiun, sambungnya. Tidak dipungkiri, demikian Suryadharma, akibat penarikan dana haji ini, banyak perbankan yang menjerit karena uang yang biasa diputar untuk kepentingan perusahaan perbankan itu kini mulai berkurang. “Bayangkan, masing-masing bank itu ada yang Rp50 miliar, ada yang Rp400 miliar dan bahkan ada yang satu triliun rupiah. Hal ini harus dilakukan untuk mengamankan uang ibadah haji,” katanya. Satu hal yang sangat dikhawatirkan sehingga langkah ini harus dilakukan adalah kalau mereka (pihak bank) bangkrut, negara hanya menerima penggantian sebesar Rp2 miliar dan ini sangat merugikan. Makanya, kata Suryadharma, Kemenag mengambil langkah upaya dimana dana haji itu disimpan pada satu rekening yakni di Kemenkeu guna menghindari potensi kerugian. Sampai saat ini diakui Suryadharma, masih ada sekitar Rp12 triliun lagi dana haji yang tersimpan dalam rekening perbankan.

Tangse Masih... warga dilaporkan luka-luka akibat terseret arus dan tertimbun tanah longsor. Informasi diperoleh Waspada dari Camat Tangse Jafaruddin, sebanyak 149 jiwa mengungsi di Blang Malo. Sedangkan 40 Kepala Keluarga (KK) warga Desa Kebun Nilam masih terkurung, dan sebagiannya berupaya melintasi medan berat untuk mencari logistik.(b10/b04)

Luar Negeri

WASPADA Senin 27 Februari 2012

Kim Keluarkan Ancaman Sebelum Latihan AS-Korsel SEOUL (AP): Pemimpin Korea Utara (Korut) Kim Jong-un mengancam akan melakukan serangan balasan yang kuat terhadap Korea Selatan (Korsel) jika terprovokasi, kata media pemerintah Minggu (26/ 2), sehari sebelum dimulainya latihan militer tahunan AS-Korsel yang disebut Pyongyang sebagai satu latihan invasi. Para pejabat Korsel dan AS mengatakan latihan 12 hari itu, yang sebagian besar merupakan latihan perang dengan simulasi komputer yang sifatnya defensif. Laporan tentang ancaman itu dikeluarkan sehari setelah seorang utusanseniorASmengatakanhubunganantarakeduaKoreaharus

diperbaiki sebelum AS dan Korut dapat mencapai kemajuan nyata hubungan mereka. Kim,panglimatertinggimiliter Korut yang berkekuatan 1,2 tentara, menyatakan komentarnya dalam satu kunjungan ke satuansatuan militer garis depan, termasuk satu kesatuan yang menembaki kepulauan Korsel tahun 2010lalu,demikianmenurutkantor berita nasional Korean Central News Agency. Sebelumnya, Korut juga memperingatkan, dua latihan gabungan militer AS-Korsel mendatang samadengan deklarasi perang. Dalam satu artikel yang diterbitkan oleh kantor berita resmiKCNA,KomisiPertahananNasional Korut menyebutkan bahwa latihan militer yang direncanakan itu adalah “tantangan terang-terangan terhadap perdamaian dan keamanan di Semenanjung Korea.” ASdanKorselmerencanakan

dua latihan militer bersama, Key Resolve dan Foal Eagle, mulai pekan depan sampai akhir April. Komisi Pertahanan Nasional memperingatkan dalam artikel tersebut bahwa latihan militer pada dasarnya“deklarasi bisu perang,” yang akan disertai dengan “pembalasan fisik yang sesuai. ”Korutmengancamakanmelakukan perang suci terhadap AS dan Korsel. AS dan Korsel juga berniat akan menggelar latihan militer gabungan pada pekan depan. Komisi Pertahanan Nasional Korut (NDC) mendeskripsikan latihan militer kedua negara itu merupakan hal yang tak termaafkan. Pekan lalu, Korut juga bersumpah akan melancarkan serangan balasan bila ada peluru artileri yang mendarat di perairan Korut saat latihan militer berlangsung. Latihan militer itu digelar di Laut Kuning, wilayah yang berada di dekat Korut. Pemerintah Korut juga

dikabarkan meminta warga sipil yang bermukim atau bekerja di dekat lokasi latihan militer AS agar mengungsi. Pembicaraan sejum-

lah negara dengan Korut mengenaiprogramnuklirSabtu,tampaknya belum akan menemukan terobosan baru. (cnn/ok/m10)

Pakistan Mulai Ratakan Rumah Osama Bin Laden PESHAWAR, Pakistan (Reuters): Pasukan keamanan Pakistan mulai meratakan dengan tanah rumah di mana pemimpin alQaida Osama bin Laden dibunuh pasukan khusus AS di Abbottabad Mei lalu, kata seorang polisi senior di kota itu. Tembok pembatas dan bagian atas gedung tersebut sudah dihancurkan tengah malam, kata Karim Khan kepada Reuters, tanpa memberi keterangan lebih rinci atau mengatakan apa alasan penghancuran rumah tersebut Sabtu (25/2).(m23)

Syria Gelar Referendum RUU Konstitusi Di Tengah Kekacauan DAMASKUS, Syria (AP/ Antara/RIANovosti):SyriaMinggu (26/2) mengadakan referendum nasional mengenai rancangan konstitusi baru dipandang oleh

pemerintah sebagai bagian dari solusi krisis politik di negara ini. Rancangan dokumen, yang diusulkan oleh rezim Presiden Bashar al-Assad yang diperangi, pada dasarnya akan mengakhiri hampir 50 tahun kekuasaan Partai Baath dan mengantar pada “era baru reformasi demokrasi” di Syria.Sekitar 15 juta orang Syria yang memenuhi syarat untuk memilih, tetapi dengan situasi keamanan yang mudahmenguapdidaerah,jumlahpemilih yang sebenarnya tidak dapat diprediksi. Pihak oposisi Syria menyebut referendum sebagai“satu permainan politik” dan mendesak para pemilihuntukmemboikotkegiatan itu. “Gagasan referendum di tengah situasi saat ini tidak masuk akal,” kata Aref Dalila, salah seorang apemimpin oposisi kepada RIA Novosti. KementerianLuarNegeriSyria menyatakankelompokbersenjata di Provinsi Homs, Syria Tengah, menolakuntukmenyerahkanmayat dua wartawan asing kepada pemerintah. “Di luar motif kemanusiaan, pemerintahyangberkompetendiHoms, Jumat,mengirimam-bulans-BulanSabit MerahdanmenugasisejumlahtetuaHoms untukmeya-kinkankelompokbersenjata dipe-mukimanbergolakBabaAmruntuk menyerahkanmayatduawartawanasing secaragelapberadadiSyria,”katakementeriantersebutdidalampernyataandisiarkanolehkantorberitaresmiSANA.(m10)


3.000 Warga Malaysia Protest Perusahaan Tambang Australia KUALA LUMPUR, Malaysia (AP): Sekitar 3.000 warga Malaysia menggelar aksi unjuk rasa Minggu (26/2) menentang berdirinya pabrikpenyulinganyangdibangun perusahaan tambang Australia, Linas, karena dikhawatirkan akan menimbulkanpencemaranradiasi. Aksi tersebut merupakan demonstrasi terbesar menentang pabriksenilaiAS$230jutayangakan dibangundibagiantimurMalaysia danbisamenimbulkansakitkepala bagipemerintahmenjelangpemilihannasionalyangdiperkirakanakan berlang-sung tahun ini. Pihak berwenang baru-baru ini memberikan surat izin kepada Lynasuntukmengoperasikanpabrik penyulinganhasilbumilangkapertamadiluarChina.PabrikdiPahang itudiproteskarenaresikokesehatan danlingkunganyangtimbuldengan potensibocornyalimbahradioaktif. Lynasmengatakanpabriknya,yang akanmenyulingbijiradioaktifdari Australia, memiliki pengawasan polusidanmenurutrencanaakan mulaiberoperasiJunimendatang.

Para pengunjukrasa, termasuk anggota parlemen dari kalangan oposisi, bertekad menekan pemerintahuntukmenghentikan proyekitu.Banyakdiantaramereka mengenakan kaos berwarna hijau bertuliskan‘Hentikan Lynas’ dan mereka meneriakkan katakata ‘Hancurkan Lynas’ dalam aksi unjukrasa selama dua jam di Pahang, ibukota Kuantan. Pemimpin oposisi Anwar

Ibrahim mengatakan, aliansinya akan mengajukan mosi darurat keparlemenuntukmendesakpemerintahmembatalkanproyekitu. Diajugaberjanjipartaioposisiakan menghentikan pabrik itu jika memenangkan pemilihan nasional yang dijadwalkan berlangsung Juni.“Kami tidak mau proyek ini mengorbankan kebudayaan dan keselamatan anak-anak kami,” katanyadihadapanmassa.(m23)

Ribuan Orang Bentuk Rantai Manusia Dalam Protes Anti-Putin MOSKOW (AP): Ribuan orang yang saling berpegangan tangan membentukrantaimanusiasepanjang16kmyangmemanjangdiMoskow Pusat dalam satu protes terakhir menentang PM RusiaVladimir Putin. Putin, yang menjabat presiden dari 2000 sampai 2008, kini mencalonkan diri untuk masa jabatan ketiga dalam pemilihan 4 Maret mendatang. Dia diperkirakan akan memenangkan pemilihan dengan mudah, namun gelombang protes yang tak terduga telah menggoyahkancitranyasebagaiseorangpemimpinkuatyangberkuasa dengan dukungan luas publik. Para aktivis memperkirakan mereka membutuhkan 34.000 orang Minggu (26/2) untuk membentuk rantai manusia sepanjang Garden Ring dan mereka tampaknya berhasil mengumpul massa.(m10)

Pentas Demokrasi Aceh

A4 Suara Sementara Pilkada Langsa

Suara Sementara Pilkada Lhokseumawe

Suara Sementara Pilkada Aceh Timur

WASPADA Senin 27 Febuari 2012

Suara Sementara Pilkada Aceh Utara

Balon Aceh Selatan Makin Ramai TAPAKTUAN(Waspada): Munculnya bakal calon (balon) Bupati Aceh Selatan, periode 2013-2018, sebagaimana diberitakan harian ini dua hari lalu, menjadi pembicaraan hangat masyarakat. Ini juga mengundang beragam tanggapan dari para tokoh politisi di sana. Sejak Kamis hingga Jumat (23-24/2) kemarin misalnya, pembicaraan balon bupati ini menjadi agenda tersendiri bagi kalangan anggota DPRK Aceh Selatan. Para calon yang muncul bukan hanya 10 seperti yang diberitakan, melainkan mencapai 13 orang. Selain membicarakan sosok figur yang paling tepat menggantikan posisi Husin Yusuf, mereka juga merekam para balon yang mulai bergerilya ke pedesaan, guna menggarap dukungan melalui pengumpulan fotocopy KTP, sekaligus mencuri start berkampanye secara terselubung. Pembahasan serupa juga berlangsung di perkantoran dan

warung-warung kopi. Dengan bekal berita Waspada, terlihat terjadinya pro-kontra terhadap balon tertentu serta prediksi balon yang bakal dapat dukungan masyarakat. Dari 13 balon tersebut sebagian besar di antaranya, bakal maju melalui jalur independen. Karenanya tidak heran, para balon tersebut bagaikan berlomba-lomba menggarap dukungan KTP serta pembentukan timsesnya di kecamatan. “Dari hasil rekaman kami di pedesaan, jumlah balon yang muncul tercatat sebanyak 13 orang,” kata H.Khairul Yakob, Sekretaris Partai Golkar Aceh Selatan, sembari mengatakan dari jumlah tersebut termasuk tiga politisi yang ikut ambil bagian dalam Pilkada enam bulan ke depan. Ketua Komisi A DPRK Aceh Selatan itu mengaku geli-geli sedap membaca dan menelusuri sosok figur balon yang muncul, karena dinilai semua berbobot. Terlepas dari berbagai kekurangan sebagai manusia,

Panwas Nilai Calon Langgar Aturan IDI (Waspada): Baliho dan spanduk serta alat peraga lain milik Cagub/Cawagub, Cabup/Cawabup berserak di Kabupaten Aceh Timur. Panitia Pengawas (Panwas) setempat menilai calon tersebut telah mencuri start. “Tak hanya mencuri start, tapi juga telah melanggar aturan yang telah ditetapkan,” papar Ketua Panwaslu Aceh Timur Irhamsyah, SH melalui Ketua Divisi Penanganan Pelanggaran Tarmizi Hasan, S.Sos.I, M.A melalui siaran persnya yang diterima Waspada, Rabu (22/2). Dia menjelaskan, Panwas Aceh Timur menemukan alat peraga atau atribut baliho dan spanduk milik kandidat yang dipasang di tempat-tempat umum, namun pihaknya tidak mempersoalkan pemasangan yang di lakukan di depan Posko Timses kandidat yang ukurannya 5x5 meter. “Ada juga atribut dipasang di Warkop, namun saat kita komunikasikan para Timses kandidat menyatakan bahwa Warkop adalah sebagai Posko Timses,” jelas Tarmizi seraya menambahkan, hasil penelusuran Panwaslu Aceh Timur ternyata menurut pemilik warung kopi itu bukan posko kandidat. “Jadi Pemasangan atribut atau baliho kandidat ini sudah terindikasi mencuri start kampanye dan melanggar tahapan yang telah ditetapkan oleh KIP Aceh No. 31 tahun 2012 tentang masa kampanye baru boleh dimulai tanggal 22 Maret 2012,” sebut Tarmizi. “Panwaslu Aceh Timur mengimbau kepada semua calon menaati seluruh peraturan dan perundang-undangan dalam pelaksanaan Pilkada,” ujar Tarmizi. (b24)

Golkar Komit Dukung Ibnu Hasim-Adam BLANGKEJEREN (Waspada): Ketua Dewan Pertimbangan DPD II Golkar Gayo Lues H. Ibnu Hasim mengingatkan, sebagai ujung tombak partai, sistem kaderisasi Partai Golkar harus mampu menyiapkan kader baru partai dalam lima tahun ke depan sebagai tenaga inti dalam melakukan penggalangan di masyarakat untuk memperluas basis dukungan Partai Golkar guna menghadapi Pilkada. Hal itu disampaikan Ibnu Hasim usai memimpin rapat konsolidasi pengkaderan Partai Golkar di Aula Bale Musara Pendopo Bupati Gayo Lues, Sabtu (25/2). Dalam rapat itu hadir sejumlah Ketua DPC Partai Golkar dan barisan AMPG, kecuali Ketua Golkar H. Amru dan Ketua DPC Kec. Terangun H. Rabusah, karena berada di luar daerah. Sementara, AsrialYacobi, wakil ketua DPD Golkar, mengatakan gerakan kaderisasi secara menyeluruh akan dilaksanakan dalam waktu dekat, mengingat selain kebutuhan ini untuk tahun 2014 juga menghadapi Pemilukada pada 9 April nanti. “Saya harap seluruh pengurus DPD Partai Golkar Gayo Lues mendukung sepenuhnya pasangan Ibnu – Adam sesuai dengan Keputusan DPP Pusat, bahwa Golkar sebagai perahu pasangan Ibnu-Adam,” ujar Asrial. Asrial menambahkan, kaderisasi merupakan ujung tombak partai dalam upaya konsolidasi organisasi. Disamping itu, program kaderisasi juga bagian dari pelaksanaan catur sukses Partai Golkar, yakni sukses pemenangan di Pilkada, Pemilu legislatif dan Pilpres. (cjs)

para balon dianggap cocok dan tepat menjadi kandidat bupati. Hal serupa juga dikemukakan Ketua Partai Keadilan dan Persatuan Indonesia (PKPI) Aceh Selatan Khaidir Amin dan H.Ridwan A.Rahman (mantan Ketua DPD PAN Aceh Selatan). Kedua politisi ini mengaku ikut maju meramaikan balon kepala daerah. Ke-13 balon tersebut terca-

tat Husin Yusuf (bupati sekarang), Daska Aziz (Wabup), T.Sama Indra (Dirut Bank Aceh Cabang Sigli), Khaidir Amin (Ketua PKPI/Wakil Ketua DPRK Aceh Selatan), T.Mudasir (Ketua Partai Golkar Aceh Selatan), H.Ridwan A.Rahman (Anggota DPRK Aceh Selatan), Chairil Anwar (Mantan Kepala PT POS Cabang Banda Aceh). Mudatsir Kamil (Staf Di-

Para Calon Tebar Bantuan Ke Tangse SIGLI (Waspada): Bantuan banjir bandang Tangse, Minggu (26/2) pagi mulai berdatangan. Beberapa kandidat calon gubernur /wakil gubernur Aceh, bupati/wakil bupati Pidie mulai menebar pesona mengantarkan bantuan untuk warga korban banjir bandangTangse, Pidie. Antara lain pasangan Irwandi-Muhyan (cagub/wagub Aceh). Melalui Tim Ses Seuramoenya, pasangan ini telah mengantarkan bantuan masa panik berupa Sembako sebanyak tiga truk berisikan beras, telur ayam, mie instan, minyak goreng, air mineral, tepung terigu serta pakaian. Penyaluran bantuan itu dibenarkan Ketua regional satu Seramoe IrwandiMuhyan, IskandarYusuf didampingi Koordinator, Suryadi M

Jamil Simpang Perak kepada Waspada, Minggu (26/2). Menurut Iskandar Yusuf, bantuan tersebut merupakan bantuan tahap awal dan kemungkinan besar pihaknya akan kembali menambah menyalurkan bantuan untuk tahap berikutnya setelah Irwandi kembali dari kunjungan Takengon. Tim Seuramoe Irwandi/ Muhyan mendirikan Posko di Desa Blang Malo. Hal itu dilakukan supaya dapat menyalurkan bantuan kepada masyarakat secara merata. “Tetapi Karena masih banyak anggota dari Seuramoe Irwandi-Muhyan berada di Takengon, Aceh Tengah, maka kami mewakili untuk menye-rahkan bantuan tersebut untuk korban yang terkenak dampak musibah itu agar

benar-benar pulih” Suyadi. Selain itu Seuramoe Irwandi-Muhyan juga turut mengerahkan sebanyak 300 relawan ke lokasi banjir bandang Tangse untuk membantu warga yang menjadi korban banjir Sementara itu, Kandidat Bakal Calon Bupati Pidie, Salman Ishak melaporkan sejak bencana banjir bandang pihaknya langsung datang kelokasi dan keesokan harinya, Minggu (26/2) menyerahkan bantuan masa panik berupa sembako. Bantuan yang telah disalurkan kata Salman masih bersifat darurat dan kita tetap menyalurkan untuk tahap berikutnya. “ Saya berharap supaya korban bencana alam ini dapat tabah menghadapi cobaan ini” demikian Salman Ishak. (b10)

Qanun Pilkada Dinilai Inkonstitusional IDI (Waspada): Ketua DPD Gerakan Nasional Calon Independen (GNCI) Aceh, Safaruddin, SH, dengan tegas menolak Qanun Pilkada Aceh yang disahkan tanpa berpedoman ke Undang-Undang Pemerintah Aceh (UUPA). “Seharusnya pihak DPRA dan Pj. Gubernur berpedoman kepada UUPA dalam membuat qanun seperti yang di atur dalam Pasal 323-245,” tegas Safaruddin kepada Waspada, Jumat (24/2). Safaruddin berpendapat, pasal itu adalah pasal 96 yang disebutkan bahwa pada saat berlakunya qanun tersebut maka seluruh tahapan dan program yang telah ditetapkan dan dijalankan oleh Komisi Independen Pemilihan (KIP) dinyatakan tetap berlaku dan sah. “Hal ini bertentangan dengan pasal 7 UU No. 10 tahun 2004 yang mengatur tentang lex superiori derogat lege priori, Peraturan yang lebih tinggi mengesampingkan peraturan yang lebih rendah,” tegas Safaruddin. Selain itu juga, sambung pakar hukum asal Aceh Timur ini, Qanun Pilkada yang disahkan juga melanggar asas legalitas yang melarang berlakunya undang-undang secara surut (retroaktif). “Jadi secara umum suatu undang-undang adalah bersifat non-retroaktif, yaitu tidak boleh berlaku secara surut. Akantetapi,untukhal-haltertentu dimungkinkan untuk diberlakukan surut, contohnya ketentuan-ketentuan Pasal 1 ayat (2) KUHP dan pasal 43 ayat (1) UU Pengadilan HAM,” tegasnya. Safaruddin menjelaskan, dalam UUPA secara tegas di sebutkan dalam pasal 66 ayat (6) tata cara pelaksanaan tahapan pemilihan sebagaimana dimaksud pada ayat (2), ayat (3), ayat (4), dan ayat (5) diatur

oleh KIP dengan berpedoman pada qanun. “Logikanya, setelah adanya qanun maka KIP baru menyusun tahapan dengan berpedoman kepada qanun,” sebut Safaruddin. Ingatkan Pj. Gubernur Pengesahan qanun Pilkada tersebut, sambung Safaruddin lagi, telah melecehkan UUPA yang menjadi keistimewaan dan kekhususan Aceh. Padahal jauh-jauh hari GNCI Aceh telah mengingatkan Pj. Gubernur Aceh satu hari setelah menjabat agar menyelesaikan permasalahan Pilkada Aceh dengan

berpedoman ke UUPA, begitu juga dengan DPRA seharusnya komit dalam menjaga dan menjaga UUPA. (b24) Sebagai negara hukum, kata Safaruddin, selayaknya semua pihak harus taat pada aturan. “Jika pemerintah sendiri tidak taat pada aturan, maka bagaimana dengan rakyat,” katanya seraya menandaskan, GNCI Aceh akan melakukan Judicial Review terhadap qanun Pilkada yang disahkan DPRA dan Pj. Gubernur Aceh ke Mahkamah Agung (MA) di Jakarta dalam waktu dekat. (b24)

Sejumlah LSM Usulkan Hardansyah BLANGKEJEREN (Waspada): Menjelang Pemilihan Kepala Daerah yang berlangsung 9 April, sejumlah bupati/wali kota di 17 kabupaten/kota akan berakhir masa jabatannya. Berbagai prediksi tentang figur calon penjabat terus berhembus, terutama di sejumlah tempat berkumpulnya para politisi dan birokrat. Di Gayo Lues, mereka mulai menyebut-nyebut sejumlah figur nama bakal calon penjabat bupati yang akan diusul masyarakat dan sejumlah LSM ke Pj. Gubernur Aceh dan Menteri Dalam Negeri. Tidak hanya di level kabupaten, pembicaraan seputar calon Pj. Bupati Gayo Lues ini juga menjadi topik pembicaraan hangat di warung kopi di desadesa. Hal ini semakin terasa ketika banyak tokoh dari kalangan masyarakat dan LSM Gayo Lues meragukan usulan DPRK terhadap Pj. Bupati Gayo Lues. “Kami minta kepada Gubernur Aceh, agar hati-hati dalam

Penambahan Personil TNI Didukung BLANGPIDIE (Waspada): Maraknya tindakan intimidasi serta aksi teror oleh kelompok tertentu selama pelaksanaan Pemilihan kepala daerah di Aceh dinilai menjadi alasan yang tepat menambah personel TNI maupun Polri ke Aceh. “Berdasarkan apa yang terjadi akhir-akhir ini di gamponggampong seperti di pedalaman aceh saat ini sudah mulai muncul tindakan teror kita mengimbau agar semua pihak dapat memiliki komitmen yang sama untuk Pemilukada damai, jadi tidak perlu dipersoalkan dengan kehadiran dan peran aparat keamanan, karena tugasnya untuk melindungi dan mengayomi masyarakat,” sebut Ghazali Abbas Adan, salah seorang tokoh masyarakat Aceh melalui pesan singkatnya kepada Waspada Minggu (26/2). Ghazali Abbas Adan mantan anggota DPR RI dan juga salah seorang calon bupati di kabupaten Pidie Jaya itu juga menyampaikan kecamannya terhadap ‘kelompok merah-hitam’ yang selama ini dinilai sering melakukan tindakan teror dan intimidasi terhadap masyarakat dalam rangka memuluskan ambisi politik dengan cara-cara yang bertentangan dengan azas demokrasi dan Hak Azazi Manusia (HAM). “Ada kelompok tertentu yang mencoba memperkeruh suasana dengan melakukan tindakan teror dan intimidasi untuk tujuan politik, kita tentu mengecam sikap mereka yang tidak beradab dan melanggar HAM dan demokrasi, dan kita mengharapkan kepada semua elemen sipil yang cinta damai dan anti kekerasan untuk berani dan peduli menyuarakan kondisi ini secara transparan dan tegas terhadap mereka (kelompok) yang berperilaku tidak terpuji seperti itu, sehingga pelaksanaan Pilkada benar-benar terjamin berlangsung dengan jujur, bersih dan damai, agar dapat melahirkan pemimpin yang baik dan adil, bukan pemimpin yang lahir karena mengintimidasi rakyatnya,” tukas Ghazali Abbas Adan. Dipertanyakan Sementara itu pemerhati politik Aryos Nivada mempertanyakan pengamanan TPS oleh 4.000 prajurit TNI karena sebelumnya

nas Kementerian Kelautan dan Perikanan RI), Zulkarnaini (mantan Kadis Pendidikan Aceh Selatan), Ra-himanuddin (mantan Kepala BKD Aceh Selatan), Chairiwas Rahman (Sekretaris Baitul Mall Provinsi Aceh), Jasmiadi Jakfar (Anggota KIP Aceh Selatan), serta T.Asrul Ali (Kadis Pertambangan dan Energi Aceh Selatan). (b30)

Kodam Iskandar Muda dan Polda Aceh telah menyebutkan kondisi Aceh sudah stabil. “Ada keanehan ketika kondisi Aceh dikatakan sudah stabil oleh Kepala Penerangan Kodam Iskandar Muda dan Kapolda Aceh, tetapi kebijakan yang diambil tidak selaras antara ucapan dan tindakan. Sangat kental unsur kepentingan yang bermain di sini.” sebut Aryos Nivada, Pemerhati Politik dan Keamanan Aceh dalam sebuah diskusi non formal di Banda Aceh, Sabtu (25/2). Selain perbantuan 4000-an Tentara Nasional Indonesia ada juga permintaan dari Polda Aceh ke Mabes Polri untuk penambahan pengamanan Pilkada Aceh. “Sebelumnya harus diperjelas jumlah kebutuhan riil di lapangan berdasarkan sebaran TPS,” kata Aryos. TNI dan kepolisian, menurut Aryos, harus memperjelas format dan mekanisme pengamanan yang dilakukan kepada publik sehingga jelas transparasi kinerja dari kedua institusi vertikal tersebut. “Jangan sampai peluang penambahan pengamanan hanya dijadikan komoditas mencari keuntungan dari institusi tersebut. Terlepas bentuk keuntungan dari segi keuangan atau politis. Bilamana itu terjadi sangat disayangkan sebagai sebuah institusi melakukan kebijakan itu,” ungkap Aryos. Menurutnya, TNI dan Polri harus menjaga agar tidak melanggar aturan yang mengatur dua lembaga itu yakni UU 34 tahun 2004 tentang TNI dan UU No. 2 tahun 2002 tentang kepolisian. Agar tidak melanggar TNI dan Polri sebaiknya menurunkan angka penambahan personel dari TNI dalam Pilkada dan mengikutsertakan peran dari elemen masyarakat sipil untuk mengamankan jalannya Pilkada 2012. Sebelumnya, Pejabat TNI dan Polri Aceh melakukan pertemuan di Kodam Iskandar Muda membahas pengamanan Aceh menjelang Pemilukada, berbagai aksi penembakan, kriminal menjadi sorotan dalam pertemuan tersebut, terlebih paska penembakan pekerja asal jawa di tiga lokasi, Aceh Utara, Bireun dan Aceh Besar. (cb05/b08)

menampung usulan Pj Bupati Gayo Lues, karena salah dalam menentukan pemimpin akibatnyasangatfatal,”ujarArwin,Ketua Umum LSM ASARA, kemarin. Ditambahkan, tiga nama yang akan diusulkan DPRK ke Pj. Gubernur Aceh Tarmizi Karim dan Menteri Dalam Negeri, diragukan independensinya. Namun demikian kata Arwin, untuk mengantisipasi adanya kepentingan terhadap kelompok dalam penentuan Pj. Bupati Gayo Lues itu, sejumlah LSM telah sepakat, mendorong Hardansyah, SPd, MAP untuk mengisi kekosongan tampuk pemimpin Gayo Lues pada 6 Maret nanti. (cjs)

Waspada/Maimun Asnawi

626 Anggota Satlinmas mengikuti apel penyerahan dari Wali Kota Lhokseumawe kepada kepolisian Mapolres Kota Lhokseumawe, baru-baru ini.

Pemko Lhokseumawe Serahkan 626 Satlinmas LHOKSEUMAWE (Waspada): 626 Anggota Satuan Linmas diserahkan ke pihak kepolisian Mapolres Kota Lhokseumawe oleh Wali Kota Lhokseumawe Munir Usman, baru-baru ini. Polisi diminta untuk menggodok petugas Linmas itu agar siap mengamankan 259 TPS pada Pilkada 9 April mendatang. “Sampai dengan hari pencoblosan, Satlinmas kita serahkan ke pihak kepolisian agar mereka bisa ditatar kembali dan diberikan pemahaman tentang tata cara pengamanan TPS, sehingga Pilkada berjalan aman dan damai,” kata Munir Usman di Lapangan Hiraq usai apel

penyerahan Satlinmas. Munir juga mengatakan, hingga saat ini tidak ada persoalan dengan atribut dan berbagai peralatan serta perlengkapan petugas Linmas, karena semua kebutuhan telah dipenuhi. Orang nomor satu di Kota Lhokseumawe itu mengatakan tidak ada titik rawan di wilayah kekuasaannya. “Kepada petugas pada hari-H kita berikan dana paket Rp250 ribu untuk satu hari. Kita berharap, dengan adanya Satlinmas dan polisi, Pilkada berjalan aman, begitupun persoalan keamanan menjadi tanggungjawab semua pihak,” ucap Munir. (b18)

Baru Tiga Cabup Aceh Tamiang Memenuhi Syarat KUALASIMPANG (Waspada): Hasil verifikasi faktual yang dilakukan Komisi Independen Pemilihan (KIP) Kabupaten Aceh Tamiang terhadap fotocopi KTP untuk mendukung tujuh pasangan calon bupati-wabup Aceh Tamiang banyak yang tidak memenuhi syarat. Hal ini ditemukan petugas yang melakukan verifikasi saat mendatangi langsung ke alamat rumah pemilik KTP. Data hasil verifikasi faktual fotocopi KTP untuk dukungan persyaratan administrasi cabup-cawabup Aceh Tamiang dari non partai (calon perseorangan/calon independen) yang dihimpun Waspada dari KIP Aceh Tamiang, kemarin, pasangan H. Awaluddin-Saiful Anwar yang sebelumnya menyerahkan 15.568 lembar fotocopi KTP, namun setelah diverifikasi tercatat 12.025 lembar yang memenuhi syarat (MS) atau 77,24 persen yang memenuhi syarat (MS), sedangkan 3.543 lembar dinyatakan tidak memenuhi syarat (TMS). Pasangan Umar Ahmad-Sarmada menyerahkan 11.600 lemar, hanya 5.295 lembar yang MS (45,65 %). Pasangan M. Joni EvitaBuyung Arifin menyerahkan 12.987 lembar namun 9.194 lembar yang MS (70,79 %). Pasangan M.Nasir-Jabat Sumbada menyerahkan 11.360 lembar, hanya 7.842 lembar yang MS (69,03 %). Pasangan Lukmanul HakimBoeran menyerahkan 11.465 lembar, yang MS tercatat 9.882 lembar (86,19 %). Pasangan Zulfendi-Abul Hayat menyerahkan 8.597 lembar, hanya 4.354 lembar yang MS (50,65 %). Pasangan ABD Halim-Mahmud menyerahkan 9.151 lembar, hanya 5.203 lembar yang MS (56,86 %).

Ketua KIP Aceh Tamiang Izuddin ketika dikonfirmasi Rabu (22/2) membenarkan pihaknya sudah melakukan verifikasi faktual mulai tingkat desa (kampung), kecamatan (PPK) dan kini sedang diverifikasi kembali di KIP Aceh Tamiang. Menurut Izuddin, berdasarkan hasil verifikasi faktual fotocopi KTP dukungan dari ketujuh cabub-cawabup Aceh Tamiang itu, ternyata untuk sementara hanya ada tiga pasangan yang telah memenuhi syarat administrasi dukungan yaitu pasangan Awaluddin-Saiful Anwar, M. Joni Evita-Buyung Arifin dan Lukmanul HakimBoeran. “Persayaratan minimal adalah 8.508 lembar fotocopi KTP yang sah menurut ketentuan persyaratan yang berlaku, ketiga pasangan ini telah memenuhi syarat karena jumlah fotocopi KTP dukungannya sudah melebihi dari ketentuan yang berlaku. Ketiga pasangan ini tidak perlu lagi menambah jumlah fotocopi KTP ketika mendaftar pada 28 Februari-5 Maret 2012,” terang Izuddin. Sedangkan empat pasangan lainnya yang belum memenuhi syarat dukungan fotocopi KTP, tegas Izuddin, nanti jika ingin mendaftar harus menambah lagi fotocopi KTP dukungannya, maksimal yang boleh bagi mereka untuk menambah sebanyak 2 kali jumlah fotocopi KTP dukungan yang masih kurang. “Namun nanti fotocopi KTP yang mereka tambah akan diverifikasi lagi dan jika jumlahnya tidak memenuhi syarat minimal 8.508 lembar, maka mereka akan didiskualifikasi,” tegas Izuddin dan anggota KIP Ferry Irawan Nasution kepada Waspada, kemarin. (b23)









Bupati/Wali Kota


Wakil Gubernur :

Wakil Bupati/Wakil Wali Kota:

Data Pengirim (sesuai KTP)

Data Pengirim (sesuai KTP)





Alamat :

Alamat :

Mulai 1 Februari 2012 s/d sepekan sebelum pemilihan, Harian WASPADA menyiarkan polling pembaca berhadiah untuk Pemilihan Gubernur Aceh. Kupon polling yang telah diisi dapat dikirim langsung atau melalui pos ke Bumi Warta Harian WASPADA Jl. Brig. Katamso No. 1 Medan 20151 atau melalui agen-agen WASPADA antara lain: Jailani Agency/Nurhasanah Jl. Sudirman No. 1 Langsa, TB. Lautan Ilmu/Muchsin Salam, Jl. T. Umar No. 86, Langsa, Hamzah A.Gani.R/Arun Post Jl. Sukaramai No. 71, Lhokseumawe, Toko Buku Biruen Post Jl. Mawar No. 14 Bireuen, Abdul Aziz P Jl. Letjen Suprapto No. 19 Kualasimpang, T. Ardiansyah Perwakilan WASPADA Jl. Sri Ratu Syafiatuddin No. 21 Peunayong, Banda Aceh. Hasil polling akan diumumkan secara berkala, sesuai jumlah kupon yang diterima. Di akhir masa polling kuponkupon yang masuk akan diundi untuk menentukan pemenang yang akan diumumkan pada 15 April 2012. Para pemenang akan menerima hadiah sbb: Pemenang I : Rp. 1.000.000,Pemenang II : Rp. 750.000,Pemenang III : Rp. 500.000,-

Mulai 1 Februari 2012 s/d sepekan sebelum pemilihan, Harian WASPADA menyiarkan polling pembaca berhadiah untuk pemilihan bupati/wali kota di 6 kab/kota di Aceh (Aceh Timur, Langsa, Aceh Utara, Lhokseumawe, Banda Aceh dan Gayo Lues). Kupon polling yang telah diisi dapat dikirim langsung atau melalui pos ke Bumi Warta Harian WASPADA Jl. Brig. Katamso No.1 Medan 20151 atau melalui agen-agen WASPADA antara lain : Jailani Agency/Nurhasanah Jl. Sudirman No. 1 Langsa, TB. Lautan Ilmu/Muchsin Salam, Jl. T. Umar No. 86, Langsa, Hamzah A.Gani.R/Arun Post Jl. Sukaramai No. 71, Lhokseumawe, Toko Buku Biruen Post Jl. Mawar No. 14 Bireuen, Abdul Aziz P Jl. Letjen Suprapto No. 19 Kualasimpang, T. Ardiansyah Perwakilan WASPADA Jl. Sri Ratu Syafiatuddin No. 21 Peunayong, Banda Aceh. Hasil polling akan diumumkan secara berkala, sesuai jumlah kupon yang diterima. Di akhir masa polling kuponkupon yang masuk akan diundi untuk menentukan pemenang yang akan diumumkan pada 15 April 2012. Para pemenang akan menerima hadiah sbb: Pemenang I : Rp. 1.000.000,Pemenang II : Rp. 750.000,Pemenang III : Rp. 500.000,-


WASPADA Senin 27 Februari 2012

A5 Hasil Sabtu (Minggu WIB) Lyon vs Paris SG OGC Nice vs Caen Ajaccio vs Dijon Montpellier vs Bordeaux Valenciennes vs Lorient Evian vs AS Nancy Auxerre vs St Etienne

4-4 1-0 2-1 1-0 2-0 2-0 0-0

Klasemen Ligue 1


BOLA hasil sundulan gelandang AC Sulley Muntari (14) sudah melewati garis gawang ketika ditangkap kiper Juventus Gianluigi Buffon di San Siro Stadium, Sabtu (Minggu WIB), tetapi wasit menganulirnya.

Wasit Palsukan Hasil Tudingan Milan MILAN, Italia (Waspada): Gol menit 83 dari pemain pengganti Alessandro Matri di San Siro Stadium, Sabtu (Minggu WIB), menyelamatkan Juventus dari kekalahan dalam bigmacth melawan AC Milan. Juara bertahan Milan memimpin sejak menit 14 berkat gol Antonio Nocerino pada laga giornata 25 Liga Seri A itu. I Rossoneri mestinya dapat memantapkan keunggulannya, na-mun gol sundulan Sulley Mun-tari dianulir wasit Paolo Ta-gliavento menit 25. Keputusan kontroversial

wasit dalam duel yang turut dipelototi mantan pelatih Timnas Inggris Fabio Capello tersebut, kini menjadi pembicaraan terpanas di Negeri Pizza. Sebab bola hasil tandukan Muntari terlihat jelas telah melewati garis gawang, saat ditangkap kiper Juve Gianluigi Buffon, sehingga wasit dituding

telah memalsukan hasil duel. “Insiden itu tentu saja memalsukan hasil. Entah garis (gawang) tersebut digambar dengan salah atau agak terlalu besar,” sindir Massimiliano Allegri, allenatore Milan. “Tidak perlu melihat tayangan ulang. Hal itu sangat jelas dari semua sudut stadion. Pembatalan gol Muntari merugikan kami, karena kami bisa unggul 2-0,” ujarnya lagi, seperti dilansir Reuters, Minggu (26/2). Keputusan tersebut merupakan kekeliruan memalukan, namunwasit mengimbanginya dengan tidak mensahkan ‘gol’ Matri dengan alasan offside saat duel tinggal menyisakan waktu 11 menit. Hanya saja secara terpisah, sikap wasit terkesan cukup kejam.

“Sayangnya ada episode yang telah mempengaruhi permainan. Gol Matri? Sejujurnya saya tidak melihatnya, tapi paling tidak skor menjadi 2-1 jika gol Muntari disahkan,” klaim Allegri. Dengan hasil imbang ini, Il Diavolo tetap menjadi Capolista dengan 51 poin, satu poin di atas I Bianconeri. Namun LaVecchia Signora masih menyimpan satu partai tunda melawan tim papan bawah Bologna. Menurut penyerang Milan Robson de Souza alias Robinho, wasit telah membuat kesalahan fatal dengan tidak mengesahkan gol Muntari. Bomber asal Brazil itu malah menuding, kesalahan itu akan berimbas pada penentuan juara Seri A musim ini. “Itu sudah jelas. Luar biasa

Juve Klaim Keputusan Seimbang MILAN (Waspada): Striker Juventus Alessandro Matri, mengklaim keputusan wasit sudah seimbang dengan membatalkan gol gelandang AC Milan Sulley Muntari menit 25 serta gol dirinya menit 79. “Gol saya juga dianulir.0 Ini membuat kami seimbang dengan AC Milan. Sebab, seperti yang saya katakan, sundulan Muntari seharusnya menjadi gol,” papar Matri dalam Sky Sport Italia, Minggu (26/2). Pembatalan masing-masing satu gol dari kedua tim petarung oleh wasit Paolo Tagliavento dalam bigmatch Milan-Juve di San Siro Stadium pada giornata 25 Liga Seri A, Sabtu (MingguWIB), membuat hasil akhirnya seri 1-1. I Rossoneri unggul lebih

dahulu menit 14 lewat gol Antonio Nocerino, Matri kemudian membalasnya menit 83. Empat menit sebelumnya, Matri melepas tembakan dari dalam kotak penalti yang masuk ke gawang kiper Milan Christian Abbiati, tetapi wasit menilai bomber berumur 27 tahun itu sudah terperangkap offside. “Sangat penting kami mampu menyamakan kedudukan pada partai sulit seperti ini. Hasil imbang membuat perbedaan dalam klasemen liga, tapi ini tidak akan menentukan dalam perebutan gelar juara,” klaim Matri. Kiper Juve Gianluigi Buffon (foto kiri) sepakat dengan Matri. “Jujur, sundulan Muntari benar-benar membuat kami panik dan saya tidak menyadarinya,” jelasnya.

“Kami mengambil keuntungan dari situasi itu, tapi hal yang sama terjadi kepada kami di babak kedua. Mestinya, hasil akhir akan menjadi imbang 2-2,” klaim Buffon. Gol Milan yang dicetak Nocerino terjadi karena faktor ketidaksengajaan. Tendangannya dari luar kotak penalti membentur tubuh Leonardo Bonucci dan bola berbelok arah masuk ke gawang Buffon. “Saya tidak tahu arah bola akan berubah dengan sentuhan Leonardo. Saya siap untuk menepis bola, tapi saya benar-benar tidak tahu kalau itu langsung berbuah gol,” beber Buffon. Sedangkan Antonio Conte, allenatore Juve, mengakui kehebatan Milan yang berhasil menekan The Old Lady. “Mereka bermain dalam level tertinggi


dan berhasil membuat kami tertekan,” ucapnya. “Lepas dari pembahasan tentang Scudetto, semua orang pasti paham bahwa Milan bermain cantik, sedangkan Juventus hanya beruntung. Milan sangat kuat meskipun banyak pemain mereka yang absen,” tambah Conte. (m15/sky/fi) SKUAD PSSA Asahan diabadikan bersama pelatih Rudi Saari dan ofisial seusai mengalahkan Madina Medan Jaya pada lanjutan putaran kedua kompetisi Divisi I PSSI Grup II di Stadion Mutiara Kisaran, Minggu (26/2).


PSSA Balas Medan Jaya KISARAN (Waspada): Tuan rumah PSSA Asahan berhasil memenuhi ambisinya untuk revans kekalahan dari Madina Medan Jaya pada putaran pertama. PSSA menang 3-1 pada lanjutan putaran kedua kompetisi Divisi I PSSI Grup II di Stadion Mutiara Kisaran, Minggu (26/2). Turun dengan target menang, PSSA langsung unggul

di menit 11 melalui kerjasama tim yang berhasil diselesaikan Edy Syahputra. Belum puas dengan keunggulan satu gol, PSSA yang didominasi pemain PON Sumut 2012 ini terus menggempur gawang Medan Jaya yang dikawal Ilham Anggiat. Top skor sementara PSSA, Bambang Hardianto, akhirnya menambah pundi gol PSSA pada

menit 31. Memasuki babak kedua, ritme serangan tim besutan Rudi Saari ini tetap gencar. Alhasil, Deni Setiawan berhasil mengubah skor menjadi 3-0 hasil tendangan spekulasi dari tengah lapangan. Jelang injury time, wasit Arif Johan menghadiahkan penalti untuk Medan Jaya setelah pemain PSSA handsball di area

Klasemen Sementara PSSA PSDS MMJ Poslab MU PSPP

8 7 8 8 8 5

5 4 3 3 1 1

2 2 3 2 1 0

1 16-5 1 9-3 2 10-8 3 8-10 6 3-10 4 4-14

17 14 12 11 4 3

terlarang. Penalti itu dieksekusi dengan baik oleh M Iksan Lubis. Senin (27/2) ini, pertandingan dilanjutkan dengan mempertemukan Poslab Labuhanbatu berhadapan dengan PSDS Deliserdang. (a31/a15)

Sihar Terinspirasi Sukses Boca Junior JAKARTA (Waspada): Ketua Umum PSSI, Djohar Arifin Husin, resmi membuka SSB Boca Junior hasil kerjasama PT Pro Duta FC dan klub Argentina, Boca Junior, di Lapangan Aldiron Mabes TNI AU, Pancoran, Jakarta, Minggu (26/2). Dalam sambutannya di hadapan sekira 500 lebih anak usia 4-17 tahun, Djohar menyatakan hadirnya SSB klub raksasa asal Argentina di tanah air adalah suatu kegembiraan bagi sepakbola Indonesia. “Hari ini kembali terlaksana proses pembentukan pemain muda kita dengan dibukanya SSB Boca Junior. Filosofi menyebutkan Timnas Indonesia akan kuat, jika pembinaan usia muda kita kuat,” kata Djohar didampingi Sekretaris Exco Sarluhut Napitupulu dan Pengurus PSSI lainnya. Sihar Sitorus, pemilik SSB

Waspada/Yuslan Kisra

KETUA Umum PSSI Djohar Arifin Husin bersama pemilik SSB Boca Junior Indonesia Sihar Sitorus menyaksikan permainan ratusan anak di Lapangan Aldiron Mabes TNI AU, Pancoran, Jakarta, Minggu (26/2). Boca Junior, mengaku terinspirasi perkembangan dan sukses Boca Junior melahirkan pemain kaliber dunia sekelas Diego Maradona, Gabriel Batistuta, Carlos Tevez, dan lainnya. “Karena itu, .kami berupaya

membawa budaya klub raksasa asal Argentina ini ke Indonesia dan hari ini sudah bisa Anda saksikan. Jangan sia-siakan kesempatan dan segera daftarkan putra Anda,” ujar Sihar. Pihaknya menargetkan un-

tuk merekrut 5000 anak usia U4 sampai 17 tahun. Maka, SSB Boca Junior atau lebih dikenal dengan sebutan Boca Junior Football Schools Indonesia (BJFSI) akan dibangun di beberapa kota besar di tanah air. “Tahap pertama kami buka di Jakarta dan Medan. Untuk Kota Medan sudah berjalan kurang lebih dua bulan di markas Pro Duta FC. Hanya saja grand opening dilakukan di Jakarta. Kurikulum yang akan kita gunakan sepenuhnya juga mengdiadopsi langsung dari Boca Junior,” beber Sihar. Ditambahkan, pihaknya juga akan menerima beberapa pemain kiriman SSB Boca Junior asal Indonesia berlatih di Argentina. “Dengan begitu, kesempatan bermain di Eropa bagi anak Indonesia semakin terbuka. Kami juga memberikan beasiswa gratis bagi pemain berbakat,” katanya lagi. (yuslan)

gol tersebut tidak disahkan. Ini akan menentukan Scudetto,” kecam Robinho melalui Football Italia. Setelah unggul satu bola lewat gol Nocerino, tuan rumah terus menekan dan seharusnya mendapatkan gol kedua menit 25. Gelandang Ghana, Muntari, lantas menyundul bola rebound saat Buffon memblok tandukan Phillipe Mexes. “Di babak pertama kami sebenarnya mencetak dua gol. Saya tidak bisa mengerti kenapa hakim garis tidak mengesahkan gol Muntari,” be-ber Nocerino. “Dengan selisih dua gol, tentu semuanya akan berjalan berbeda. Hasil imbang ini berari hilangnya kesempatan bagi kami, karena target kami adalah mempertahankan posisi di puncak,” tambah Nocerino. Matri berhasil mengobati kekecewaan setelah golnya tidak disahkan wasit 79. Striker Italia itu mencetak gol penye-imbang kedudukan saat duel tinggal menyisakan tujuh menit. Menit 89, gelandang Juve ArturoVidal, diusir keluar lapangan oleh wasit. (m15/espn/rtr/goal)

Montpellier Paris SG Lille Etienne Lyon Marseille Renes Toulouse Bordeaux Valencs Evian SM Caen Lorient St Brest Dijon Ajaccio OGC Nice AS Nancy Auxerre Sochaux

25 16 5 4 48-25 25 15 7 3 44-25 24 12 9 3 42-26 25 12 7 6 33-26 25 12 4 9 41-32 23 10 9 4 34-22 24 11 6 7 33-29 24 10 7 7 25-23 25 9 9 7 30-28 25 8 6 11 26-27 24 6 9 9 33-37 25 7 6 12 30-37 25 6 9 10 24-32 24 4 14 6 21-22 25 7 5 13 30-44 25 6 8 11 27-43 25 5 8 12 23-29 25 5 8 12 22-35 25 4 10 11 30-38 24 4 8 12 22-38

53 52 45 43 40 39 39 37 36 30 27 27 27 26 26 26 23 23 22 20


BEK Lyon Aly Cissokho (kiri) bertarung seimbang dengan gelandang PSGJavier Pastore di Stade Gerland, Minggu (26/2) dinihari WIB.

Perasaan PSG Campur Aduk PARIS (Waspada): Penyerang Paris Saint Germain (PSG) Guillaume Hoarau mencetak gol pamungkas untuk menyamakan kedudukan menjadi 4-4 saat malawan tuan rumah Olympique Lyon pada matchday 25 Ligue 1 Prancis. Namun hasil laga dramatis di Stade Gerland, Sabtu (Minggu WIB) tersebut, tak mampu menyelamatkan tahta PSG dari kudeta Montpellier, yang pada partai lainnya menaklukkan Girondins Bordeaux 1-0. “Perasaan kami campur aduk, karena kami tidak boleh kemasukan gol sebanyak itu,” tutur Hoarau melalui saluran TV Prancis Orange Foot, Minggu (26/2).

PSG unggul lebih dulu setelah bermain 21 menit, saat Hoarau menyorongkan bola hasil tendangan bebas Jeremy Menez melewati kiper Prancis Hugo Lloris. Les Gones langsung balas menyerang. Tendangan voli Bafetimbi Gomis dari jarak dekat bersarang di gawang PSG menit 34. Lisandro Lopez menggandakan gol sekaligus membalikkan skor, setelah mengunci umpan silang Michel Bastos menit 36. Bastos kemudian menembakkan tendangan voli sejauh 20 meter ke sudut atas gawang tim tamu untuk membuat kedudukan menjadi 3-1 menit 40. Carlo Ancelotti, pelatih PSG, duduk dengan tatapan kosong sebelum Anderson Nene membalaskan satu gol melalui tendangan penalti tiga menit menjelang rehat.

Lyon bermain jinak pada awal babak kedua. Tetapi Jimmy Briand mampu menyundul masuk bola hasil tendangan bebas Bastos menit 57 untuk mengembalikan keunggulan dua gol tim tuan rumah. Les Parisiens tidak menyerah dan bek Marcos Ceara, yang baru masuk menggantikan Christophe Jallet, mengurangi selisih angka menit 73 dengan tembakan menyilang. Lloris melakukan dua penyelamatan bagus untuk mengelakkan usaha Nene dan Thiago Motta dari jarak dekat. Tapi empat menit memasuki tambahan waktu, Hoarau muncul sebagai pahlawan PSG dengan menyundul masuk bola hasil umpan silang Mathieu Bodmer. Di Stade de la Mosson, aksi Montpellier tidak spektakuler saat menjamu Bordeaux. Namun sundulan John Utaka menit 80 memanfaatkan bola hasil tendangan pojok Marco Estrada menit 79, mengangkat tim itu ke puncak klasemen Ligue 1 dengan keunggulan satu poin di atas PSG. (m15/ant/rtr/uefa)




THEO WALCOTT (14) mencetak dua gol bagi Arsenal ke gawang Tottenham Hotspur dalam laga Derbi London Utara di Emirates Stadium, Minggu (26/2).

WASPADA Senin 27 Februari 2012


GELANDANG veteran Manchester United, Paul Scholes (22), mencetak gol ke Norwich City dalam lanjutan Liga Premier di Carrow Road Stadium, Minggu (26/2).

London Utara Milik Gunners LONDON (Waspada): Arsenal menunjukkan sikap pantang menyerah saat menjamu Tottenham Hotspur dalam derbi London Utara pada lanjutan Liga Premier di Emirates Stadium, Minggu (26/2). Tertinggal dua gol, The Gunners langsung membalas dengan lima gol. Partai tersebut berjalan panas dan seru sekaligus menunjukkan mental juara yang dimiliki tuan rumah. Sempat terhenyak lewat dua gol Louis Saha dan Emmanuel Adebayor di 34 menit pertama, Arsenal mampu bangkit dan mencetak gol dalam rentan waktu 28 menit. Bacary Sagna membuka

asa Arsenal di menit 40, sebelum Robin van Persie menyamakan kedudukan tiga menit kemudian. Tomas Rosicky dan dua gol dari Theo Walcott memastikan tiga poin akhirnya jatuh ke tangan skuad ArseneWenger. Dengan hasil ini, Arsenal membuka peluang menembus empat besar klasemen karena

memiliki poin sama dengan peringkat empat yang sementara diduduki Chelsea, yakni 46 poin. Spurs sendiri harus rela keunggulan poinnya atas Chelsea dan Arsenal terpangkas jadi tujuh angka dan mengganggu kesempatan merusak dominasi duo Manchester di puncak klasemen. Di laga lain, Manchester United meraih kemenangan penting saat tandang ke markas Norwich City. Gol telat Ryan Giggs di menit-menit akhir pertandingan membuat Setan Merah meraih tiga poin penuh di Carrow Road. Meski bermain di kandang lawan, MU tetap tampil menye-

Hatrik Denis Benamkan Roma ATALANTA, Italia (Waspada): AS Roma menelan kekalahan 1-4 saat bertandang ke Atlanta dalam lanjutan Serie A, Minggu (26/2). Kemenangan Atlanta tidak terlepas dari penampilan gemilang German Denis (foto) yang mencetak hatrik. Guido Marilungo membuka keunggulan Atalanta lewat gol pada menit 10. Hanya berselang 10 menit, gawang Roma kembali kemasukan. Kali ini, giliran Denis yang memaksa Maarten Stekelenburg memungut bola. Meski tertinggal 0-2, Roma tak menyerah. Gabriel Heinze cs terus berusaha mencari peluang hingga berhasil memperkecil ketinggalan berkat gol Fabio Borini. AP Selepas jeda, Roma kembali dibungkam Atalanta. Laga baru berjalan dua menit, Denis membobol gawang Roma. Usaha Roma terhindar dari kekalahan pun kian sulit, setelah Pablo Hasil Minggu (26/2) Osvaldo diusir wasit pada menit 54. Atalanta pun memanfaatkan keunggulan jumlah pemain. Atalanta vs AS Roma 4-1 Menit 66, Denis akhirnya menggenapkan hatrik sekaligus Cagliari vs Lecce 1-2 memperbesar keunggulan Atlanta 4-1. Setelah kebobolan, Catania vs Novara 3-1 Roma kembali kehilangan pemain setelah Marco Cassetti Chievo vs Cesena 1-0 diganjar kartu merah pada menit 82. (m33/rtr) Siena vs Palermo 4-1

Gol Telat Selamatkan Garuda Muda BANDAR SERI BEGAWAN (Waspada): Meski tampil menekan dan menguasai penyerangan, Timnas Indonesia U-21 harus menunggu sampai menit 81 untuk mengimbangi permainan Singapura. Andik Vermansyah cs hampir kalah di laga kedua melawan Singapura dalam lanjutan Hassanal Bolkiah Trophy, Minggu (26/2). Tertinggal di paruh pertama, gol Nurmufid Fastabiqul Khoirot menghindarkan skuad Garuda Muda dari kekalahan. Berkat gol bek muda Persebaya ini, Indonesia bermain imbang 1-1. Singapura membuka ke-

unggulan melalui Muhammad Fariz Ramli di menit 11. Memanfaatkan kesalahan kiper Muhammad Ridwan mengantisipasi tendangan bebas, Fariz Ramli melepaskan tendangan keras dari luar kotak terlarang. Memasuki babak kedua, Indonesia mendominasi jalannya pertandingan. Namun anakanak asuh Widodo Cahyono Putro sering salah umpan. Aliran bola dari lini tengah dan depan juga sering terputus, sehingga peluang gagal dimaksimalkan. Tersisa sembilan menit, Indonesia akhirnya menyamakan kedudukan lewat Fasta, sapaan

Evans Raja Slam Dunk ORLANDO, AS (Waspada): Jeremy Evans sukses menjadi jawara kontes Slam Dunk dalam event NBA All Star 2012 di Orlando, Minggu (26/2). Evans, tergabung dalam Utah Jazz, sejatinya tidak tampil dalam kontes tersebut. Pebasket yang berjuluk ‘Human Pogo Stick’ tersebut masuk menggantikan pebasket NewYork Knicks, Iman Shumpert. Di babak pertama, Evans melakukan dunk dengan kamera di kepalanya, kemudian melewati rekan setimnya yang AP duduk di kursi sambil memegang dua bola di babak kedua. Di babak terakhir, Evans melompati komedian Kevin Hart yang berkaus tim layaknya seorang tukang pos. “Saya hanya berterimakasih pada fans Jazz. Anda ingin melakukan sesuatu untuk membuat mereka terlibat di dalamnya. Jadi saya merasa itu cara yang bagus. Dan Dwight Howard, dia yang banyak membantu saya,” tutur Evans. Pemain berusia 24 tahun ini juga mengalahkan Chase Budinger (Houston Rockets), Paul George (Indiana Pacers), dan Derrick Williams (Minnesota T’wolves). Kemenangan Evans pun membuat Jazz meraih trofi kontes Slam Dunk pertama dalam sejarah keikutsertaan di NBA. Sebelumnya, Kevin Love (Minnesota T’wolves) pamer kebolehan mencetak angka dari garis three point. Love menjadi juara dengan mengalahkan Kevin Durant (Oklahoma City Thunder) 17-14 di final. Sementara itu, Tim Charles Barkley mengalahkan Tim Shaquille O’Neal 146-133 dalam Rising Star Challenge 2012. Kyrie Irving, rookie Cleveland Cavaliers, terpilih sebagai pemain terbaik dengan koleksi 34 angka. (m33/ap)

Nurmufid Fastabiqul Khoirot. Eksekusi tendangan bebas pemain muda Persebaya ini menerobos pagar hidup sebelum akhirnya mendarat di jala Singapura. (m33/ini)

rang. Pertandingan baru berjalan tujuh menit, Setan Merah bahkan sudah unggul 1-0. Diawali umpan silang Nani dari sayap kanan, Paul Scholes yang tidak terkawal di dalam kotak terlarang mudah menyambut bola dengan sundulan keras. MU nyaris menggandakan keunggulannya di menit 16. Umpan silang mendatar Javier Hernandez diteruskan tendangan keras Danny Welbeck. Sayang, tendangannya masih mampu ditepis John Ruddy. Menit 84, Norwich menya-

makan kedudukan. Tendangan balik badan Grant Holt menaklukkan De Gea. Saat pertandingan hampir usai, Giggs datang sebagai penyelamat. Gol tersebut dicetaknya pada menit 92 hasil menyambut umpan silang Ashley Young. Pada Sabtu (Minggu WIB), Manchester City tetap memastikan di puncak klasemen setelah menggunduli Blackburn Rovers 3-0 di Etihad Stadium. Tiga striker The City, Mario Balotelli, Sergio Aguero dan Edin Dzeko, masing-masing me-

nyumbang satu gol bagi tuan rumah. Balotelli membuka keunggulan menit 30, menuntaskan serangan balik Citizens. Aguero menambah keunggulan menit 52 memanfaatkan blunder kiper Paul Robinson. Dzeko, masuk menggantikan Balotelli di menit 79, memantapkan kemenangan dua menit setelah memasuki arena. “Kami menjalani Februari dengan bagus, tetapi kini kami mesti memastikan Maret juga berjalan baik. Sangat penting

Klasemen Liga Premier

Minggu, 26 Februari Arsenal vs Tottenham Norwich vs Man United Stoke City vs Swansea

5-2 1-2 -

Sabtu, 25 Februari Newcastle vs Wolves QPR vs Fulham WBA vs Sunderland Wigan vs Aston Villa Chelsea vs Bolton Man City vs Blackburn

2-2 0-1 4-0 0-0 3-0 3-0

bagi kami untuk tetap berada di puncak klasemen pada akhir

Man City 26 20 3 Man United 26 19 4 Tottenham 26 16 5 Arsenal 26 14 4 Chelsea 26 13 7 Newcastle 26 12 7 Liverpool 25 10 9 Norwich 26 9 8 Sunderland 26 9 6 Everton 25 9 6 Fulham 26 8 9 West Brom 26 9 5 Swansea 25 7 9 Stoke 25 8 6 Aston Villa 26 6 11 Wolves 26 5 7 QPR 26 5 6 Blackburn 26 5 6 Bolton 26 6 2 Wigan 26 4 8

3 67-19 3 63-26 5 51-30 8 53-37 6 47-31 7 38-38 6 29-23 9 38-43 11 34-30 10 26-27 9 32-36 12 33-35 9 28-32 11 24-38 9 29-34 14 30-51 15 27-45 15 37-59 18 29-54 14 23-50

63 61 53 46 46 43 39 35 33 33 33 32 30 30 29 22 21 21 20 20

Mei nanti,” tekad Roberto Mancini, manajer City. (m15/m33/ sky/espn)

Tiga Pecatur Master FIDE Bersaing Ketat Besok Pembukaan Waspada Cup MEDAN (Waspada): Tiga pecatur bergelar Master FIDE (MF) bakal bersaing ketat pada Turnamen Catur Terbuka Perorangan Waspada Cup 2012 mulai Selasa (28/2) hingga 3 Maret mendatang di Gedung PWI Sumut Parada Harahap, Jl Adinegoro Medan. Ketiga pecatur MF tersebut adalah MF Hamdani Rudin, MF Pitra Andika (Sumut), dan MF Maksum Firdaus (Sumsel). Berdasarkan catatan Panpel, telah terdaftar 120 pecatur yang berasal dari Riau, Kepri, Sumbar, Sumsel, Aceh, dan tuan rumah Sumut mengikutiWaspada Cup. Ketua Umum Pengprov Percasi Sumut, Parlindungan Purba SH, mengatakan pihaknya akan menurunkan seluruh pecaturnya yang akan tampil pada PON XVIII/2012. Menurutnya, turnamen itu merupakan ajang pemanasan bagi pecatur yang lolos PON XVIII di Riau, September mendatang. Sebab, inilah kesempatan pecatur menguji kemampuan sebelum berlaga di arena

PON. Pecatur Sumut yang tampil adalah MF Hamdani Rudin, MF Pitra Andika, MN Binsar Marbun, MN Sukarnaedy, dan Marihot Simanjuntak. Pecatur putri diwakili MNW Tuty Rahayu Sinuhaji, MNW Tri Handayani, Charlely Tessy,YolaYolanda, dan Maria Herlina Siahaan didampingi pelatih MN Ir Saharuddin Noor. Parlindungan juga berharap pecatur Sumut merebut gelar juara beregu yang tahun lalu diraih Percasi Riau. Tahun ini, Waspada Cup menggelar kelompok senior putra (terbuka), kelompok senior putri/junior putra dan putri serta kelompok khusus wartawan sebagai ajang seleksi untuk Porwanas 2013. Ketua Pertandingan, Suhadi, menambahkan pendaftaran ditutup 25 Februari lalu dan pendaftaran ulang digelar pada Selasa (28/2) besok pukul 08.00 sampai 12.00 WIB dilanjutkan pertemuan teknik. Setelah itu, seremonial pembukaan dan dilanjutkan babak pertama yang

Waspada/Setia Budi Siregar

PECATUR Sumut MF Hamdani Rudin cs foto bersama Ketua Umum Pengprov Percasi Sumut Parlindungan Purba SH didampingi Sekum Pery Iskandar, Ketua Panpel Waspada Cup Sonny Firdaus SH, Sekretaris Pengkot Percasi Medan Syharuddin Noor, dan Ketua Pertandingan WMN Suhadi, Minggu (26/2). dijadwalkan pukul 15.00 WIB. Untuk biaya pendaftaran, kelompok senior putra (terbuka) non gelar Rp50 ribu, kelompok senior putri/junior putra dan putri non gelar Rp25 ribu, dan peserta bergelar master tidak dikenakan biaya. Pembukaan turnamen pada Selasa (28/2) besok direncana-

kan akan dihadiri Ketua Umum PB Percasi Hashim Djojohadikusumo yang juga akan melantik pengurus Percasi Kota Medan. Dalam hal ini, Parlindungan berpesan kepada Ketua Percasi Kota Medan Sonny Firdaus SH agar memperbanyak frekuensi pertandingan dan sosialisasi catur ke sekolah.

“Percasi Sumut telah melakukan sosialisasi catur masuk Lembaga Pemasyarakatan (LP). Sudah seharusnya Percasi Medan bergerak aktif dengan melakukan kegiatan, seperti menggelar kejuaraan pelajar dan antarklub/instansi,” ujarnya. (m18)


WASPADA Senin 27 Februari 2012


PSMS Ingin Sejarah SURABAYA (Waspada): Skuad PSMS Medan berharap ingin menjadi tim pertama yang meruntuhkan reputasi Persela Lamongan sebagai tim tidak terkalahkan di Stadion Surajaya. Demikian disampaikan caretaker PSMS, Suharto, di Surabaya, Minggu (26/2). Dalam laga lanjutan Indonesian Super League (ISL), Selasa (28/2) besok, PSMS memang tidak diperkuat dua pilarnya, Novi Handriawan dan Luis Alejandro Pena. Namun Suharto mengaku telah mempersiapkan tim secara matang dalam upaya membuat kejutan. Suharto, didampingi Roekinoi dan dr Raja, mengakui bu-

Waspada/Austin Antariksa

ALAMSYAH NASUTION (2 kiri) siap mencetak gol dari set piece bagi PSMS Medan saat dijamu Persela Lamongan di Stadion Surajaya, Selasa (28/2) besok. kan hal mudah menghadapi Persela di kandangnya. Akan tetapi, pemain bersama ofisial dan manajemensudahbertekadingin menoreh tinta emas sekaligus menggapai kemenangan tan-


KASAT Narkoba Polres Asahan, Napsanto, berhati-hati melewati tanjakan saat melintasi wilayah pedalaman di Kecamatan BP Mandoge baru-baru ini.

Otomotif Media Polres Asahan Dekati Masyarakat KISARAN ( Waspada): Olahraga otomotif merupakan salah satu media Polres Asahan dalam pendekatan dan berinteraksi dengan masyarakat, sehingga program membangun kamtibmas dan melayani dapat berjalan dengan baik. Kasat Narkoba Polres Asahan, Napsanto, Minggu (26/2) menuturkan, olahraga otomotif sangat digemari masyarakat terutama kalangan pemuda. Sehingga Polres Asahan bersama Klub Mostrac (Monster Trail Comunity) melakukan ekspedisi mengelilingi Asahan tergolong ekstrim. “Dengan cara itu, kita lakukan pendekatan dengan masyarakat sehingga tugas dalam melayani berjalan dan masyarakat terlindungi serta dapat beraktivitas dan terhindar dari tindakan kriminal,” ujar Napsanto, dikenal dengan julukan Kenjiro Naruto. Bila hubungan antara Polri

dan masyarakat terjalin baik, tindak kejahatan seperti balap liar yang cenderung dilakukan kalangan pemuda dapat ditertibkan dan disalurkan pada tempatnya. “Yang paling utama adalah pendidikan moral. Dengan kegiatan terabas menggunakan trail dan mengunjungi wilayah pelosok Asahan, kita menyampaikan misi itu,” ujar Napsanto. Ketua KNPI Asahan, Rahmat Hidayat Siregar, mengatakan pihaknya sangat mendukung kegiatan Polres Asahan mengunjungi dan memantau kamtimbas, sehingga dirinya ikut ambil bagian bergabung dalam ekspedisi itu. Berdasarkan data perjalanan Klup Monstrac Polres Asahan, hampir 60 persen wilayah pedalaman Asahan telah dikunjungi, sehingga kehidupan masyarakat pedalaman dapat terpantau dengan baik. (a15)

dang pertama musim ini. Menempatkan Ledy Utomo sebagai libero mendampingi Sasa Zecevic dan Alamsyah Nasution menghuni lini gelandang bersama Anton Samba, Zulkarnaen, dan Inkyun Oh, dinilai akan mempertebal kekuatan Ayam Kinantan. Sebagai pendampingi Osas Saha di lini serang, Suharto kemungkinan akan memasang Yoseph Nico Ostanika lebih awal dengan Choi Dong Soo menanti giliran di bench. Adapun keinginan membuat sejarah di kandang Persela tercetus sejak dari Medan setelah PSMS sukses

menahan Sriwijaya FC. “Kemenangan dari Persela ini sangat penting buat Ayam Kinantan untuk memperbaiki posisinya dalam upaya merebut posisi 10 besar di putaran pertama,” kata Suharto. Kepada Waspada, Ledy Utomo dan Alamsyah Nasution pun berjanji akan tampil maksimal bila mendapat kepercayaan dari pelatih menghadapi Persela. Ledy Utomo, mantan pemain nasional U-21, dan Alamsyah sama-sama menegaskan siap membela PSMS dan menjalankan peran Novi Handriawan dan Luis Pena.

“Ini adalah kesempatan kedua saya membela PSMS setelah sebelumnya di Sigli musim ini. Tentu akan saya pergunakan untuk memperlihatkan kemampuan terbaik, apalagi pernah bermain di tim nasional U-21,” aku Ledy. Sementara itu, Alamsyah berjanji mencetak gol dari bola mati seperti saat menjebol gawang Persiba Balikpapan di Stadion Teladan beberapa waktu lalu. Di lain pihak, Nico Malau pun tak mau ketinggalan. Nico juga bertekad membuat gol ke gawang Persela saat diberi kesempatan menjadi ujung tombak nantinya. Persela sendiri baru saja dilanda kebahagiaan atas diperolehnya izin dari Badan Liga Indonesia (BLI) menggunakan Stadion Surajaya. Sebelumnya, Laskar Joko Tingkir terpaksa mengungsi ke Madiun akibat kondisi lapangan Surajaya rusak berat. Terkait ambisi PSMS, Muji Santoso mengaku pasukan Ayam Kinantan juga bukan tim yang mudah untuk dikalahkan sekalipun Persela bermain di kandang sendiri. Pasalnya, Sekretaris Tim Persela itu menambahkan kubu tuan rumah tetap khawatir kondisi lapangan akan memengaruhi permainan bilamana hujan turun. (m17)

Prestasi Internasional Tembak Sumut MEDAN (Waspada): Prestasi apik ditoreh dua atlet tembak reaksi Sumut di pentas internasional bertajuk West Java Championship 2012 di Lapangan Tembak AU Sulaiman, Jawa Barat, Minggu (26/2). Kedua atlet, Musa Idhishah dan Madi Melian, merebut peringkat tiga. Musa Idhisah, akrab disapa Doddy dan juga Ketua Harian Pengprov Perbakin Sumut, berhasil naik podium juara di kelompok Great U Open. Medi Melian meraih juara ketiga di kelompok Great Senior Standar. West Java Championship diikuti puluhan penembak reaksi dari seluruh Indonesia. Selain itu, beberapa atlet luar negeri juga ikut serta, seperti Singapura, Thailand, dan Malaysia. Doddy mengatakan hasil yang diraih membuktikan bahwa penembak reaksi Sumut memang mampu bersaing di pentas internasional. “Meski tergolong baru di Sumut, hasil ini menunjukkan atlet tembak reaksi Sumut mampu bersaing dengan atlet daerah dan negara lain,” ujar Doddy via ponsel kepada Waspada, Minggu (26/2). Lebih lanjut, Ketua Pengprov Perbakin Sumut ini mengatakan kesuksesan tentunya dapat diraih asalkan atlet tetap serius berlatih. “Saya yakin atlet tembak reaksi Sumut akan mampu mendulang prestasi dan hal itu sudah dibuktikan. Kuncinya, harus rajin berlatih dengan serius dan tidak cepat puas. Ke depan, saya optimis nomor tembak reaksi akan semakin berkembang

nang tampil beda. Maka, Scoopers dibentuk dengan berbagai keunikan di antaranya menjadikan baju ‘kodok’ sebagai pakaian seragam yang wajib dipakai saat berkumpul,” ungkap Sofyan. “Dengan berkumpul di minggu pagi, kami juga dapat melakukan aktivitas olahraga bersama. Tentunya hal ini akan memberikan dampak positif bagi anggota komunitas,” ujarnya lagi. Gunarko Hartoyo, Marketing Research Development & Corporate Communication Manager CV Indako Trading Co selaku main dealer Honda di Sumatera Utara mengungkapkan, karakter membentuk kelompok sosial merupakan salah satu karakter konsumen di Indonesia. “Sebagai makhluk sosial, kebutuhan berkumpul dan berinteraksi dengan orang lain menjadi karakter yang tidak terpisahkan dari dari bangsa kita. Komunitas kendaraan roda dua atau klub motor menjadi

Problem Catur

Putra Sutomo, Putri Wahidin Terbaik MEDAN (Waspada): Putra SMA Sutomo 1 Medan mengukuhkan diri sebagai tim terbaik di ajang Honda Development Basketball League 2012 North Sumatera Series di GOR Samudera, Jl Pancing Medan, Sabtu (25/2) malam. Tim asuhan Suwandi itu memastikan gelar juara dengan menaklukkan rival abadinya, SMA Methodist 2 Medan, 84-54. Itu merupakan gelar juara pertama Sutomo 1 Medan di ajang Honda DBL yang sudah memasuki tahun ketiga. Sebaliknya, kekalahan tersebut mengingatkan Methodist 2 Medan akan kegagalan final tahun lalu saat ditumbangkan Wahidin. Turun dengan kekuatan penuh, Sutomo 1 tampil percaya diri. Meski sempat memimpin lewat dua free throw Dani An-

di daerah ini,” tandas Doddy lagi. Madi Melian yang bertanding di kelompok Great Senior Standart mengungkapkan rasa puasnya dengan hasil yang diraih. Terlebih lagi, ini merupakan event pertamanya di tingkat nasional maupun internasional. (m47)

KISARAN (Waspada): PB SATU Asahan berhasil mengungguli PB Angsapura Medan dalam laga persahabatan di Hall Bulutangkis “Batik”, Jl Imam Bonjol Kisaran, Sabtu (25/ 2). Dalam laga tersebut, PB SATU Asahan yang dilatih duet pelatih Jefri Abdullah Batubara dan Adi Banyak tampil mendominasi. Di kategori usia dini putra, Willy menang atas Yoga 21-6, 21-16, Hendi mengungguli Arif 21-11, 21-17, Rizky dikalahkan Uzri 10-21, 8-21, dan Diky mengalahkan Fajal 21-14, 21-15).

salah satu gambaran wujud berkembangnya kebutuhan interaksi social,” tutur Gunarko di Medan, Minggu (26/2). Klub motor terutama yang dibina distributor resmi, menurutnya, secara rutin mendapat pengetahuan tentang keselamatan berkendara. Anggota

klub motor ditanamkan rasa malu jika tidak melengkapi kendaraannya di jalan ataupun sanksi jika melanggar rambu lalu lintas. “Inilah yang menjadi satu dari sekian banyak kondisi yang membedakan klub motor dengan geng motor,” papar Gu-

narkko. Lie Ci Pin, Promotion Manager CV IndakoTrading Co, sangat menyambut baik kehadiran Medan Scoopers Community dan berharap komunitas ini dapat berkembang dengan menjunjung tinggi nilai-nilai safety riding. (adv)



Jawaban di halaman A2







1 A








ngatasi Agung 21-14, 21-10. PB SATU juga unggul di ganda remaja melalui Didi/Akbar, Roni/ Oji, dan Tedi/Roby. Pelatih PB Angsapura Medan, Armada, menyatakan hasil yang diperoleh anak didiknya akan menjadi bahan evaluasi ke depan untuk menghadapi event mendatang. PBSI Asahan yang diwakili Sekretaris Arifin Widjaja SH menyatakan puas atas penampilan anak-anak PB SATU Asahan yang juga Pusdiklat Bulutangkis-nya Kabupaten Asahan. (a31)


Hitam melangkah, memastikan menang sedikitnya empat langkah.


Untuk putri, Dina kalah dari Tiara 1-21, 3-21 dan Audi takluk di tangan Modi 23-25, 8-21. Kategori anak-anak, Willy mengungguli Reza 21-16, 2116, Teddy unggul atas Fikri 2110, 21-11, dan Dandi menaklukkan Adnan 21-15, 21-9. Di kategori remaja, Oji mengakhiri perlawanan Hefri 21-7, 21-12 dan Didi Cardi memaksa Thomas menyerah 21-14, 21-11. Dari nomor pemula, Tedi menang atas Fahmi 21-8, 2111, Akbar dipaksa kalah dari Alfen 16-21, 7-21, dan Roby me-

KLUB motor terutama yang dibina distributor resmi secara rutin mendapat pengetahuan tentang keselamatan berkendara.



drian dan lay-up Chandra, Methodist 2 justru bermain jauh dari harapan pendukungnya dan harus tertinggal jauh 23-4. Methodist 2 berusaha bangkit di kuarter kedua, namun tim besutan Jenny itu kerap kesulitan menembus area pertahanan lawan. Sebaliknya, Sutomo terus menambah perolehan angka dengan mudah hingga akhirnya menutup laga dengan kemenangan mencolok. “Dari awal kami sudah yakin mampu mengalahkan Methodist 2 di final. Motivasi anakanak meningkat setelah me-

naklukkan juara bertahan Wahidin di semifinal. Kami sangat puas dengan kemenangan ini, terlebih menjadi gelar pertama kami di ajang DBL,” ujar Manajer Sutomo 1, Suwandi. Sukses Sutomo 1 kian lengkap dengan terpilihnya Reynaldo sebagai Most Valuable Player (MVP). Di bagian putri, setelah dua tahun hanya menjadi semifinalis, SMA Wahidin akhirnya mengukuhkan diri sebagai tim terbaik usai menumbangkan SMAN 5 Medan 64-36. “Ini gelar juara yang sudah kami nanti sejak dua tahun lalu. Sebelumnya kami hanya mampu menembus semifinal. Saya pribadi sangat puas, terlebih pemain kita Meilawati terpilih sebagai MVP,” ujar pelatih SMA Wahidin, Herijanto alias Tek Peng. (m42)

PB SATU Ungguli Angsapura Waspada/ist

DODDY (kanan) diabadikan bersama Madi Melian, usai seremoni penyerahan medali di Lapangan Tembak AU Sulaiman, Jawa Barat, Minggu (26/2).

Gaya Unik Medan Scoopers Community MEDAN (Waspada): Pecinta Honda Scoopy, semakin menikmati keunikan motor yang mereka miliki. Akhir pekan lalu di pusat perbelanjaan RamayanaTeladan, sekitar 30 pemakai Honda Scoopy mendeklarasikan terbentuknya komunitas mereka yang khas. Tampil riang, sporty dan unik menjadikan komunitas yang dinamai Medan Scoopers Community itu menarik perhatian masyarakat serta dipastikan menambah semangat gaya retro Honda Scoopy. Komunitas yang dikomandoi Sofyan ini seperti menjadi jawaban bagi kebutuhan pengendara Honda Scoopy untuk bisa berkumpul menunjukkan eksistensi terhadap gaya khask mereka. Scoopers pun menjadi komunitas pertama yang tampil unik dengan menggagas ‘kopi darat’ alias berkumpul di pagi hari. “Pemakai Honda Scoopy merupakan orang-orang yang menyenangi keunikan dan se-

Waspada/Arianda Tanjung

TIM Putra SMA Sutomo 1 Medan (atas) dan tim putrid SMA Wahidin Medan (bawa) foto bersama setelah menjadi juara Honda DBL 2012 North Sumatera Series di GOR Samudera Sport Center Medan, Sabtu (25/2) malam.

1. Pintu gerbang; Palang yang dipasang di ujung gang untuk menghalangi masuknya kenderaan tertentu; Jalan masuk ke dalam tambang atau terowongan. 3. Bahasa ibu dari negara Portugal. 6. Buku berisi nilai kepandaian dan prestasi belajar murid di sekolah. 7. Gagang senapan; Tangkai bedil. 8. Bersifat atau berkaitan dengan korporasi; Berbadan hukum. 10. Nama candi di Sumatera Utara. 11. Pelabuhan (Inggris, jamak). 13. Lubang renik pada kulit atau rongga kecil-kecil pada benda padat. 15. Tulis dari belakang: Pekan Olahraga Daerah (singkatan). 17. Sumbu roda dsb; Ujung puncak (tombak, tiang, kerucut, dsb); Pemain sepakbola di posisi gelandang tengah. 19. Bandar udara (Inggris populer). 20. Pengiriman barang dagangan ke luar negeri.

21. Olahraga; Judul halaman olahraga Waspada.


1. Berserakan; Kucar-kacir; Cerai-berai tidak keruan. 2. Beri tahu; Kewajiban tamu di kantor atau kompleks tertentu. 3. Kuras dengan cara yang licik hingga habis uang atau harta milik orang lain. 4. Untuk sementara waktu. 5. Sikap bersedia mengakui keunggulan lawan atau kelemahan sendiri; Sikap adil (jujur) terhadap lawan bertanding. 9. Penyusun laporan, termasuk laporan berita; Wartawan. 12. Orang yang memberikan dukungan, sokongan, dsb. 13. Mudah dibawa-bawa; Mudah dijinjing (misal radio/tv, mesin tik, dsb). 14. Pemasukan barang dsb dari luar negeri. 16. Perintis jalan; Pionir. 18. Gulai ayam berkuah santan kental.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.


1 5 3 8 9 3 5 5 4 1 6 9 3 8 4 7 7 6 9

1 8 3 5 6 4 7 1 2 2 7 4 8 6 3 5 9 2 5 6

9 1


3 8 6 8

3 *221



Radwanska Kampiun DUBAI(Waspada):Agnieszka Radwanska (foto) menembus peringkat lima besar dunia untuk pertama kalinya setelah menga-


Pasang Iklan Telp. 4528431 HP. 081370328259 Email:

lahkan Julia Goerges 7-5, 6-4 pada final Dubai Championships, Minggu (26/2). Petenis berusia 22 tahun asal

Polandia itu akan naik ke peringkat lima dunia ketika susunan peringkat baru diumumkan Senin (27/2) ini, setelah memenangi

gelar tunggal WTA-nya yang kedelapan dalam kariernya. Tertinggal 4-5 pada set pertama, Radwanska yang memenangitujuhdaridelapangame berikutnya untuk unggul satu set dan 4-1 pada set kedua, akhirnya memastikan kemenangan atas

WASPADA, Senin 27 Februari 2012 lawanya yang berasal dari Jerman. Sebelumnya, Radwanska juga memenangi satu-satunya pertemuan mereka saat bertarung di babak 16 Besar Australia Terbuka lalu dengan skor 6-1, 6-1. “Dalam momen yang pen-

ting, saya pikir saya hanya lebih konsisten. Forehand milik Julia (Goerges) adalah senjata utamanya,” ujar Radwanska. “Andatidakpernahtahuharus mengharapkan apa dari pukulan itu, karena membuat bola melesat sangat cepat. dan terkadang

saya bahkan tidak bisa bergerak ke arah yang tepat dan bolanya sudah berada di samping saya. Saya hanya mencoba tetap tenang hingga akhir pertandingan,” tandasnya. (m33/ap)

WASPADA Senin 27 Februari 2012

Medan Metropolitan


Masjid Raya Al Mashun Tetap Terawat MEDAN (Waspada): Meski sudah berusia 106 tahun, namun keaslian bangunan dan ornamen Masjid Raya Al Mashun Medan masih terawat dengan baik. Sehingga umat Islam tidak merasa terganggu saat beribadah di masjid yang menjadi simbol sejarah Islam di Medan. Pengamatan Waspada, Jumat (24/2), kondisi halaman dan kamar mandi masjid cukup bersih. Tidak ada kendaraan umum ataupun pedagang yang boleh memasuki halaman masjid. Hanya beberapa sepedamotor milik para pengurus masjid yang terparkir di dekat pagar bagian dalam halaman. Kondisi bangunan masjid juga cukup terawat. Meski ada beberapa bagian yang terlihat rusak dan lapuk di makan usia, seperti beberapa ornamen jendela, besi, dan pintu kayu, namun tetap dirawat sehingga tidak memunculkan kesan kumuh bagi umat Islam yang beribadah. Penasehat Badan Kemakmuran (BKM) Masjid Raya Al Mashun Medan H Makmur Saleh Pasaribu beserta Nazir Masjid Raja Muda Deli, Tengku Hamdy Osman Delikhan Al-Haj mengakui memang ada beberapa bagian bangunan masjid yang sudah rusak namun belum bisa diganti. Namun kondisi itu terjadi karena BKM ingin memperta-

hankan keaslian bangunan yang menjadi cagar budaya Medan. Serta karena ornamen kuno tersebut berasal dari Eropa, sehingga sulit dicari penggantinya. “Jadi ornamen dan jenis besinya itu tidak ada dijual di sini. Karena dulunya itu memang dibawa dari Eropa. Ada juga kayu di bagian dalam menara yang sudah mulai lapuk. Kayu itu berasal dari Sulawesi. Jadi sebenarnya, kita sudah berusaha mencari, tapi barangnya memang susah didapat,” sebutnya. Begitupun, katanya, pihak Pemko Medan sudah berjanji kepada Badan Kemakmuran Masjid akan segera membantu perbaikan ornamen dan bangunan yang rusak itu. “Tidak perlu harus sama betul, asal jenisnya sama kami bersedia untuk segera diganti,” katanya. Makmur menjelaskan, selain bantuan dari Pemko Medan, banyaknya juga umat Islam yang memberikan bantuan untuk perbaikan masjid. Dicontohkannya, tentang bantuan untuk penggantian karpet baru tahun lalu, yang ditangani langsung si pemberi sumbangan. Begitupun soal kebersihan halaman, kamar mandi dan bagian dalam masjid. Menurut Makmur, BKM sudah menunjuk beberapa orang yang bertanggung jawab membersihkannya setiap hari. Seperti menyapu dan mengepel halaman luar dan kamar mandi, serta menyedot debu karpet bagian dalam setiap hari. Selain itu membersihkan rumputdanpekarangankuburan di belakang masjid. Khusus Kamis dan Jumat,

petugas kebersihan harus bekerja lebih ekstra, khususnya untuk menjaga kebersihan kamar mandi dan bagian dalam masjid. Karena pada hari-hari itu banyak umat Islam yang beribadah ke masjid. “Karena itu, bagi yang ambil wudhu di kubah kamar mandi saja, saya jamin akan merasa sangat nyaman,” katanya. Gaji seadanya Para petugas kebersihan, imam, muazzin dan pembaca saritilawah di Masjid Raya Al Mashun, kata Makmur, hanya digaji seadanya. Namun hal itu tidak pernah menjadi masalah, karena sudah terbangun kedekatan antara BKM dengan mereka.“Masalah gaji itu nomor dua disini. Tapi hubungan batin antara Raja Muda sebagai nazir masjid yang membuat kami betah bekerja disini,” ujarnya. Kondisi itu dibenarkan Tomo, yang sudah belasan tahun bertugas menjaga kebersihan di Masjid Raya. Menurutnya, meskipun hanya digaji Rp450 ribu sebulan, namun hal itu tidak menjadi persoalan, karena kedekatan mereka dengan pengurus BKM. Sementara itu, Sekretaris BKM H Ridwan As mengatakan, tidak ada masalah dengan kondisi kas masjid yang saat ini sekitar berjumlah Rp60 jutaan. Menurutnya, pemasukan dana infaq Jumat setiap minggunya mencapai Rp3,5 jutaan dan pengeluaran untuk imam dan khatib Rp1,1 juta. “Jadi tidak ada masalah dengan uang, karena banyak umat Islam yang menyumbang ke masjid ini,” katanya. (m48)

PSB YPSA Dibuka 1 Maret MEDAN (Waspada): Menjelang berakhirnya tahun ajaran 2011/2012,YP Shafiyyatul Amaliyyah akan melaksanakan Open Day pendaftaran siswa baru (PSB) untuk TA 2012/2013 pada 1 Maret 2012. Demikian Ketua PSB YP Shafiyyatul Amaliyyah Fauzi Azhar, SAg Sabtu (25/2). Menurut Fauzi, sebagai institusi pendidikan yang telah menyandang Rintisan Sekolah Berstandar Internasional Mandiri, YPSA akan terus memberikan kontribusi pendidikan yang terbaik bagi bangsa Indonesia, mulai dari jenjang pendidikan PG, TK, SD, SMP, SMA, Kelas Internasional hingga mencapai hasil yang optimal dalam mewujudkan visi membangun generasi emas

(We Shall Create Golden Generation). “Dalam mewujudkan citacita serta visi misi, maka proses pendidikan yang ditempuh haruslah terencana, terarah, bertahap, realistis, serius dan berkesinambungan serta didukung tim kerja yang profesional,” katanya. Di samping itu, kata Fauzi, YPSA juga menjalin kerjasama dengan berbagai instansi, salah satunya dengan PT Musim Mas melalui program beasiswa ‘Anak Mas’. Untuk informasi pendaftaran siswa baru secara online di website: Ditambahkan Kepala Pendidikan Bagoes Maulana, S.Kom, program beasiswa ‘Anak Mas’ merupakan beasiswa yang

dikhususkan bagi anak-anak yang tidak mampu. Dalam hal ini pemberian beasiswa dilakukan full sampai siswa tersebut menamatkan pendidikannya di YPSA. Adapun fasilitas yang diperoleh yakni biaya pendidikan, buku tulis, akomodasi, uang saku, baju dan lain-lain. Namun demikian, beasiswa ini dikhususkan bagi pelajar SMA se Sumatera Utara. Untuk proses seleksi, lanjut Bagoes, meliputi siswa berprestasi, seleksi berkas yakni rapor, surat miskin dan akan disupervisi langsung ke ke rumah siswa tersebut. Selanjutnya akademik, Matematika, Fisika, Biologi, B. Inggris, Agama dan praktik agama, psikologi/kesehatan dan wawasan siswa.(m43)

Citra Anugrah Teknika Serahkan CSR Dan Bibit Pohon MEDAN (Waspada): PT Citra Anugrah Teknika menyerahkan bantuan Corporate Social Responsibility (CSR) kepada anak yatim/yatim piatu kawasan Kecamatan Medan Selayang, Kota Medan serta 1.000 batang bibit pohon mahoni untuk penghijauan sekaligus syukuran. Penyerahan tersebut oleh Direktur Utama Leo Prima Putra didampingi Direktur Operasi Reza Armaya di Citra Mansion, Jln. Bunga Cempaka, Kelurahan PD Selayang II, Kecamatan Medan Selayang, Sabtu (25/2). Hadir dalam kegiatan tersebut Ketua DPD REI Sumut TommyWistan, Camat Selayang Halim Hasibuan, Sekcam, Lurah, tokoh masyarakat, puluhan anak yatim/yatim piatu serta warga. Dirut Citra Anugrah Teknika Leo Putra Prima mengemukakan, bantuan CSR kepada para anak yatim merupakan komitmen perusahaan tersebut. Demikian juga dengan penyerahan 1000 batang pohon mahoni guna penghijauan terkait konsep ‘Go Green and Green Living’ di perumahan yang dibangun.

‘’CSR itu juga diprogramkan untuk pemberian beasiswa kepada anak yatim berprestasi yang bersekolah di tingkat SD. Sementara, bibit pohon juga terkait dukungan kepada program peduli lingkungan mengantisipasi global warming,’’ kata Leo. Dia menambahkan, pengembang tidak selalu harus membangun gedung, akan tetapi juga mesti peduli lingkungan. Sedangkan Ketua DPD REI SU Tommy Wistan mengemukakan, REI sebagai wadah para pengembang tetap men-support semua anggotanya. Pada kesempatan itu, Tommy juga menyatakan, belum semua developer atau pengembang menerapkan konsep Green Living atau lingkungan hidup yang hijau. ‘’Karena itu, REI selalu mengingatkan dan mengimbau setiap pengembang agar menerapkan konsep Green Living di tiap lokasi perumahan dan property yang dibangun,’’kata Tommy. Menurut dia, konsep Green Living itu diharapkan bisa menurunkan temperatur udara se-

tidaknya 2 derajat Celcius, di samping menerapkan pengurangan penggunaan enerji, seperti listrik, AC dan air. Sementara, Camat Medan Selayang Halim Hasibuan mengatakan, saat ini pembangunan kawasan atau wilayah Medan Selayang cukup pesat. Dengan demikian, masyarakat perlu memberi dukungan. ‘’Kehadiran pengembang atau investor di wilayah Medan Selayang patut didukung, seperti menciptakan suasana dan rasa aman serta nyaman, sehingga investor tidak ‘lari’ ke kawasan lain,’’kata Halim. Acara tersebut juga ditandai dengan penanaman pohon di lokasi pertapakan yang akan dibangun perumahan. Penanaman dilakukan Dirop Citra Anugrah Teknika Reza Armaya didampingi Dirut Leo Putra Prima, TommyWistan dan lainnya. Sebelumnya, dilaksanakan doa bersama dipimpin Ustadz Amhar Nasution. Dalam tausiyah singkatnya dia mengemukakan, hendaknya setiap rumah atau pemukiman yang akan dibangun perlu dilakukan doa bersama.(m34)

Waspada/Feirizal Purba

PENYERAHAN bantuan Corporate Social Responsibility (CSR) PT Citra Anugrah Teknika kepada para anak yatim/yatim piatu.

RUANG utama Masjid Raya Al Mashun Medan terlihat sangat bersih dan terawat dengan baik.

Kaum Ibu Diimbau Manfaatkan Posyandu MEDAN (Waspada): Ketua Tim Penggerak PKK Provinsi Sumatera Utara Hj Sutias Handayani Gatot Pujo Nugroho mengajak masyarakat khususnya kaum ibu untuk memanfaatkan keberadaan Posyandu di lingkungan masing-masing, untuk memantau tumbuh kembang anak Balita. ”Pemantauan tumbuh kembang anak pada usia Balita sangat penting, karena pada usia tersebut merupakan periode emas pertumbuhan anak,” ujar Sutias di Kantor Tim Penggerak PKK Provinsi Sumatera Utara Jalan Tengku Cik Ditiro, Medan, Sabtu (25/2). Menurut Sutias, hingga kini pelayanan pemantauan tumbuh kembang anak Balita yang mudah dijangkau masyarakat adalah Posyandu. Karena itu, peningkatan kualitas pelayanan Posyandu perlu ditingkatkan, terutama melalui kegiatan revitalisasi Posyandu yang saat ini menjadi program nasional. Untuk meningkatkan kemampuan kader Posyandu

dalam memberikan pelayanan, maka Tim Penggerak PKK Provinsi Sumatera Utara pada tanggal 21-22 Februari lalu, menggelar Kelas Kader Posyandu Peduli Tumbuh Aktif Tanggap Sumut Tahun 2012, di Aula Kuba Asrama Haji Pangkalan Mansur Medan. Acara diikuti kader Posyandu yang berasal dari Kota Medan, Binjai, Tebing Tinggi, dan Kabupaten Deli Serdang, dengan jumlah utusan kader masing-masing kabupaten/ kota 17 orang. Di samping itu pelatihan juga diikuti anggota tim penggerak PKK Provsu dan utusan instansi pemerintah. Dijelaskan Sutias, pelaksanaan Kelas Kader Posyandu Peduli Tumbuh Aktif Tanggap ini merupakan program Tim Penggerak PKK Pusat, karena itu pihaknya sangat mendukung dan menyambut pelaksanannya di Sumut. “Gerakan pengembangan Posyandu Peduli Tumbuh Aktif dan Tanggap (TAT), merupakan salah satu bentuk revitalisasi

Posyandu yang menekankan pada gerakan pemberdayaan keluarga dalam memantau serta memberikan pola asuh tumbuh aktif tanggap (TAT) yang berkualitas pada anak Balita,” kata Sutias. Dia juga mengingatkan masyarakat terus menggalakkan gerakan pemanfaatan pekarangan untuk penyediaan tanaman obat keluarga ( Toga). Pemanfaatan lahan pekarangan sebagai apotik hidup, penting dalam upaya peningkatan derajat kesehatan keluarga. Sementara itu, untuk tahun 2012 ini secara nasional pelaksanaan Kelas Kader Posyandu Peduli Tumbuh Aktif Tanggap dilaksanakan di 14 provinsi dan 56 kabupaten/kota. Gerakan Posyandu peduli TAT juga dirangkaikan dengan acara lain seperti Gebyar Posyandu dan Kontes Posyandu. Kegiatan ini juga akan berlanjut pada monitoring ke Posyandu percontohan yang menjadi peserta kelas kader serta bantuan alat-alat Posyandu.(m28)

Waspada/Amir Syarifuddin

SUTIAS Handayani Gatot Pujo Nugroho memukul gong tanda dibukanya Kelas Kader Posyandu Peduli Tumbuh Aktif Tanggap (TAT) Sumut Tahun 2012.


Kejujuran Kekuatan Paling Besar MEDAN (Waspada): Kejujuran merupakan kekuatan yang paling besar. Kekuatan itu melebihi kekuatan fisik. Bahkan, kata Pangkostrad Letjen TNI AY. Nasution, penjahat sekalipun mencari teman yang jujur. Tapi saat ini, banyak orang yang ingin mendapatkan sesuatu dengan cara menipu, berbohong bahkan selalu bangga dengan ketidakjujurannya. Diharapkan, kita semua dan pemimpin di Al Washliyah harus jujur. Karena jujur adalah kekuatan yang besar. Hal itu diungkapkan Panglima Komando Strategis Angkatan Darat (Pangkostrad) Letjen TNI Azmyn Yusri Nasution saat memberikan arahan pada acara Maulid Nabi Muhammad SAW dan pelantikan bersama Muslimat Al Washliyah, Angkatan Putri Al Washliyah (APA) serta Ikatan Guru dan Dosen Al Washliyah (IGDA) Medan di Lapangan Sepakbola Widuri Marendal Medan, Sabtu (25/2) sore. Hadir pada acara itu, Ketua Pimpinan Al Washliyah Sumut H. Hasbullah Hadi, SH, MKn, Sekretaris H.Yulizar Parlagutan Lubis, Ketua PB Al Washliyah Yusuf Pardamean Nasution dan Ketua PD Al Washliyah Medan Ir Azzam Rizal. Ketua PW Al Washliyah H. Hasbullah Hadi mengatakan, Indonesia merupakan bangsa yang besar. Namun saat ini terjadi kemerosotan moral dan jatuh pada tempat yang serendahrendahnya. “Kemunafikan ada di mana-mana, kejujuran tidak ada lagi,” terangnya. Karena itu, AlWashliyah harus tampil memperbaikinya melalui pendidikan dan gerakan dakwah. “Al Washliyah senantiasa melahirkan pemimpin bangsa, umat, tokoh pendidikan. Karenanya, mari bersama-sama membangun bangsa ini. Sebab bangsa ini tidak bisa dibangun sekelompok orang,” jelasnya. Sedangkan, Ketua Muslimat Al Washliyah Kota Medan Hj. Wardaty Nasution mengajak seluruh warga Al Washliyah membangun Al Washliyah sehingga terus berjaya dan membawa umat ke masa yang akan datang. “Al Washliyah senantiasa melahirkan pemimpin yang melanjutkan perjuangan Rasulullah,” katanya. Adapun pengurus yang dilantik Ketua PW Al Washliyah Sumut H Hasbullah Hadi SH MKn yakni, Ketua Muslimat Al Washliyah Kota Medan Hj. Wardaty Nasution, Sekretaris Hj. Juma’iyah, Ketua APA Medan Masjuriatul Bahar SSos, Sekretaris Masitah SAg. Ketua IGDA Medan, H. A. Salim Daulay, MA, Sekretaris Dra Deliana Nasution serta pengurus lainnya. Acara pelantikan diakhiri dengan tausyiah peringatan Maulid Nabi Muhammad SAW oleh Al Ustadz Imdim Chow (Awi Cheng Ho) dari Jakarta. (h02)


Medan Metropolitan

WASPADA Senin 27 Februari 2012

Sejumlah Tokoh Sumut Lepas Bomer Pasaribu

Waspada/Surya Efendi

DARI KIRI KE KANAN: Anggota DPD RI asal Sumut Parlindungan Purba, Kajati Aceh Yusni SH, Bomer Pasaribu, Wali Kota Medan Rahudman Harahap dan Ketua Umum PB Wushu Supandi Kusuma. Mereka diabadikan pada acara syukuran pelantikan Bomer Pasaribu sebagai Duta Besar (Dubes) RI untuk Denmark dan Lithuania di kediaman Panusunan Pasaribu Jln. Sei Belutu Medan, Sabtu (25/2).

MEDAN (Waspada): Sejumlah tokoh Sumatera Utara melepas mantan Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Bomer Pasaribu yang saat ini mengemban tugas sebagai Duta Besar (Dubes) Indonesia untuk Kerajaan Denmark merangkap Republik Lithuania, dalam acara syukuran di Jl Sei Belutu Medan, Sabtu (25/2). Satu di antara tokoh masyarakat Sumut ini mengaku acara penglepasan dirinya tersebut merupakan reuni yang paling membahagiakan. Hadir dalam acara tersebut antaralain tokoh kerukunan umat beragama J Ferdinandus, Afifuddin Lubis, Sofyan Tan, dan anggota DPD RI Parlindungan Purba, anggota DPR RI Chairuman Harahap dan Abdul Wahab Dalimunthe serta mantan pejabat Pemprovsu di antaranya Abduh Pane, Kasim Siyo, sejumlah Bupati/Walikota di Sumut dan unsur pimpinan SKPD se-Sumut. Dalam sambutannya, Abduh Pane, salah seorang tokoh Sumut yang juga pernah menjabat sejumlah pimpinan SKPD Pemprovsu mengatakan, sosok Bomer Pasaribu sebagai tokoh dan putra terbaik Sumut, sangat pantas mewakili masyarakat Indonesia untuk bertugas di Denmark dan Lithuania. Pasalnya, Bomer yang dinilai memiliki ketokohan dan rendah hati tersebut memiliki kemampuan lebih dari cukup untuk mempromosikan Indonesia, maupun menjalin kerjasama antar negara Indonesia dengan negara-negara di Uni Eropa, khususnya Denmark. “Dan satu hal lagi dengan merangkap Dubes untuk Lithuania saya rasa ini kepercayaan yang cukup beralasan, meski pun saya menilai tugas tersebut sangat berat, karena Lithuania relatif asing bagi masyarakat Indonesia,” katanya. Sementara itu, tokoh kerukunan umat beragama J Ferdinandus mengatakan, penunjukkan Bomer yang sudah mulai bertugas selama dua minggu tersebut merupakan pengakuan terhadap

Isu Uang Dalam Pemilihan Anggota KPID Sumut Alamsyah: Anggota Dewan Mau Terima, Silahkan MEDAN (Waspada): Isu pemberian uang mulai santer terdengar dalam proses pemilihan anggota Komisi Penyiaran Indonesia Daerah (KPID) Sumut. Dua orang anggota Komisi A DPRD Sumut juga mengaku mendengar isu-isu itu. Jumat (24/2), Waspada mencoba menelusuri isu pemberian uang dalam pemilihan anggota KPID Sumut oleh Komisi A DPRD Sumut. Pernyataan tentang permainan uang muncul dari beberapa orang calon anggota KPID. Namun mereka tidak bersedia disebutkan namanya dalam pemberitaan ini. Dalam proses seleksi anggota KPID, Komisi A DPRD Sumut bertugas untuk memilih tujuh dari 12 nama calon yang lulus pada seleksi tahapan sebelumnya. Caranya, setiap anggota dewan menulis tujuh nama

yang mereka nilai layak. Hasil rekapitulasi 17 orang anggota Komisi A, ditetapkanlah tujuh nama untuk direkomendasikan menjadi anggota KPID Sumut. Kapan dewan melakukan pemilihan? Ketua Komisi A DPRD Sumut Isma Fadly Pulungan saat ditanya Waspada melalui telefon selular mengatakan, belum tau kapan. Dia hanya bilang, mungkin Senin atau Selasa (27 atau 28/2). “Masih menunggu kawan-kawan (personel Komisi A) ngumpul dulu,” katanya. Isu uang dalam pemilihan anggota KPID Sumut mulai muncul sejak 12 nama calon masuk ke DPRD. Saat itu calon peserta sudah melakukan lobilobi kepada setiap anggota dewan. Calon yang mengenal atau merasa kenal dengan dewan, mereka menghubungi langsung. Untuk yang tidak mengenal, biasanya lewat perantara. Seorang calon anggota KPID, kepada Waspada mengatakan isu uang semakin santer setelah Komisi A melakukan

simulasi cara pemilihan anggota KPID. Simulasi dilaksanakan Jumat (17/2) di ruang Komisi A, dan Sabtu (18/2) di Hotel Arya Duta. Beberapa orang calon anggota KPID yang pada simulasi hari pertama berada di posisi nomor bawah, diduga melakukan money politics kepada sejumlah anggota Komisi A. Karena pada simulasi hari Sabtu, nama-nama tersebut naik ke posisi atas. Pelaksanaan simulasi sendiri, sebut sumber, disinyalir sengaja dilakukan dewan untuk membuat para calon gusar. Upaya itu sepertinya berhasil, karena sekarang ini sejumlah calon mengaku resah dengan cara-cara yang dilakukan dewan. “Untuk calon yang punya uang, kondisi ini dimanfaatkan untuk ‘mendekati’dewan,”katasumber. Sangat dengar Dua orang anggota Komisi A DPRD Sumut Syamsul Hilal dan Alamsyah Hamdani, tidak membantah adanya isu uang dalam proses pemilihan calon

anggota KPID Sumut. Saat dihubungi melalui telefon seluar, Syamsul Hilal, mengatakan mendengar isu money politics, tapi belum mendapatkan buktinya. Sedangkan Alamsyah Hamdani mengaku sangat mendengar isu itu. Tentang simulasi yang di Hotel Arya Duta? Syamsul Hilal mengaku tidak mengikuti acara itu karena sedang melihat keluarganya yang sakit. Namun yang dia dengar, pertemuan itu hanya untuk menjajaki pendapat anggota Komisi A. “Tapi saya sangat menghargai sosial kontrol dari pihak manapun agar Komisi A dapat bekerja dengan sebaik-baiknya dan KPID lebih legitimate,” ujarnya. Sementara itu, Alamsyah Hamdani, mengakui Komisi A ada melakukan simulasi. Tapi itu bukan cerminan hasil yang sebenarnya. Dia saja mengaku menulis beberapa nama yang bukan menjadi pilihannya pada simulasi itu. Pertemuan Komisi A di Hotel Arya Duta, menurut Alam-

syah, adalah untuk membicarakan tentang cara dewan memilih calon anggota KPID. Karena itulah dilakukan simulasi. “Nama yang saya tulis saja asalasalan. Belum tentu nama itu yang saya tulis pada pemilihan sebenarnya,” sebutnya. Tentang isu uang yang telah santer, menurut Alamsyah, tidak dijadikannya sebagai beban. Dia mengaku akan tetap milihcalonyangdinilainyapantas. “Isu itu wajar-wajar saja. Kalau itu benar dan ada anggota dewan yang mau terima, silahkan. Tapi kalau saya tidak akan memilih berdasarkan uang,” katanya. Namun, Ketua Komisi A Isma Fadly Pulungan, melalui telepon selular, mengaku tidak pernah melakukan simulasi. Apalagi di Hotel Arya Duta. Menurutnya, dewan tidak boleh melakukan kegiatan di luar kantor. Pertemuan di Arya Duta hanya pertemuan informal yang tidak khusus membahas KPID. “Komisi A tidak pernah melakukan simulasi. Apalagi di luar kantor,” sebutnya. (m12)

kemampuan putra Sumut untuk memberikan kinerja terbaik bagi negara ini. “Saya tidak heran jika beliau bisa mendapat kepercayaan sebesar ini, karena dengan pengalaman beliau, baik ketika menjadi politisi maupun akademisi yang sangat mumpuni, tentu hal ini tidak diragukan lagi,” sebutnya. Sekretaris I Pengurus Yayasan Haji Hasan Pinayungan (YHHP) Padangsidempuan Gus Irawan Pasaribu dalam sambutannya mengatakan, sosok Bomer Pasaribu sebagai anak pertama di keluarga mereka merupakan panutan dan pengayom, setelah orang tua mereka meninggal dunia. Karena itu, sosok Bomer selaku pembina yayasan selama ini cukup memberikan mereka kenyamanan dan membuat mereka yang tujuh bersaudara semakin akrab dan terus berdekatan meski terpisah jarak. “Dengan tugas baru beliau ini, maka tugasnya sebagai pembina yayasan akan diteruskan Bang Panusunan Pasaribu. Yayasan yang merupakan amanah orangtua kami ini akan tetap menjadi pemersatu dan perekat hubungan kami, demikian juga silaturahmi kami dengan masyarakat seperti telah dijalin orangtua kami semasa hidupnya,” kata Gus Irawan, yang juga Dirut Bank Sumut tersebut. Sementara itu, Bomer Pasaribu mengatakan, acara tersebut merupakan reuni yang paling membahagiakan bagi dirinya. Sebab, katanya, meski sudah banyak acara penglepasan untuk tugas barunya tersebut dilaksanakan, namun sangat berbeda dengan yang ada di Medan. Dia mengatakan, bisa bertemu dengan teman-teman lama dan juga para tokoh masyarakat Sumut yang cukup banyak berjasa semasa karirnya, hingga dipercaya menjadi Dubes. “Ini reuni yang paling membahagiakan bagi saya. Saya berharap melalui pertemuan ini semakin terjalin erat hubungan baik selama ini. Tentunya, semua itu untuk pelayanan kepada masyarakat dan memberikan yang terbaik bagi bangsa dan negara,” katanya.(m28)

Pemagaran Kios Eks Juwita Resahkan Pedagang MEDAN (Waspada): Pemagaran kios eks Juwita Shoping Centre di Jalan Surabaya Simpang Jalan Bandung Medan, oleh pengembang, meresahkan dan merugikan puluhan pedagang yang menempati sedikitnya 25 kios, yang tidak bisa lagi berdagang sejak Kamis (23/2). Kekecewaan para pedagang itu mereka sampaikan saat berkunjung ke kantor Harian Waspada Jln. Suprapto Medan. Mereka meminta Wali Kota Medan mengambil tindakan kepada pengembang yang tidak diketahui pedagang keberadaannya. “Kami minta Wali Kota Medan mengambil tindakan tegas kepada pengembang yang sudah memperlakukan pedagang semena-mena. Pasalnya, kami sudah menyewa kios ini sejak tahun 1976 silam, setiap bulan membayar sewa Rp300.000. Tempat inipun sudah menjadi ciri khas Kota Medan, sebagai pusat belanja berbagai asesoris. Kami ingin tempat ini dipertahankan,” kata Sucipto atau akrab disapa Akok, perwakilan pedagang. Menurut Akok, saat pihak pengembang mendatangi penyewa kios di tempat itu dua bulan yang lalu, menjanjikan kepada penyewa kios untuk memilih. Jika ingin tetap menyewa, maka kiosnya akan diperbaiki. Jika tidak mau meneruskan menggunakan kiosnya, akan diganti rugi setiap meternya Rp12 juta. “Belum ada keterangan dari pengembang, tentang hasil perjanjian sebelumnya. Tapi sekarang kami tidak bisa lagi berjualan karena sudah ada pagar di muka kios. Ada 25 kios yang merasa dirugikan oleh pengembang yang berbuat semena-mena kepada kami. Kami mohon perlindungan dan kejelasan terutama dari Wali Kota Medan.Karena pengembang tidak bisa kami temui, kawasan

kios sudah dipagar sejak Rabu malam pukul 00.00 Wib,” sebut Akok. Pada kesempatan yang berbeda, Iyan, pedagang jam di gedung eks Juwita itu menambahkan, pemagaran seng di keliling toko mereka, tidak jelas siapa yang menyuruh apalagi memberitahukan kepada mereka. “Pemagaran seng ini liar dan membuat 25 sampai 30 pedagang yang menempati puluhan kios disini rugi,” ujarnya. Menurut Iyan, dirinya yang sejak 1986 berdagang di lokasi itu telah memenuhi kewajiban sama seperti pedagang lainnya yakni rutin setiap bulan membayar listrik, air, pajak, dan sebagainya. “Dulu gedung ini milik Fosan sebagai manejer PT Juwita. Setelah Fosan meninggal, istrinya pindah ke Jakarta. Cuma itu yang kami ketahui,” sebutnya. Hal senada juga dikatakan Aket. Menurut dia yang telah berjualan selama 56 tahun, pemagaran itu dilakukan sepihak dan jelas membuat mereka resah. “Ini kesannya seperti penggusuran paksa. Padahal kami telah memenuhi hak dan kewajiban atas hak pakai kios-kios disini,” katanya. Pantauan Waspada, sejumlah pemuda berpakaian preman dan seragam salah satu OKP berjaga-jaga di toko-toko tersebut. “Sebelum kompleks ruko ini dipagar, oknum anggota OKP itu tidak ada. Dikhawatirkan dapat memicu bentrok jika polisi dan pemerintah setempat tidak cepat menengahi persoalan ini dengan adil. Ini lagu lama, jika membayar preman untuk mengusir pedagang, uang yang keluar relatif kecil daripada membayar ganti rugi kepada puluhan pedagang yang menempati puluhan kios disana,” sebut pedagang. Sebagaimana diketahui, gedung tersebut dulunya digunakan sebagai bioskop Juwita di lantai atas dan supermarket berada di lantai dasar. Sewaktu bioskop Juwita tutup, para pedagang yang sudah puluhan tahun berdagang di lokasi itu masih bertahan. Para pedagang tersebut menempati kioskios dengan berjualan jam, sepatu, pakaian, dan sebagainya. (m37/m46)

Perusakan RS Tembakau Deli Kebangkrutan Budaya MEDAN (Waspada): Perusakan Rumah Sakit Tembakau Deli PTPN II di Jalan Putri Hijau, merupakan kebangkrutan kebudayaan Medan. Karena itu perlu dibangun gerakan masyarakat untuk menyelamatkan bangunan bersejarah itu dari penghancuran setelah dijual ke investor swasta. Wacana itu disampaikan dalam diskusi ‘Mengapa Perusakan Rumah Sakit Tembakau Deli Harus Dilakukan’ yang digagas Gerakan Penyelamatan RS Tembakau Deli, di Penang Corner Jalan Dr Mansur Medan, Kamis (23/2) sore. Turut hadir dalam diskusi itu, sejarawan Belanda Dirk A. Buiskool, sejarawan Unimed Ichwan Azhari, pakar hukum USU OK Saidin, Ketua Majelis Hukum dan Ham Muhammadiyah Abdul Hakim Siagian, pimpinan Gerakan Penyelematan RS Tembakau Deli Edi Ikhsan, Anggota Dewan Kota Medan Datuk Adil Freddy Ha-

berham, serta sejumlah aktivis dan pemerhati sejarah Medan lainnya. Ichwan Azhari mengatakan, bahwa sedang terjadi kebangkrutan kebudayaan di Medan, dengan banyaknya penjualan bangunan bersejarah, seperti yang terjadi pada RS Tembakau Deli saat ini. Anehnya, tidak ada perlawanan dari pemerintah untuk menyelamatkan bangunan-bangunan itu. “Padahal sudah ada perda Pemko Medan untuk melindungi bangunan bersejarah,” sebutnya. Masyarakat Medan sendiri, kata Ichwan, terkesan tidak perduli dengan keberadaan bangunan bersejarah itu. Karena itu, menurutnya, perlu dibangun gerakan membangkitkan kesadaran masyarakat tentang pentingnya diselamatkan bangunan RS Tembakau Deli. “Kalau perlu kita bangun seperti gerakan pengumpulan koin atau gerakan masyarakat lainnya. Karena saya pesismis

dengan upaya hukum. Sudah banyak pengalaman kalau jalur hukum tidak efektif dalam melindungi bangunan bersejarah, seperti kasus penjualan Balai Kota,” katanya. Wacana gerakan rakyat tersebut disambut baik Abdul Hakim Siagian dengan mengajak masyarakat Medan untuk datang ‘berziarah’ ke RS Tembakau Deli. “Siapa tahu besok rumah sakit itu ternyata sudah dirubuhkan. Jadi mari kita samasama melihat ke sana,” katanya. Begitupun, Abdul Hakim memandang perlu untuk melakukan upaya hukum dengan melaporkan secara pidana pelaku perusakan bangunan RS tersebut. Selain itu meminta Komisi Pemberantas Korupsi untuk menindaklanjuti penjualan aset tersebut, karena harga bangunan yang sudah berusia ratusan tahun itu sangat tinggi. Dia juga meminta agar segala upaya penghancuran RS di stanvaskan.

Pakar hukum USU, OK Saidin juga menilai perlu untuk melaporkan penjualan RS dengan alasan divestasi menutupi kerugian perusahaan oleh PTPN II ke KPK. Karena, sebagai mantan konsultan PTPN II, dia mengaku tahu betul perilaku korupsi para direksi perusahaan BUMN itu. “D i v e s t a s i i t u h a n y a merupakan modus direksi untuk menjual aset tersebut ke swasta. Mereka kan memang korupsi, makanya perusahaan merugi sementara direksi kaya raya,” ujarnya. Sebelumnya, sejarawan Belanda Dirk A. Briskool menceritakan, RS Deli adalah situs yang sangat penting dalam sejarah perkembangan Kota Medan. Karena bangunan yang didirikan pada 1870 itu merupakan salah satu bangunan pertama yang didirikan Deli Maatschapij, perusahaan perkebunan tembakau milik Belanda di Medan. Seperti diketahui, Medan baru

berkembang pesat setelah perusahaan perkebunan masuk ke daerah ini. “RS Tembakau Deli itu simbol sejarah perkebunan di Medan. RS itu dibangun sebagai tempat pemeriksaan kesehatan para kuli Cina yang didatangkan sebagai pekerja di perkebunan,” kata Dirk yang sudah fasih berbahasa Indonesia. Dia juga mengaku heran mengapa pemerintah tidak berusaha untuk mempertahankan bangunan yang memiliki nilai sejarah sangat tinggi. Dia membandingkan dengan kota London, Roma dan Amsterdam yang pasti mempertahankan bangunan-bangunan bersejarah di sana. Bangunan bersejarah dinilainya juga memiliki potensi wisata, karena banyak turis yang datang untuk melihat kenangan kota kuno. “Kalau di Inggris atau Prancis, pemerintahnya pasti mempertahankan bangunan bersejarah,” sebutnya.(m48)

Waspada/Surya Efendi

KIOS-kios di bawah gedung eks Juwita Shoping Centre Jln. Surabaya simpang Jln. Bandung Medan, ditutup pagar seng tanpa pemberitahuan sehingga menuai protes puluhan pedagang.

Medan Metropolitan Polisi Amankan 112 Sepedamotor



Senin 27 Februari 2012

MEDAN (Waspada): Mengantisipasi geng kereta, Polsek Medan Baru, Polsek Sunggal, dan Polsek Medan Helvetia menggelar razia secara serentak di lokasi berberda mengamankan 112 sepedamotor, Minggu (26/2) dinihari. Seorang pria mabuk mengendarai sepedamotor ditangkap karena melawan petugas ketika dirazia.

Mantan Kekasih Curi Dispenser Diadukan ke Polisi MEDAN (Waspada): Herna, 27, warga Jalan Tirtosari, Kel. Bantan, Kec. Medan Tembung, mengadukan mantan kekasihnya RP, 30, warga Medan Tembung, ke Polsek Percut Seitua, Sabtu (25/2) karena mencuri dispenser miliknya. Informasi yang diperoleh di kepolisian, pencurian itu berawal saat RP dan temannya datang ke rumah korban Herna, Jumat malam. Dia bertanya kepada korban kenapa menikah sama orang lain. “Pacaran sama aku kenapa kau pulang-pulang sudah kawin sama orang lain,” sebut RP. Selanjutnya RP meminta korban agar segera mengembalikan uang yang selama ini mereka gunakan saat berpacaran beberapa tahun. Karena korban tidak punya uang, RP mengambil dispenser bermerk miyako milik korban secara paksa. Herna kemudian melaporkan kasus pengambilan barang secara paksa itu ke Polsek Percut Seituan. Mendapatkan laporan dari korban, petugas Polsekta Percut Seituan melakukan penyelidikan dan mengejar RP. Kapolsekta Percut Sei Tuan Kompol Maringan Simanjuntak melalui Kanit Reskrim AKP Faidir Chan SH membenarkan kejadian tersebut. “Pelakunya masih dalam penyelidikan,” sebut Faidir. (h04)

Pantauan Waspada di lapangan, razia yang digelar Polsek Medan Baru pukul 01:00 sampai 02:30 dinihari di Jln. Letjen Jamin Ginting depan kompleks perumahan Citra Garden dipimpin Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, M. Hum dengan menurunkan 40 personel. Dalam razia itu, diamankan 71 sepedamotor karena pengendaranya tidak bisa memperlihatkan SIM, STNK, tidak memakai helm, knalpot blong, serta satu di antara pengendara mabuk. Kapolsek Medan Baru Kompol Dony Alexander mengatakan, razia tersebut untuk mengantisipasi geng kereta yang telah meresahkan masyarakat. Selain itu juga, menekan aksi kejahatan jalanan, pencurian sepedamotor, narkoba, senjata tajam, senjata api, buronan yang terlibat kriminal. Menurut Dony, pihaknya

menahan sepedamotor yang pengendaranya tidak bisa memperlihatkan SIM dan STNK. “Sepedamotor itu bisa dikembalikan kepada pemiliknya asal bisa memperlihatkan SIM, STNK, dan BPKB kendaraan tersebut,” ujarnya. Sementara itu, Polsek Sunggal yang melakukan razia di Jln. Medan-Binjai mengamankan 21 sepedamotor yang pengendaranya tidak bisa memperlihatkan SIM dan STNK, serta knalpot blong. Kapolsek Sunggal Kompol M Budi Hendrawan SH, SIK yang memimpin razia dibantu Kanit Reskrim AKPVictor Ziliwu SH, SIK, dengan menurunkan 35 personel dibantu personel dari Polresta Medan mengatakan, sepedamotor yang terjaring razia diboyong ke Mapolsek Sunggal. “Sepedamotor bisa dikembalikan kepada pemiliknya apabila bisa memperlihatkan

SIM, STNK dan BPKB. Bagi kendaraan ber-knalpot blong harus diganti dengan yang semula,” sebutnya. Kata dia, razia itu dilakukan secara rutin mengantisipasi geng kereta. Bagi sepedamotor yang belum diambil oleh pemiliknya selama sepekan, pihaknya akan melakukan penyelidikan. “Polsek Sunggal secara rutin melakukan patroli agar suasana Kamtibmas di wilayah hukum Polsek Sunggal, tetap aman,” tutur Victor. Sedangkan Polsek Medan Helvetia yang menggelar razia di Jln. Tengku Amir Hamzah/ Griya Riatur Medan, mengamankan 20 sepedamotor yang pengendaranya tidak memperlihatkan SIM dan STNK, serta knalpot blong. “Para pengendara yang kendaraannya diamankan tidak ada yang mengaku terlibat geng kereta,” kata Kompol Sutrisno Hady Sansoto SH, SIK. (m36)

Dengan Niat Baik, Kegiatan PJB Mendapat Berkah MEDAN (Waspada): Sesuatu yang dilakukan dengan niat baik pasti akan diridhoi Allah SWT dan membawa berkah. Karena itu, kegiatan yang dilakukan Paguyuban Jawa Bersatu (PJB) dengan niat baik pasti mendapat berkah. Hal ini dikatakan Ketua Dewan Penasehat DPW PJB Sumatera Utara H Syah Afandin, SH ketika tampil sebagai pembicara pada Rapat Kerja Wilayah (Rakerwil) I PJB Sumut di Hotel Griya Jln. T Amir Hamzah, Medan, Minggu (26/2). Menurut H Syah Afadin, PJB harus mempunyai kegiatan yang bermanfaat untuk anggotanya dan masyarakat. “Kita harus punya geliat ekonomi dengan melakukan usaha bersama seperti koperasi,” ujarnya. Dia berharap pembentukan koperasi atau usaha lainnya menjadi salah satu rekomendasi Rakerda yang harus direalisasikan. Selain Syah Afandin, tampil juga sebagai nara sumber pada Rakerwil tersebut, Dirut Bank Sumut Gus Irawan dan Wakil Bupati Sergai Ir Soekirman. Kecil dahulu Sementara itu, Ketua DPW PJB Sumut Drs H Adi Munasip, MM mengatakan, untuk menjadi besar kita harus memulainya dari kerja atau usaha kecil dahulu. “Semua keberhasilan harus dimulai dari yang kecil. Tapi yang pasti harus direalisasikan dahulu,” tandasnya. Mengenai Pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013, Adi Munasip mengatakan, sejauh ini PJB belum mengajukan atau menyusun kriteria-kriteria. “Kalau nantinya kita mengajukan calon, maka tidak akan jauh dari orang terdekat kita karena bisa dipercaya,” ujarnya. Mengenai H Syah Afandin yang juga Ketua DPW PAN Sumut dan Ketua DPW HNSI Sumut, Adi mengakui yang bersangkutan memang belum pernah mencalonkan diri untuk maju pada Pilgubsu mendatang. “Cuma saya tahu, banyak pihak yang minta kepadanya untuk maju,” ujarnya. Rakerda diikuti 230 peserta dari PJB se-Sumatera Utara itu juga diisi dengan pemberian kartu asuransi kecelakaan diri sekaligus merangkap kartu anggota PJB.(m08)


FOTO BERSAMA: Ketua Dewan Penasehat DPW PJB Sumatera Utara H Syah Afandin SH dan Ketua DPW PJB Sumut Drs H Adi Munasip MM berfoto bersama dengan pengurus lainnya usai Rapat Kerja Wilayah (Rakerwil) I PJB Sumut di Hotel Griya Jln. T Amir Hamzah, Medan, Minggu (26/2).

Waspada/Ismanto Ismail

KAPOLSEK Kompol Dony Alexander melihat puluhan sepedamotor yang terjaring razia yang di kumpulkan di halaman Mapolsek Medan Baru.

H. Anif Gelar Lomba Foto Berhadiah Rp50 Juta MEDAN (Waspada): Sebagai wujud kepedulian pada perkembangan keterampilan anak muda di Medan, H. Anif menggelar lomba foto berhadiah total Rp50 juta. Lomba ini bersamaan dengan momen peringatan HUT ke-73 H. Anif. Demikian disampaikan Ketua Penyelenggara Musa Rajekshah alias Ijeck di sekretariat, Jln. Sei Deli Medan, Minggu (26/2). Lomba foto tersebut bertema “Hijau Bumiku Lestari Flora Faunaku” dan akan memilih foto-foto terbaik berisi subjek seputar habitat kolam burung di lokasi perumahan Cemara Asri. Menurut Ijeck, tema ini dipilih untuk mengajak semua kalangan peduli tentang kelestarian plasma nutfah bumi yang sangat kaya terutama kekayaan spesies burung di Indonesia.

“Isu bumi hijau menjadi agenda serius untuk diwujudkan bersama dan menjaga kelestarian fauna merupakan salah satu bagian terpenting untuk itu,” kata Ijeck seraya mengajak kalangan pecinta fotografi untuk mengabadikan kekayaan fauna di Indonesia. Ijeck menambahkan, lomba ini juga mengembangkan potensi keterampilan fotografi menjadi bagian industri kreatif yang makin tumbuh positif di Medan. Sebagai salah satu kota terbesar di Indonesia, Kota Medan merupakan basis fotografi dengan jumlah pehobi yang tinggi. Lomba ini dibagi kategori umum dan pelajar/ mahasiswa dengan waktu pendaftaran 20-29 Februari 2012 di Sekretariat Perumahan Cemara Asri, Cemara Asri Boulevard 131 Medan. Untuk informasi lengkap juga bisa didapat di grup Facebook “Lomba Foto Kolam Burung Cemara Asri”. (m25)

Anuar Shah, Sosok Pemimpin PP Yang Melakukan Perubahan

Waspada/Andi Aria Tirtayasa

TERSANGKA Su (tengah) dan pisau sangkur ditahan petugas Reskrim Polsek Percut Seituan, Minggu (27/2) dinihari, usai menuduh pelajar SMP membawa narkoba.

Tuduh Pelajar SMP Bawa Narkoba, Oknum TNI Diciduk MEDAN (Waspada): Dua pria, satu di antaranya oknum TNI usai menuduh dua siswa SMP membawa narkoba dan video porno, diringkus polisi di depan pintu tol Haji Anif, Desa Sampali, Kec. Percut Seituan, Minggu (26/2) dinihari. Oknum TNI Serka BP, 40, selanjutnya diamankan oleh petugas Den Intel Kodam I/BB. Sedangkan satu lagi mengaku anggota OKP berinisial Su, 32, warga Jalan Starban Gang Mandala, Kec. Medan Polonia, bersama satu senpi mainan jenis mancis, borgol, sangkur, dan sepedamotorYamahaVega R BK 3735 XO diamankan ke Polsek Percut Seituan. Informasi yang diperoleh di kepolisian menyebutkan, awalnya malam itu, dua siswa SMP Yogi, warga Jalan Krakatau, dan Andika, warga Jalan Cemara, Medan Tembung, mengendarai sepedamotor Mio BK 4377 ABZ pergi ke kawasan pintu tol H Anif di Jalan Cemara, Desa Sampali, Kec. Percut Seituan. Kedua korban bermaksud menghabiskan malam minggu di kawasan yang ramai didatangi oleh kaum remaja itu. Saat

sedang duduk-duduk di atas sepedamotornya, datang kedua pelaku ti BP dan Su mengendarai Yamah Vega R yang nomor plat polisinya ditutup pakai lakban. Mereka langsung menuduh kedua pelajar SMP itu telah membawa sabu-sabu. Merasa tidak membawa narkoba, Yogi dan Andika membantahnya. Namun, kedua pelaku malah meminta handphone korban dengan tuduhan menyimpan film porno. Namun, saat bersamaan muncul petugas Reskrim Polsek Percut Seituan yang sedang melakukan patroli rutin di kawasan tersebut. Merasa curiga, petugas Reskrim dan Patroli Polsek Percut Seituan berhenti dan sekaligus menanyai kedua pelaku. Kepada polisi, oknum TNI itu mengaku aparat keamanan yang sedang mencari geng kereta, sedangkan Su mengaku sebagai anggota PPM. Namun, pengakuan kedua pelaku dibantah korban. “Mereka tidak ada mencari geng kereta, melainkan menuduh kami telah membawa narkoba,” sebut korban kedua petugas. Meski sempat terjadi per-

tengkaran, apalagi kedua pelaku membawa sangkur, borgol, dan senjata api mainan mirip FN, polisi segera mengamankan kedua pelaku. Karena BP mengaku anggota TNI, kemudian datang petugas Den Intel Kodam I/BB mengamankan oknum TNI tersebut. Kapolsek Percut Seituan Kompol Maringan Simanjuntak yang dikonfirmasi membenarkan peristiwa tersebut. “Oknum BP sudah diamankan oleh petugas Intel Kodam, sedangkan tersangka Su kini ditahan di Polsek Percut Seituan karena memiliki senjata tajam,” ujarnya. Berdasarkan catatan Waspada, di wilayah hukum Polsek Percut Seituan, sedikitnya sudah dua kali terjadi kasus perampasan sepedamotor yang dilakukan oknum mengaku petugas yang menuduh korban membawa narkoba dan anggota geng kereta. Dua kasus itu terjadi di Jalan Rumah Sakit Haji, Desa Medan Estate, dan satu lagi di Jalan Selam III, Kel. Bantan, Kec. Medan tembung. Setelah menuduh korbannya, para pelaku merampas sepedamotor milik korban. (h04)

Tikaman Maut Gagalkan Pernikahan RENCANA Agustino Tandiono alias A Chi, 29, untuk menikah dengan gadis idamannya pada Agustus 2012, gagal sudah dan kini tinggal kenangan. Satu tikaman di bagian kiri pinggangnya membuat sales pakan ternak ini menghembuskan nafas terakhirnya, Rabu (22/2) sekira pukul 01:00. Korban tewas ditikam oleh dua pria tak dikenal sekira 20 meter dari depan rumahnya di Jalan Bambu I Gang Sehati No 20-B, Kel. Durian, Kec. Medan Timur. Sejumlah warga yang ditemui di lokasi kejadian menyebutkan, sekira pukul 22:00, A Chi mengendarai sepedamotor Jupiter pulang ke rumahnya usai berkunjung ke rumah temannya di kawasan Jalan Adam Malik Medan. Sesampainya di Jalan Bambu I persis di depan rumah warga No 200-D, tibatiba korban dipepet oleh dua pria mengendarai sepedamotor yang diduga hendak merampok korban. Karena korban memberi perlawanan, seorang pelaku menghujamkan satu tikaman ke bagian kiri pinggang korban. Meski mendapat tikaman, korban terus berusaha menyelamatkan diri dan membelok ke gang rumahnya sementara kedua pelaku langsung melarikan diri begitu korban berteriak rampok. Sesampainya di depan rumah, korban menghubungi ibu kandungnya via telepon selulernya. Begitu pintu rumahnya dibuka, korban langsung terkapar di lantai rumahnya dengan kondisi tubuhnya bersimbah darah segar. “Begitu korban masuk ke rumah, dia langsung terjatuh. Darahnya mengalir terus sehingga lantai rumah penuh bercak darah,” tutur Toni, 26, adik ipar korban kepada Waspada yang ditemui di lokasi kejadian.. Dijelaskan Toni, sebelum meninggal, korban sempat menceritakan bahwa dirinya hendak dirampok oleh dua pria mengendarai sepedamotor. Korban sempat melawan dan meninggalkan sepedamotornya di dalam gang menuju rumahnya. “Karena tak bisa lagi membawa sepedamotornya, korban tertatihtatih pulang ke rumahnya dan darah terus berceceran hingga ke rumah,” katanya.

Selanjutnya, korban segera dilarikan ke Rumah Sakit Imelda. Tak berapa lama, korban akhirnya menghembuskan nafas terakhirnya dan langsung dibawa ke Yayasan Sosial Angsapura Medan. Akan nikah Menurut Toni, rencananya pada Agustus 2012 ini, abang iparnya itu akan melangsungkan pernikahannya. “Rencana itu akhirnya gagal. Tuhan berkehendak lain, meski kita telah berencana,” sebutnya. Menjelang rencana pernikahannya itu, korban sangat gigih mencari uang. “Korban bekerja sebagai sales pakan ternak. Dia gigih bekerja tiap hari demi mengumpulkan uang. Berapa yang didapatnya, dia tabung uang itu,” ujar Toni. Dijelaskan Toni, abang iparnya itu pernah bekerja di kapal pesiar Santa Cruise selama lima tahun. Setelah tak bekerja lagi di kapal pesiar internasional itu, A Chi bekerja sebagai sales pakan ternak di kawasan Jalan Bilal Medan. Sementara itu, Fransuharyono, adik korban nomor tiga mengatakan, abangnya A Chi merupakan anak tertua dari empat bersaudara. Menurutnya, malam sebelum kejadian, dia hanya tahu kalau korban pergi ke rumah temannya. “Tapi kita gak tahu ke rumah temannya yang mana,” katanya. Kapolsek Medan Timur Kompol Patar Silalahi didampingi Kanit Reskrim AKP Ridwan SH menyebutkan, korban meninggal dunia akibat penganiayaan dan sempat melakukan perlawanan karena di bagian tangannya ada luka goresan. “Pelaku penganiayaan tersebut masih dalam penyelidikan, sedangkan saksi yang dimintai keterangannya baru dua orang yakni Toni, adik ipar korban dan marga Sinaga, tetangga korban,” sebut Patar. Kata dia, kasus penikaman maut tersebut baru dilaporkan oleh keluarga korban ke Polsek Medan Timur, Rabu (22/2) sekira pukul 04:30 dan sekira pukul 11:00 polisi membawa jasad korban ke RS Pirngadi Medan untuk kepentingan visum dan otopsi. (h04)

MEDAN (Waspada): Selama lima tahun dipercayakan memimpin Pemuda Pancasila di Sumatera Utara, Anuar Shah yang akrab disapa Aweng telah melakukan berbagai perubahan terhadap kader Pemuda Pancasila dari tingkat Pimpinan Cabang, Pimpinan Anak Cabang hingga ke tingkat anak ranting. “Perubahan-perubahan di lingkungan Pemuda Pancasila, seluruh kader tidak diperbolehkan menyentuh narkoba. Hal ini selalu ditekankan Anuar Shah, SE baik melalui pidatonya dalam setiap pelantikan maupun melalui surat edaran ke MPC kabupaten/kota,” kata Ketua MPC PP Kota Medan Drs Boyke Turangan (foto), Minggu (26/2). Selain itu, tiap kegiatan yang dilakukan PP, tidak terlepas dari kegiatan sosial seperti memberi bantuan kepada kaum dhuafa, berupa beras, uang dan lainnya. Bantuan itu berasal dari kader Pemuda Pancasila yang menyisihkan sebagian rejekinya. Dijelaskan Boyke, sosok pemimpin Pemuda Pancasila seperti Anuar Shah, patut

dipercayakan untuk kedua kalinya memimpin PP Sumut melalui Pesta Demokrasi yang digelar di Kota Padangsidimpuan pada 28 Februari 2012. Bagi kader Pemuda Pancasila yang hendak menjadi tampuk pimpinan, harus menjalani tes urine guna menghindari adanya penyalahgunaan narkoba. Jadi Anuar Shah menegaskan, kader Pemuda Pancasila yang terlibat penggunakan narkoba dikeluarkan dari keanggotaan. Bahkan, PP bekerjasama dengan Polri serta instansi lainnya memberantas peredaran narkoba di Sumatera Utara. Meski sibuk menjalankan roda organisasi Pemuda Pancasila, namun Anuar Shah tetap menimba ilmu ke jenjang pendidikan tinggi hingga meraih gelar Sarjana Ekonomi. Kini, Aweng terus belajar sehingga ilmu yang diperolehnya bisa diberikan kepada kader-kader Pemuda Pancasila. “Saya sangat kenal dengan karakter Anuar Shah, selaku pemimpin yang arif dan bijak, tidak sombong serta selalu dekat dengan berbagai kalangan baik instasi pemerintah, tokoh masyarakat dan tokoh agama,” jelas Boyke. (m39)

Proyek Perpustakaan SD Terbengkalai BELAWAN (Waspada): Sejak mulai dibangun tahun 2010, proyek pembangunan gedung perpustakaan Sekolah Dasar Negeri (SDN) dan SD swasta di kawasan Medan Utara, tidak kunjung selesai. Akibatnya, bahan bangunan perpustakaan itu seperti tiang kayu dan dinding mulai rusak karena lapuk dan tidak diplaster. Pantauan Waspada di SDN 065000 Kelurahan Terjun dan SDN 067261 Jalan Sehat Komplek Perumahan Panggon Indah, Kel. Rengas Pulau, Kec. Medan Marelan, serta SDN 068474 Jalan Tangguk Damai Blok 3, SDN 068475 Jalan Tuar Raya Komplek Griya Martubung dan SD swasta Washliyani Jalan Pancing Satu lingkungan 3 Kebun Lada, Kel. Besar, Kec. Medan Labuhan, dan laimnya, pembangunan gedung perpustakaannya berhenti dan terbengkalai. Pekerjaan bangunan perpustakaan di sekolah itu sudah berjalan setengah, tanpa atap, dan dindingnya masih belum diplaster. “Ini mulai dibangun tahun 2010, namun kami tidak tahu siapa pemborongnya. Sebab kami hanya diberitahu mendapat bantuan gedung perpustakaan dan terima kunci jika telah selesai,” kata Kepsek SDWashliyani Universita Washliyani didampingi Kepsek SMP Washliyani Surawan. Rencananya gedung perpustakaan itu dibangun untuk tempat sekitar 3000 judul

buku yang sebelumnya diserahkan Dinas Pendidikan Kota Medan. Namun akibat pembangunannya tidak kunjung selesai, semua buku itu belum bisa digunakan sekitar 387 siswa sekolah tersebut. “Karena tempatnya belum ada, bukunya tidak bisa digunakan dan masih tersimpan di gudang. Kami khawatir buku itu akan rusak dimakan rayap jika tidak segera manfaatkan,” sebutnya yang mengaku kecewa karena sekolahnya telah lama mendamba-kan perpustakaan. Anggota DPRD Sumut dari Fraksi PKS M Nasir mengatakan, dana pembangunan gedung perpustakaan SDN dan Swasta itu berasal dari Dana Alokasi Khusus (DAK) tahun 2010. Namun akibat pekerjaannya tidak benar, semua gedung perpustakaan tidak selesai sesuai jadwal yang rencananya yakni tahun 2011. “Dari laporan masyarakat pada reses kemarin, proyek ini milik Disdik Medan yang pekerjaannya disubkan ke sejumlah pemborong. Bahkan pekerja proyek ini ada yang tidak digaji karena pemborongnya sudah lari,” katanya saat meninjau SDWashliyani. Nasir menagih komitmen Wali Kota Medan Rahudman Harahap yang ingin memajukan pendidikan di Kota Medan, agar diwujudkan dan meminta pertanggungjawaban Kepala Disdik Medan mengenai hal itu. Namun bila tidak mampu diserahkan ke penyidik. “Saya menilai proyek ini terindikasi penyalahgunaan anggaran. Untuk itu, saya harap jaksa dan polisi tanggap dengan memulai penyelidikan masalah ini,” ujarnya. (h03)

Waspada/ Rustam Effendi

ANGGOTA DPRD Sumut M Nasir bersama Kepsek SD Washliyani Universita Washliyani dan Kepsek SMPWashliyani Martubung Surawan meninjau proyek pembangunan gedung perpustakaan yang tidak kunjung selesai di sekolah itu.

Medan Metropolitan


WASPADA Senin 27 Februari 2012

Ribuan Jamaah Hadiri Peringatan Maulid Nabi Kota Medan

Teks foto (Waspada/ Rustam Effendi

USTADZ Fikri Haikal MZ (baju hijau) duduk disamping Wali Kota Medan Ruhudman Harahap dan Muspika, sebelum memberi ceramah pada peringatan Maulid Nabi Besar Muhammad SAW tingkat Kota Medan, di lapangan bola halaman Masjid Al Husain, Griya Martubung.

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari



GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

BELAWAN (Waspada): Nabi Muhammad SAW adalah pemimpin di dunia dan akhirat. Karena itu, tidak seorangpun pemimpin di dunia ini yang mampu mengimbanginya. Hal itu dikatakan Al Ustadz Fikri Haikal MZ dalam tausiyahnya pada peringatan Maulid Nabi Besar Muhammad SAW tingkat Kota Medan di lapangan bola halaman Masjid Al Husain, Griya Martubung, Kel. Besar, Kec. Medan Labuhan, Jumat (24/2). Dijelaskan, bukti kalau Nabi Muhammad pemimpin dunia akhirat adalah pola hidupnya selalu sederhana walau dia berada pada puncak kekuasaan. “Dia tidur beralaskan daun kurma dan sarapan hanya memakan dua buah kurma ditambah air putih. Walupun Allah menawarkan dia kekayaan namun ditolaknya selama umatnya masih ada yang susah,” kata Fikri yang merupakan anak alm KH Zainuddin MZ, itu. Bahkan, kata Fikri, saat ajal akan menjelang, Muhammad tetap peduli dan ingat dengan umatnya dengan memberikan pesan. “Di dunia dia selalu membantu umat dan di akhirat nanti dia juga akan menolong umatnya,” ujarnya. Sejak hadir di lokasi maulid, Fikri Haikal MZ yang merupakan generasi penerus KH Zainuddin MZ itu telah memukau hati ribuan warga muslim Kota Medan, yang hadir dalam acara itu. Bahkan dicela- cela ceramahnya sesekali ada sindiran kepada pemerintah dan masyarakat. “Dulu di Medan ini banyak jalan yang

berlobang. Tapi sekarang, lobang yang berjalan- jalan,” kata Fikri berlogat khas Alm KH Zainuddin MZ dan disambut gelak tawa hadirin. Ustadz yang pandai berkelakar ini menyebutkan, sekarang seorang artis lebih dihargai daripada seorang ulama yang menunjukkan jalan benar ke surga. “Sekali manggung, seorang artis bisa dibayar hingga 60 juta rupiah. Padahal hanya membawakan lagu selama 6 menit. Tapi seorang ustad yang ceramah hingga satu jam, dibayar sekian puluh ribu rupiah, bahkan terkadang air putih pun tidak disedikan,” ucapnya, kembali disambut tepuk tangan dan tawa hadirin, termasuk Wali Kota Medan dan bawahannya. Sebelumnya,Wali Kota Medan Rahudman Harahap mengatakan, peringatan hari besar keagaman Islam akan dipusatkan di kawasan atau basis umat Islam. Hal ini diambil sebagai bukti kepedulian Pemko terhadap masyarakat dan meningkatkan hubungan silaturahmi. “Kalau sekarang di sini, tahun depan bisa di Marelan,” katanya. Usai acara, Camat Medan Labuhan Zain Noval mengatakan, tahun ini pembangunan Islamic Center akan dimulai di Griya 3 Kel. Tangkahan, dan pembebasan lahannya seluas 70 hektar mulai mendapat titik terang.“Rencananya, tahun ini dilakukan peletakan baru pertama. Namun masih menunggu keputusan penggurus Yayasan Islamic Center,” sebutnya. (h03)

Dituduh Penculik Nyaris Dibakar Massa MEDAN (Waspada): Dituduh menculik anak di bawah umur, seorang pria beristri tiga nyaris dibakar sekelompok orang tak dikenal di Jalan Rahayu, Desa Sambirejo Timur, Kec. Percut Seituan, Deliserdang, Minggu (27/2) sekira pukul 15:00.

Tersangka berinisial MDL, 42, kini diamankan petugas Polres Deliserdang. Informasi yang diperoleh di lokasi kejadian, siang itu MDL sedang istirahat di dalam rumahnya, usai memperbaiki sumur. Tidak berapa lama kemudian, sejumlah orang masuk ke rumah MDL. Tiga di antaranya mengaku petugas Polres Deliserdang, sembari memperlihat-

kan identitasnya setelah diminta warga setempat. Beberapa orang di antaranya langsung memaksa MDL ke luar dari rumah tersebut. Selanjutnya MDL dipukuli hingga babak belur dan beberapa orang lagi yang membawa minyak bensin dalam botol plastik Aqua berusaha membakar MDL namun dapat dicegah warga setempat. Saat bersamaan, seorang anggota Polresta Medan yang bermukim di belakang rumah MDL, langsung mengamankan belasan orang yang tidak diketahui dari mana asalnya itu. Namun, tiga di antaranya yang mengaku dari Polres Deliserdang memperlihatkan surat tugas penangkapan. Akhirnya MDL dibawa oleh petugas kepolisian. “Pria MDL dituduh menculik anak di bawah umur di daerah Kecamatan Batangkuis,

Kabupaten Deliserdang,” sebut anggota Polresta Medan itu. Sementara itu, Juli, istri MDL mengatakan, dirinya tidak tahu apa-apa soal tudingan terhadap suaminya itu. “Setahuku, anak yang diculik berada di rumah kakak MDL di Berastagi, dan dirawat di sana,” ujarnya. Sedangkan sejumlah warga yang bermukim di kawasan rumah MDL juga mengaku tidak tahu menahu soal aktivitas MDL karena jarang bergaul. Menurut warga, sejumlah pria yang mendatangi rumah MDL warga dari Kecamatan Batangkuis. “Kami terkejut ketika orangorang tak dikenal menyeret dan memukuli MDL. Setelah MDL mengaku telah menculik, barulah polisi berpakaian preman membawa pelaku pergi,” sebut Dijah, 30, warga setempat kepada Waspada. (h04)

Formas Dibentuk Untuk Pertahankan Tanah Polonia MEDAN (Waspada): Forum Masyarakat Sari Rejo (Formas) untuk mempertahankan tanah yang selama ini diduduki warga, Sabtu (26/2) malam, terbentuk. Sejumlah warga berkumpul di pelataran lapangan tengah Kel. Sari Rejo, Kec. Medan Polonia. Wakil Ketua I Formas Benny Rangkuti mengatakan, selayang pandang terbentuknya pengurus Formas yang baru merupakan perasaan dari masyarakat Kelurahan Sari Rejo, akan sebuah perubahan untuk mempertahankan tanah yang selama ini telah diduduki oleh masyarakat. Menurut Benny, bermula dari beredarnya di tengah masyarakat surat perintah tugas dari Wali Kota Medan no.800/ 601 tertanggal 12 Januari 2012 yang ditandatangani oleh Sekda Kota Medan tentang pemagaran aset TNI AU di Kelurahan Sari Rejo, Kec. Medan Polonia. “Awalnya ini kita lakukan karena Wali Kota Medan, menugaskan sejumlah petugas untuk melakukan pendataan terhadap sejumlah warga dan sejumlah Surat Keterangan Tanah (SKT) di atas lahan itu, dan beredarnya kabar, pada 30 Januari lalu akan diadakan pertemuan antara Wali Kota Medan dengan pengurus Formas, namun wali kota tak jadi datang,” sebutnya. Tidak hanya itu, lanjut Benny, undangan dari Camat Me-

dan Polonia tertanggal 01 Februari lalu untuk acara silaturrahmi Wali Kota Medan dengan masyarakat, ternyata hanya bercakap-cakap saja tanpa ada kesimpulan. Sehingga diadakan pertemuan di kantor Lurah Sarirejo dengan sejumlah perwakilan lingkungan serta para tokoh masyarakat dari lingkungan 1 sampai lingkungan 9. Ketua Umum Formas Drs Pahala Napitupulu BA mengatakan, perjuangan untuk mempertahankan tanah untuk masyarakat Sarirejo merupakan sebuah pilihan. “Perjuangan itu pilihan, kalau takut dan bimbang maka habislah kita. Karena kemenangan itu tidaklah jatuh dari langit melainkan harus kita rebut sama seperti perjuangan merebut kemerdekaan dari penjajah pada tahun 1945,” ujarsnya. Dia juga mengimbau kepada seluruh anggota Formas dan masyarakat Sarirejo, agar tidak terprovokasi dari janji manis orang-orang yang mengatakan perjuangan tanah Sarirejo tinggal selangkah lagi. Pembina Formas Mayor TNI AU (Purn) H Kusmani didampingi Mayor TNI AD (Purn) Harry mengatakan, jabatan kepengurusan Formas untuk mempertahankan tanah Sari Rejo itu merupakan amanah yang harus dijalankan secara jujur dan terbuka. “Yang utama adalah kejujuran dan keterbukaan dalam menjalankan tugas

demi tercapainya kepercayaan masyarakat,” ujarnya. Sementara itu, perihal keputusan tanah masyarakat Sari Rejo di Pengadilan Negeri (PN) Medan dengan no. 310/ Pdt. G/PN-Medan. Tertanggal 08 Mei 1990 yang menyatakan tanah-tanah sengketa adalah tanah garapan penggugat, dan Pengadilan Tinggi Medan No 294/PDT/1990/PT-Mdn. tertanggal 26 Maret 1990 serta keputusan Mahkamah Agung atas tanah masyarakat Sari Rejo no 229 K/Pdt/1991 tanggal 18 Mei 1995. Atas terbitan surat dari Mahkamah Agung RI tersebut, maka permohonan Kasasi dari Pemohon Kasasi Pemerintah Republik Indonesia di Jakarta cq, Panglima ABRI di Jakarta, cq, Kepala Staf Angkatan Udara di Jakarta, dan cq Komandan Pangkalan TNI AU Polonia di Medan. Susunan Pengurus Formas yakni; Pembina/Penasehat Mayor Purn TNI AU H Kusmani., Mayor Purn TNI AD Harry, M Togatorop, Ulung F Sitanggang, Mora Sogar Pohan, Salim dan Lumban Gaol. Ketua dan wakil Drs Pahala Napitupulu BA, Benny Rangkuti SH, MKN, P Sitohang, dan Rafles. Sekretaris dan wakil Wildan Areza SH, Drs Hermanto, M DIV dan Sutopo. Bendahara dan wakil M Kirpal Singh dan Wiji Santosa. Koordinator Lapangan Iwan Lokot, Maruli Pasaribu, dan Saharuddin Sembiring. (h04)

Perguruan Rizki Ananda Peringati Maulid Nabi MEDAN (Waspada): Yayasan Pendidikan (YP) Elva Syofyan Rizki Ananda memperingati Maulid Nabi Besar Muhammad SAW 1433H/2012 bertema “Dengan memperingati Maulid Nabi Muhammad SAW tingkatkan amal ibadah untuk menjadi siswa/i yang berakhlakul kharimah”, di halaman sekolah Jln. Merkatani Mariendal, Kamis (23/2). Ketua YP Elva Syofyan Perguruan Rizki Ananda Hj Elvayanti didampingi Kepala Sekolah Drs Syahril Manaf danWakasek Fathul Umra mengatakan, kegiatan religus itu berkat kerjasama orangtua murid tingkat SD, SMP, dan SMA, serta guru dalam melaksanakan pendidikan akhlak siswa melalui PHBI sekolah. Diharapkan kegiatan terse-

but muncul rasa kebersamaan siswa/i serta mampu mengembangkan potensi, fitrah, dan fungsinya sebagai generasi yang beriman bertaqwa kepada Allah SWT, serta mampu menguasai Ilmu Pengetahuan dan Teknologi (Iptek). Sekaligus mengambil makna agar bisa menjadi manusia yang berakhlak dan berbudi pekerti yang tinggi. Pendidikan agama harus dimulai sejak dini, agar mampu melahirkan generasi penerus bangsa yang benarbenar tumbuh sebagai insan yang memiliki akhlakul kharimah. Yakni insan yang bersikap taqwa kepada Allah SWT. Nilai-nilai ketauladanan yang dilakukan Nabi Muhammad SAW perlu kita aflikasikan dalam usaha mewariskan kehidupan yang lebih baik pada

siswa Perguruan Rizki Ananda. Sementara Ustadz Drs HM Ilyas Purba secara panjang lebar menyampaikan tausiyahnya tentang kelahiran Nabi Muhammad SAW di muka bumi antara lain yang dibawa adalah tentang ibadah termasuk shalat. “Orang yang berilmu akan diangkat derajatnya oleh Allah SWT, maka dianjurkan umat Islam menuntut ilmu karena hal itu termasuk nilai ibadah. Orang yang bodoh (tak berilmu) akan mengalami kesulitan dalam menjalani kehidupannya,” kata Purba. Pembacaan ayat suci Alquran oleh Diwi Khumairah, acara diselingi hiburan nasyid dari pelajar SMP Rizki Ananda serta pidato dai cilik Hazrina Masyita, pelajar kelas V SD, tentang kelahiran Rasulullah SAW dan lagulagu bernuansa Islami.(m24)

Kenduri Akbar Joko Tingkir Rayakan HUT Ke-6 MEDAN (Waspada): Kenduri Akbar memeriahkan HUT Ke-VI-2012 Joko Tingkir dengan thema “Menciptakan Nasionalisme Kebangsaan Yang Berwawasan Dalam Bingkai NKRI” digelar di lapangan mini Jln. AH Haris Nasution Gg Damai, Kec. Medan Johor, Sabtu (25/2) malam, berlangsung meriah dan sukses. Ketua Umum PW Joko Tingkir Sumut Sukirmanto SH, didampingi bendahara panitia Suparman SH, dan Sujoko mengatakan, sekitar 3000-an Satgas, kader Joko Tingkir dari 24 kabupaten/kota dengan pakaian serba hitam lengkap topi blangkon serta atribut, duduk bersila beralaskan tikar. Keluarga besar Joko Tingkir saling menyapa akrab memberi salam hormat dengan penuh kekeluargaan. Menurut Sukirmanto, paguyuban Jawa Joko Tingkir Sumut baru berusia 6 tahun yang dikategorikan masih lasak tapi cukup terarah. Digelarnya acara kenduri di Gg Damai itu karena memiliki sejarah. Bahwa ditempat inilah awalnya Joko Tingkir didirikan oleh beberapa tokoh masyarakat Jawa, guna membentuk Satgas yang bertujuan untuk mengangkat harkat dan martabat orang Jawa. Sehingga berhasil memanej serta menyatukan persepsi memupuk rasa kebersamaan, walaupun ada Pujakesuma karena itu masih saudara kita. Justru itu kenduri akbar ini bukan hanya sekedar kumpul-kumpul tapi lebih dari itu memiliki makna, selain silaturrahmi sekaligus membicarakan berbagai program. Orang jawa yang memiliki sifat legowo (berjiwa besar), profesional dan tidak selalu berlebihan dalam sikap (ojo dumeh), sudah banyak di Sumut. Maka jadikanlah kenduri akbar dirangkaikan dengan HUT menjadi perekat untuk menjalin kekompakan. Program Joko Tingkir ke depan, yaitu ingin berupaya berperan aktif membenahi serta membangun dalam upaya memajukan ekono-

mi rakyat melalui berbagai usaha-usaha kecil maupun menengah. Joko Tingkir saat ini sudah membentuk detasemen 99. Dengan landasan konstitusi dan moral. “ Saya menyatakan bangga karena Organisasi Paguyuban Joko Tingkir sudah menyebar keberbagai provinsi antara lain Bengkulu, Aceh, Pekan Baru, Riau. Bahkan sampai ke P. Jawa. Dan pada bulan Mei 2012 mendatang akan mendeklarasikan Joko Tingkir Indonesia dengan sekretariat di Jln. Gagak Hitam/Ring Road Medan. Bahkan Jenderal (Purn) Endiartono Sutarto menyatakan siap menjadi Ketua Dewan Pembina,” kata Sukirmanto. Sementara itu, Sekjen PB Satgas Joko Tingkir Indonesia Ir Setyo Purwadi MM mengharapkan, Joko Tingkir yang didirikan dengan susah payah bisa melangkah dengan tegar dan menjadi besar. “Sebagai orang Jawa saya bangga karena Joko Tingkir telah melebarkan sayapnya sampai ke P Jawa (Jateng, Jabar) meningkat ke tingkat nasional. Amanah yang diberikan oleh pendiri Joko Tingkir harus tetap dijaga eksistensinya untuk menumbuh kembangkan. Dengan konsisten mengawal empat pilar kebangsaan yaitu Pancasila, UUD 1945, Bhinneka Tunggal Ika dan NKRI,” katanya. Turut memberikan bimbingan sesepuh Joko Tingkir AKBP H Rusbandi, sedangkan ceramah agama dan doa disampaikan Ki Gondo Asmoro. Sebelumnya Satgas dan kader Joko Tingkir makan bersama nasi ambeng. Dalam kenduri akbar tersebut panitia berhasil mengumpulkan dana sebesar Rp 11.750. 000,— hasil sumbangan dari unsur dewan pendiri Joko Tingkir, dewan Pembina Sumut, anggota dari Kabupaten/kota. Juga memberi santunan kepada 108 anak yatim dari lingkungan Kecamatan Medan Johor sekitarnya serta membantu korban kebakaran Jln. Bakti Gg Seto, Kec. Medan Area.(m24)

Anak Lapas Tanjunggusta Diajak Rajin Sholat, Baca Alquran MEDAN (Waspada): Ustadz M Akhyar Nasution mengajak anak-anak remaja warga binaan Lembaga Pemasyarakatan (Lapas) Kelas II A-Anak Tanjunggusta, agar meneladani perilaku Nabi Muhammad SAW dalam kehidupan sehari-hari. “Peringatan Maulid Nabi Muahmmad SAW di Lapas II A Anak Tanjunggusta Medan ini mempunyai makna yang mendalam. Karena dapat menumbuhkan kecintaan seluruh warga binaan terhadap perilaku Nabi Muhammad SAW, baik saat masih di dalam maupun setelah ke luar dari LP ini,” sebut Akhyar Nasution saat memberikantausiyahnyapadaperingatanMaulid NabiMuhammadSAW,diaulaLapasKelasA-Anak Tanjunggusta Medan, Satu (25/2). Akhyar menjelaskan, makna peringatan Maulid Nabi di dalam Lapas, harus dapat diaplikasikan atau diwujudkan dalam aktivitas nyata di kehidupan sehari-hari dalam Lapas. Seluruh anak-anak binaan harus rajin mengerjakan sholat, membaca Alquran serta membentengi diri dengan akhlakul karimah adalah sebuah kewajiban, agar manusia tidak tersesat dan menyimpang dari ajaran yang dibawa oleh Rasulullah SAW. “Warga binaan di sini harus senantiasa rajin membaca surat Al Ikhlas, membaca salawat tiga kali setiap hari, serta meneladani pesan-pesan Nabi Muhammad sebagai seorang pemimpin yang tidak marah walau sering dikritik,” ujarnya. Sebelumnya, Kakanwil Kemenkum HAM Sumut Baldwin Simatupang BI.IP, SH, MH dalam sambutannya mengatakan, kegiatan keagamaan yang digelar seperti ini, kiranya

memberikan manfaat dalam perubahan hidup yang lebih baik, anak-anak warga binaan rajin mengerjakan sholat, tekun menuntut ilmu melalui kegiatan pelatihan keterampilan, dan menjaga akhlak, serta menjaga kesehatan jasmani dan rohaninya. “Dengan adanya kegiatan keagamaan di Lapas ini, diharapkan anak-anak warga binaan akan mendapatkan perubahan dalam pola fikir, perubahan budaya kerja, dan perubahan tingkah laku,” sebutnya. Sementara itu, Kepala Lapas Kelas II A Anak Tanjunggusta Medan Asep Syarifuddin Bc.IP, SH, CN, MH dalam sambutannya mengatakan, peringatan maulid intinya meneladani perilaku Nabi Muhammad SAW dan berharap kepada seluruh anak-anak warga binaan yang mendapat pencerahan dan perobahan untuk bisa lebih baik dalam menjalani hidup ke depannya. “Sebagai umat Islam harus menjunjung nilai-nilai dan kaidah serta hadist Nabi Muhammad SAW. Pada peringatan Maulid Nabi Muhammad SAW ini, banyak tauladan dan contohcontoh yang harus ditiru untuk lebih meningkatkan ketaqwaan. Meski di dalam Lapas, kegiatan keagamaan tetap dilaksanakan. Selain itu juga anak-anak warga binaan diberikan kegiatan pelatihan/ketrampilan sistim sekolah dan kegiatan pramuka” ujar Asep. Dalam peringatan Maulid Nabi Muhammad SAW ini bertemakan “Dengan memperingati Maulid Nabi Besar Muhammad SAW 1433 H, Mari kita sukseskan semangat reformasi birokrasi Kemenkum HAM RI melalui gerakan perubahan.” (cwan) Waspada/Ist

KEPALA Kantor Kementerian Hukum dan HAM Sumut Baldwin Simatupang, Ka Lapas Kelas IIAAnak Tanjunggusta Asep Syarifuddin, dan sejumlah staf foto bersama usai peringatan Maulid Nabi Muhammad SAW.

Sumatera Utara

WASPADA Senin 27 Februari 2012


Puting Beliung Ikut Merusak Gedung Puskesdes, SKB Dan Gereja PAKPAK BHARAT (Waspada): Kondisi terakhir kerusakan yang terjadi akibat bencana alam puting beliung yang terjadi di Pakpak Bharat, Jumat (23/2) lalu dilaporkan semakin membaik. Bencana tersebut, selain merusak 77 unit rumah, juga telah merusak gedung Puskesdes, SKB (Sanggar Kegiatan Belajar) serta dua gereja. Informasi yang dihimpun darilokasikejadianmenyebutkan, salah satu tenda darurat yang sempat didirikan pihak Tagana

(Taruna Siaga Bencana) yang bekerja sama dengan Dinas Sosial Pakpak Bharat di Sosor Desa Boangmanalu Salak kini

Waspada/Saut Boangmanalu

BUPATI Pakpak Bharat RemigoYolando Berutu,MBA memberikan bantuan kepada pihak keluarga alm. Sekka Anakampun korban bencana puting beliung Jambu Buah Rea Siempat Rube.

Taput Dukung Aweng Melanjutkan Kepemimpinan TARUTUNG (Waspada): Ketua MPC Pemuda Pancasila (PP) Tapanuli Utara, Bangun Lumbantobing menegaskan, Tapanuli Utara mendukung sepenuhnya Aweng (Anuar Sah) untuk melanjutkan kepemimpinan MPW PP Sumut untuk lima tahun kedepan. Hal itu disampaikan kepada wartawan di Kantor PP Taput Jl. Gerhard Lumbantobing No. 2 Tarutung, Rabu (22/2) terkait Musyawarah Wilayah (Muswil) PP Sumut yang akan digelar di Padangsidimpuan. “Dukungan tersebut merupakan kesimpulan dari rapat kerja pengurus yang menilai Saudara Aweng memiliki konsep kepemimpinan yang berorientasi pada pembangunan generasi muda baik regional maupun nasional,” ujar Bangun Lumbantobing. “Kami mengamati, pada kepemimpinan periode 2007-20012, Saudara Aweng telah membawa PP Sumut menjadi organisasi yang terasa memberikan kontribusi pada pembangunan didaerah ini. Dukungan itu akan kami perjuangkan pada Muswil mendatang” tambah Bangun. Untuk mengikuti Muswil PP di Padangsidimpuan, Bangun Lumbantobing akan didampingi beberapa orang unsur pimpinan. “KitaberharapMuswilnantiakanmembuahkanhasilyangberdampak pada pembinaan generasi muda di Sumut agar keberadaannya di tengah masyarakat dapat memberikan kontribusi untuk pembangunan,” ujarnya mengakhiri. (a21)

Ngobrol Di Rumah Tetangga Sepedamotor Lewong SIDIKALANG (Waspada): Kepala Unit Pelaksana Teknis (UPT) pendidikan dasar Kec. Sidikalang Kab. Dairi, Jonson Manurung, SPd, kehilangan satu unit sepedamotor jenis Revo, BB 2877 YA dari halaman rumahnya, Rabu (22/2) sekira pukul 19:00. Manurung kepada Waspada, Kamis (23/2), sepulang dari kantor, ia memarkirkan sepedamotornya di K5 rumahnya Panji Siburabura, Kelurahan Batang Beruh, Kec. Sidikalang. Lalu pergi ke rumah tetangga yang berjarak 30 meter dari rumahnya yang kebetulan kedai kopi. Satu jam berada di kedai kopi tersebut, ia pulang hendak makan malam. Namun setiba di halaman rumah, ia terkejut melihat sepedamotornya tidak lagi berada ditempat semula. (a20)

LPPD Perekat Hubungan Pemerintah Daerah Dan Pusat PAMATANGRAYA (Waspada): Dikeluarkannya PP Nomor 3 tahun 2007 oleh pemerintah pusat, selain sebagai payung hukum bagipemerintahdaerahdalampenyusunanLaporanPenyelenggaraan Pemerintahan Daerah (LPPD). Juga, merupakan konsekwensi dari berlakukannya UU Nomor 32 tahun 2004, di mana pemerintah harus mempersiapkan 35 regulasi serta instrumen yang akan menjadi landasan dan acuan dari kebijakan penyelenggaraanpemerintahandaerahyangefektif,efisien,transparan dan akuntabel, diantaranya adalah pangaturan tentang LPPD, pelaporan pertanggungjawaban kepala daerah, serta informasi pelaporan penyelenggaraan pemerintah daerah. Bupati Simalungun, JR Saragih, melalui Plh. Sekda Simalungun, Topot Saragih, mengatakan itu saat membuka workshop penyusunan LPPD tahun 2012 di Simalungun City Hotel, Pamatangraya, barubaru ini Dikatakan, LPPD merupakan salah satu piranti komunikasi, koordinasi dan perekat hubungan hirarkis antara pemerintah Daerah dan pemerintah Pusat. “Laporan Keterangan Pertanggungjawaban Kepala Daerah kepada DPRD dan informasi penyelenggaraan pemerintah daerah kepada masyarakat, merupakan medium bagi masyarakat untuk memberikan tanggapan dan saran atas penyelenggaraan pemerintahan daerah,” sebutnya. Sebelumnya, Kabag Administrasi Pemerintahan Umum, Rizal EP Saragih, dalam laporannya mengatakan, kegiatan workshop yang dilaksanakan oleh Pemkab Simalungun ini bertujuan untuk menserasikan dan mengitegrasikan seluruh data dari seluruh SKPD ke dalam LPPD Kab. Simalungun. (a29)

Pemkab Pakpak Bharat Peringati Maulid Nabi PAKPAK BHARAT (Waspada): Bupati Pakpak Bharat Remigo Yolando Berutu, MBA menyampaikan pentingnya memelihara rasa kebersamaan dan persaudaraan yang dapat dijadikan menjadi modal dasar pembangunan daerah Pakpak Bharat. Pernyataan itu disampaikannya pada acara peringatan Maulid Nabi Muhammad SAW 1433 H di Kab. Pakpak Bharat di gedung Serbaguna Salak, baru-baru ini. Bupati juga mengapresiasi tema “Dengan Peringatan Maulid Nabi BesarMuhammadSAWkitatingkatkansilaturahmi,rasapersaudaraan, dan toleransi antar umat beragama” yang dibuat panitia. Peringatan Maulin Nabi ini selain dihadiri Bupati Pakpak Bharat, juga terlihat Wakil Bupati Pakpak Bharat Ir. H. Maju Ilyas Padang, Sekda Kab. Pakpak Bharat Drs. Hoteler Sinamo, MM, perwakilan Muspida, sejumlah anggota DPRD Pakpak Bharat, Kepala Kemenag Pakpak Bharat, pejabat di lingkungan Pemerintah Pakpak Bharat, masyarakat serta utusan perwiridan dari berbagai penjuru Kabupaten Pakpak Bharat. Dr Drs. H. Azahar Sitompul, Dosen Pacasarjana IAIN Medan yang menjadi penceramah dalam peringatan Maulin Nabi ini juga menekankan pentingnya rasa persaudaraan yang perlu dipupuk di antara sesama umat manusia dengan tidak perlu memandang dia datang dari golongan dan agama apapun. “Dalam Islam diajarkan untuk berbuat benar, bicara yang benar dan jujur, sabar dan senantiasa bertakwa kepada Allah dan ajaranNya. Orang baik berkata, baik memang bagus, alangkah jauh lebih baguslagikalaukitabisamenjadiorangbenar,bicarabenar,danberbuat benar sesuai dengan tuntutan agama kita,” ungkapnya. (csb)

sudah dibongkar, karena dianggap kondisi masyarakat sudah membaik. Sementara tenda darurat yang terdapat di Jambu Buah Rea hingga saat ini masih berdiri untuk membantu masyarakat setempat. Dikabarkan, bahwa Minggu (26/2), Bupati Remigo Yolando Berutu, MBA didampingi Wakil Bupati Ir. H. Maju Ilyas Padang, Sekda Holler Sinamo, Kadis Sosial Manurung Naiborhu, SPd, MM, anggota DPRD Pakpak Bharat Lukman Padang, Camat Siempat Rube, telah menyerahkan sejumlahbantuandanlangsungmenjenguk korban tewas bencana atas nama Sekka Anakampun. Bupati Remigo Yolando Berutu, MBA pada kesempatan tersebut menyampaikan turut berdukacita dan menyampaikan akan membantu masyarakat yang terkena bencana melalui Dinas Sosial, Tenaga Kerja Dan Transmigrasi. Usai meninjau para korban bencana puting beliung Bupati Pakpak Bharat Remigo Yolando

Berutu, MBA kepada wartawan menyampaikan pihaknya akan terus bekerja memantau dan sekaligusmembantuparakorban. “Pada kesempatan ini saya mengimbau kepada seluruh masyarakat Pakpak Bharat agar kedepanjikaterjadibencanaalam untuk lebih waspada. Jika terjadi angin kencang agar menjauh dari lokasi yang terdapat pohon besar atau dari daerah-daerah yang terdapat sungai yang berpotensi meluap” ungkapnya. Barmike Manik, ST Staf BidangPemberdayaanSosialdan Penanggulangan Bencana Dinas Sosial,Tenaga Kerja danTransmigrasi Kab. Pakpak Bharat kepada wartawan di Salak, Minggu (26/2) mengatakan, masyarakat yang terkena bencana sudah terdata dan telah mendapat bantuan tahap pertama berupa beras, mi instan, minyak goreng, sarden kaleng dan kecap. Lebih jauh disampaikan Manurung Naiborhu, Kadis Sosial, data terakhir yang didapat pihaknya, jumlah korban dan kerusa-

kan terkena bencana puting beliung, meliputi Poskesdes Desa Boangmanalu rusak berat, Poskesdes Siempat Rube 1, SKB (SanggarKegiatanBelajar)diDesa Boangmanalu Salak Rusak Berat, Gereja GKPPD Siempat Rube II rusak sedang, Gereja RK Singgabur rusak ringan. Sedangkanrumahpenduduk yang mengalami kerusakan kategori rusak berat 6 unit, rusak sedang 5 unit dan rusak ringan 66 unit. Dengan demikian jumlah keseluruhan rumah warga yang rusak hingga hari ketiga pendataan pihak Pemkab Pakpak Bharat mencapai 77 unit rumah dan 5 unit fasilitas umum. Seluruh kerusakantersebutberadadiempat kecamatanyaknidiKec.SitelluTali UrangJulu,Kec.Salak,Kec.Tinada dan Kec. Siempat Rube. “Sejauhinikitasudahmelakukan koordinasi dengan pihak PemerintahProvinsimelaluiDinas Sosial, kepada pihakTagana Pusat dan ke pihak Kementerian Kordinator Kesejahteraan rakyat” ungkap Manurung Naiborhu. (csb)

Ruas Jalan Sidikalang-Perjaratan Butuh Perbaikan SIDIKALANG (Waspada): Masyarakat di sepanjang jalan Air Bersih, Kelurahan Batang Beruh Kec. Sidikalang, termasuk Kelurahan Panji Dabutar, Kec. Sitinjo Kab. Dairi hingga perbatasan Kab. Pakpak Bharat, sangat mengharapkan perbaikan jalan yang saat ini tampak memprihatinkan di sejumlah titik. Selain kondisi jalan banyak yang berlubang, sebahagian aspalnya juga sudah terkelupas. Kondisi tersebut terdapat di sejumlah titik ruas jalan perbatasan Kab. Dairi- Panjaratan Kab. Pakpak Bharat. Informasi yang himpun Waspada, Kamis (23/2), masyarakat sekitar sangat resah dengan kondisi jalan tersebut. Terlebih pada

saat musim hujan datang, di mana jalan tampak tergenang air. “Kondisi ini akan lebih menyulitkan bagi pengguna kendaraan khususnya roda dua, jelas,” T. Siburian. Ditambahkan, perbaikan yangselamainihanyasebahagian saja, itupun tampak hanya penyisipan. “Kita berharap instansi terkait dapat memperhatikan kondisitersebutdansegeramemperbaikijalandimaksud,”jelasnya. Pantauan Waspada, Kamis (23/2) di lapangan, kondisi jalan di sejumlah titik tampak kupak kapik, dan segera membutuhkan perbaikan guna kenyamanan dan keamanan pengguna jalan. Sementara, Kasi Peningkatan Jalan dan Jembatan PU Bina

Marga Sidikalang, Maringan Bancin, ST, MT, dikonfirmasi di ruang kerjanya, Kamis (23/2), menjelaskan, status jalan dimaksud saat ini telah ditingkatkan menjadi jalan propinsi. Bancin menambahkan, untuk tahun 2012 ini telah dianggarkan dana untuk pemeliharaan periodik/pengaspalan jalan Sidikalang-Panjaratan sepanjang 1,5 Km dari sumber dana DAK (Dana Alokasi Khusus). “Namun diharapkan ada kesadaran dari masyarakat dalam merawat kondisi ruas jalan tersebut setelah pekerjaan selesai dikerjakan, sebab untuk tahun 2013 mendatangruasjalandimaksudsudah menjadi tanggung jawab Pemprovsu,” pungkasnya. (ckm)

Pemkab Di Kawasan Danau Toba Harus Komit Majukan Pariwisata SIMALUNGUN (Waspada): Jajaran Pemerintah Kabupaten (Pemkab)dikawasanDanauToba harus berkomit dan memiliki tekad bersama, serta mampu menjalin kerjasama yang saling mendukung dan menghormati untuk memajukan pariwisata Danau Toba sesuai tata kelola yang profesional. Ungkapan itu dikemukakan Bupati Simalungun, JR Saragih, kepada wartawan di Parapat, kemarin,usaimelakukankunjungan khusus dalam rangka menemui sertamenggalangkomitmenpara bupati se-kawasan Danau Toba. Kunjungan khusus Bupati Simalungun sebelumnya sudah diawali dengan pertemuan bersama Bupati Tapanuli Utara, Torang Lumbantobing di Tarautung, Bupati Toba Samosir, Kasmin Simajuntak, di Tobasa, Kamis (16/2). Kemudian, pada akhir Februari 2012 JR Saragih juga akan menemui Bupati Karo, Bupati Dairi dan Bupati Samosir serta kepala daerah lainnya untuk membicarakan dan merumuskansistempengelolaanpariwisata Danau Toba. JR Saragih menjelaskan, untuk mengembangkan sektor pariwisata Danau Toba dibutuhkan komitmen yang kuat dan didukung oleh mental dan karakter yang baik. Melalui peranan dan komitmen yang dimiliki oleh pemerintah daerah sekawasan DanauTobasecarabersamadiharapkan mampu melakukan tata kelola pariwisata Danau Toba. Lebih lanjut dia mengatakan, peranan pemerintah daerah dalam menyelenggarakan tata kelolapariwisataDanauTobayang benar dan profesional harus didukung pula pelayanan prima oleh masyarakat pariwisata itu sendiri. Pemerintah daerah sekawasanDanauToba diyakinimam-

pu mengajak semua pihak untuk secara aktif menjalin kemitraan dengan masyarakat pelaku pariwisata pada masing–masing daerah kabupaten hingga ke tingkat provinsi, pemerintah pusatbahkanduniainternasional. Pemerintah daerah dapat untuk bertukar pengetahuan dan pengayaan pengalaman tentang pengelolaan destinasi pariwisata Danau Toba, selanjutnya akan merumuskan berbagai konsep tata kelola pengembangan pariwisata Danau Toba. Bupati Simalungun mengungkapkan, persoalan klasik dalam pengelolaan pariwisata Danau Toba selama ini dihadapkandengan lemahnyakoordinasi, kemitraan, perencanaan yang tidak partisipatif, rendahnya kapasitas SDM, data dasar dan penelitian yang terbatas. BersamaandenganituBupati juga mengungkapkan sejumlah pandangan tentang langkahlangkah strategis yang perlu dilakukan oleh pemerintah kabupaten/kota, Pemerintah Provinsi Sumatera Utara agar mampu membuktikan keunggulannya dalam pelaksanaan tata kelola destinasi pariwisata Danau Toba yang maju. JR Saragih, yang juga KordinatorAssosiasiPemerintahKabupatenSeluruhIndonesia(APKASI) Wilayah Sumaetara Utara ini mengatakan beberapa pandangan dan pokok-pokok yang dapat direkomendasi untuk pengelolaan pariwisata DanauToba yakni manajemen pengelolaan pariwiwsataDanauTobasebelumnya masih bersifat konvensional, karenannyaperludiorganisasikan agar lebih kreatif sehingga dapat menyajikanpelayananprimadan lebih optimal. “Pemerintahkabupaten/kota dan pemerintah provinsi serta

pemerintah pusat harus bersama-sama berkomitmen terhadappengelolaanpariwisataDanau Toba yang kuat dan berkelanjutan. Selanjutnya yang paling utama adalah peran partisipasi masyarakat lokal sesuai dengan mental dan karakter yang baik mampu menerima perkembangan pariwisata,” tegas JR. Pencapaian target jangka pendek pengelolaan pariwisata DanauToba, menurut JRSaragih, dapat dicapai dengan fakta yaitu peningkatan jumlah kunjungan wisata, dimana meningkatnya jumlahkunjunganwisatakeDanau Toba akan mampu menciptakan produk wisata yang bermutu dan berdaya saing tinggi, serta memberikan manfaat kepada masyarakat. Target kedua adalah tumbuhnya peran partispasi dan kapasitas masyarakat dalam usaha pariwisata. Ketiga mampu memunculkan respon positif seluruh peran pemerintah daerah, lembaga swadaya masyarakat dan tokoh masyarakat untuk berperan aktif mengembangkan destinasi dan memajukan usaha pariwisata di kawasan Danau Toba Sumaetra Utara. Sementara itu, tujuan jangka panjang adalah melibatkan peranan pemerintah pusat dan lembaga internasional dalam pengembangan destinasi pariwisata Danau Toba. Usai melakukan kunjungan silaturahmi dengan masing masing Bupati se kawasan Danau Toba, selanjutnya akan menyusun instrument organisasi pada lintas sektoral di daerah untuk mengukur komitmen kinerja pengembangan yang sudah dicapai mulai dari yang bersifat umum/generic hingga ke tingkat yang lebih khusus/spesifik,kata Saragih. (a29)


BUPATI Simalungun JR Saragih, ke Pemda sekawasan Danau Toba, turut didampingi Muspida antara lain Kapolres Simalungun, AKBP M Agus Fajar Arkam SIK, Dandim 0207 Letkol (Arh) Edy Setiawan, Ketua PN Simalungun, Hj Hasmayetti, SH, MHum, Dandenpom Letkol CPM Dedi Suryana, anggota DPRD Simalungun, Mansur Purba, mewakili Kajari, Kasie Intel, Taufik SH, Plh Sekda Simalungun Topot Saragih, Aspemkesra, Oberlin Hutagaol dan beberapa pimpinan Satuan Kerja Perangkat Daerah (SKPD) di jajaran Pemerintah Kabupaten Simalungun.

Waspada/Bothaniman Jaya Telaumbanua

PULUHAN massa Gerakan Mahasiswa Nasional Indonesia Cabang Nias melakukan aksi unjukrasa damai di persimpangan Jl. Diponegoro dan Jl. Pendidikan Gunungsitoli menolak kedatangan Ketua Umum DPP Partai Demokrat, Anas Urbaningrum.

Kedatangan Anas Di Nias Disambut Aksi Demo Pengurus 5 DPC PD Dilantik GUNUNGSITOLI (Waspada): Kedatangan Ketua Umum DPP Partai Demokrat, Anas Urbaningrum di Nias untuk melantik Pengurus DPC Partai Demokrat se Kepulauan Nias diwarnai aksi unjukrasa puluhan massa dari Gerakan Mahasiswa Nasional Indonesia (GMNI) Cabang Nias, Sabtu (25/2). Mereka menolak kedatangan Anas karena terindikasi terlibat sejumlah dugaan kasus korupsi. Massa GMNI Nias melakukan aksi unjukrasa damai tepat di persimpangan Jl. Diponegoro dan Jl. Pendidikan Gunungsitoli merupakan jalan yang akan dilewati iring-iringan mobil Anas Urbaningrum dan rombongan menuju lokasi acara pelantikan Pengurus 5 DPC Partai Demokrat se Kepulauan Nias di Lapangan Merdeka, Gunungsitoli. GMNI Nias dipimpin Erwin Hulu melakukan aksinya dengan menggelar spanduk yang bertuliskan “Tolak Anas Urbaningrum” serta menyampaikan orasi dan pernyataan sikap menolak kedatangan Anas di daerah itu karena terindikasi terlibat sejumlah dugaan kasus korupsi. Namun aksi unjukrasa GMNI Nias yang sempat mengundang perhatian masyarakat tersebut berhasil dikendalikan oleh petugas kepolisian dari Polres Nias dengan mengarahkan puluhan massa tetapberadadipinggirjalandantidakmenghalangi kedatangan Anas bersama rombongan menuju

Lapangan Merdeka Gunungsitoli. Dilantik Ketua Umum bersama Sekretaris Jenderal Dewan Pimpinan Pusat Partai Demokrat, Anas UrbaningrumdanEdyBaskoroYudhoyonomelantik Pengurus 5 Dewan Pimpinan Cabang Partai Demokrat se Kepulauan Nias yang dipusatkan di Lapangan Merdeka, Gunungsitoli, Sabtu (25/2). Empat dari lima Pengurus DPC Partai DemokratseKepulauanNiasyangdilantikdiketuai oleh kepala daerah yakni Kota Gunungsitoli, Kab. Nias, Kab. Nias Utara dan Kab. Nias Barat. Sedangkan Ketua DPC Partai Demokrat Kab. Nias Selatan dipimpin oleh Ketua DPRD Nias Selatan. Adapun kelima DPC Partai Demokrat yang dilantik oleh Ketua Umum DPP Partai Demokrat, Anas Urbaningrum masing-masing DPC Partai Demokrat Kota Gunungsitoli, DPC Kab. Nias, DPC Nias Utara, DPC Partai Demokrat Kab. Nias Barat dan DPC Kab. Nias Selatan. PelantikanDPCPartaiDemokratseKepulauan Nias turut dihadiri Ketua DPP Partai Demokrat, Joni Allen Marbun, Soetan Batughana, Ketua DPD Partai Demokrat Sumatera Utara, H.Tengku Milwan dan Sekretaris Tahan Manahan Panggabean serta sejumlah anggota DPRD Sumut dan anggota DPRD Kabupaten/Kota se Kepulauan Nias dari Partai Demokrat. (a25)

Diduga Cabuli Anak Di Bawah Umur, CPNS Nias Ditangkap GUNUNGSITOLI (Waspada): Satuan Reskrim Unit PPA Polres Nias menahan seorang oknum Calon Pegawai Negeri Sipil (CPNS) yang bertugas di Kantor Badan Ketahanan Pangan Kabupaten Nias berinisial FH sebagai tersangka dugaan kasus perbuatan cabul terhadap seorang wanita yang belum dewasa. Penahanan FH berdasarkan laporan pengaduan dari seorang perempuan yang masih belum dewasa dan merupakan pacar tersangka sendiri. FH dilaporkan setelah korban dicabuli sebanyak tigakalidenganjanjiakandinikahi.Namunternyata tersangka mengingkari janjinya sehingga korban melaporkan perbuatan FH kepada polisi. Korban sebut saja Ani, 20, warga Desa Hilihambawa, Kec. Botomuzoi, Kab. Nias kepada wartawan menjelaskan dirinya telah tiga kali dicabuli oleh tersangka FH yang merupakan pacarnya sendiri warga Desa Simanaere, Kec. Botomuzoi Nias. Menurut korban, dia dicabuli tersangka pertama kali di rumah abang tersangka di Desa Dahana, Kec. Gunungsitoli, Kota Gunungsitoli, pada Januari 2011 dengan iming-iming akan dinikahi. Perbuatan yang sama dilakukan di Hotel Tinca di Jalan Yos Sudarso, Kelurahan Saombo, Kec. Gunungsitoli pada Juli 2011 dan yang ketiga perbuatan cabul dilakukan tersangka terhadap dirinya di belakang sebuah gereja di Desa Hili-

hambawa, Kec. Botomuzoi, Kab. Nias. Ani menyebutkan setelah melakukan pencabulanterhadapdirinyatidaklamakemudian tersangka lulus menjadi CPNS, namun FH tidak pernah lagi mau bertemu ataupun menepati janjinya untuk menikahi dirinya. Bahkan menurut Ani, tersangka juga pernah menemui orang tuanya dan berjanji akan menikahi dirinya. “Jangankandiamenepatijanjiuntukmenikahi seperti janjinya kepada saya dan orangtua saya, dia malah mencemarkan nama baik saya dengan menceritakan di kampung kami jika dia telah mencabuli saya beberapa kali, sehingga saya kini dikucilkan di kampung,” tutur Ani. Atas perlakuan tersangka kepada korban bersama orangtuanya melaporkan tersangka ke Polres Nias.Tragisnya lagi, setelah membuat laporan, dua hari kemudian orangtua korban meninggal dunia diduga karena tidak sanggup menahan rasa malu. Kasat Reskrim, AKP.Enieli Hulu yang dihubungiwartawanmelaluiteleponseluler,Kamis (22/2) membenarkan pengaduan korban dan menetapkan FH sebagai tersangka dan dilakukan penahanan karena diduga telah melakukan persetubuhan/perbuatan cabul dengan wanita yang belum dewasa. Tersangka dijerat dengan pasal 293 KUHP dengan ancaman hukuman maksimum tujuh tahun penjara. (a25)

Pekerja Bangunan Tersengat Listrik PEMATANGSIANTAR (Waspada): Seorang pekerja bangunan, JokoWandiro, 25, warga Jalan Toba I, Kelurahan Kristen, Kec. Siantar Selatan, Kota Pematangsiantar nyaris tewas terkena aliran listrik di Jalan Asahan, Desa Dolok Marlawan, Kec. Siantar, Kabupaten Simalungun baru-baru ini. Peristiwa itu terjadi ketika korban bersama teman-temannya hendak memasang awning di lantai tiga satu bangunan dari delapan bangunan rumah toko (ruko). Sementara, bahan-bahan yang akan digunakan saat itu berada di lantai satu dan korban saat itu sedang membawa bahan bangunan berupa sebatang besi sebagai penyangga hendak ke lantai tiga. Namun, ketika sampai di lantai dua, besi sepanjang enam meter yang dipanggul korban itu di bagian belakangnya, ternyata terkena kabel listrik PLN yang melintang di pinggir jalan. Akibatnya, besi itu dialiri listrik dan korban korban tersengat hingga terpental dan jatuh ke lantai satu. Beruntung, korban jatuh ke atas tumpukan

pasir yang akan digunakan sebagai bahan bangunan hingga tubuh korban hanya pingsan akibat tersengat arus listrik dan luka-luka di tubuhnya hanya luka ringan. Para pekerja lainnya bersama kepala tukang Sipi segera membawa korban ke RSUVita Insani, Kota Pematangsiantar guna mendapat perawatan.Sesudahmendapatperawatan,korban akhirnya sadarkan diri dan sudah bisa berbicara meski masih terbata-bata. Sipi yang dihubungi wartawan menyebutkan perusahaan tempat mereka bekerja Kings, Pematangsiantar sudah menyatakan bersedia menanggung segala biaya perobatan korban sampai korban sembuh. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH, Kasat Reskrim AKP M. Adenan AS, SH, S.Ik, MH dan Kapolsek Bangun AKP Hitler Sihombing menyebutkan kejadian itu masih dalam penyelidikan. (a30)

Labfor Poldasu Selidiki Kebakaran Di Kabanjahe KABANJAHE (Waspada): Tim Laboratorium Forensik Kepolisian Daerah Sumatera Utara (Labfor Polda Sumut) akan menyelidiki peristiwa terbakarnya lima rumah toko atau ruko di Jalan Pasar Baru Pusat Pasar Kabanjahe, Senin (20/2). “Kita sudah meminta Tim Labfor Poldasu turun untuk melakukan olah tempat kejadian perkara.Inisebagaiprosestindaklanjutmenyelidiki penyebab kebakaran di lima ruko tersebut,” ujar Kapolres Tanah Karo, AKBP Marcelino Sampow, melalui Kasat Reskrim AKP Harry Azhar kepada Waspada di Kabanjahe. Ia menambahkan, pihaknya belum bisa memastikan penyebab kebakaran. Tim penyidik Satuan Reserse Kriminal (Satreskrim) juga masih mengumpulkan keterangan sehingga diperlukan waktu untuk mengungkapnya. Sejumlah barang bukti juga sudah disita untuk penyelidikan lebih lanjut. Petugas juga akan akan meminta keterangan dari sejumlah pihak, termasuk pemilik ruko. Namun, tidak dalam waktu dekat karena masih dalam suasana duka. Kepolisian juga akan mendalami terkait adanya dugaan penimbunan

minyaktanahdangasdisalahsaturuko.“Mengenai adanya dugaan penimbunan minyak tanah dan gas, kita akan mendalaminya saat pemeriksaan nanti,” kata Azhar. Seperti diwartakan sebelumnya, Enam unit ruko berlantai dua di Jalan Pasar Baru Pusat Pasar Kabanjahe Kab. Karo terbakar, Senin (20/2) sekitar Pukul 17:00. Lima di antara ruko tersebut ludes dilalap api, sementara satu unit lainnya hanya terbakar dilantai duanya saja. Tidak ada korban jiwa dalam peristiwa ini, namun seorang petugas pemadam kebakaran mengalami luka-luka di bagian kepala terkena pecahan kaca saat berusaha memadamkan api. Sementara, kerugian ditaksir mencapai miliaran rupiah. Keenam ruko tersebut, masing-masing, dua unit ruko milik Harianto yang menjual sembako, satuunitrukomilikTimotiusTariganyangdigunakan untukusahadagangkelontong,satuunitmilikSaman Munthe yang menjajakan buah-buahan, satu unit salon milik Eunike Br Situmorang serta satu ruko milik Robert Simarmata yang menjajakan gas dan minyak tanah. (cal/c10)

Sumatera Utara


Kurir Ganja Dihukum Lima Tahun Enam Bulan


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

RANTAUPRAPAT (Waspada): Terbukti membawa ganja untuk dijual kepada orang lain, terdakwa Muhammad HidayatTaufik Girsang alias Yudi dijatuhi hukuman 5 tahun 6 bulan penjara oleh Majelis Hakim dalam persidangan di Pengadilan Negeri (PN) Rantauprapat, baru-baru ini. Selain dijatuhi hukuman penjara, terdakwa dijatuhkan hukuman sebesar Rp1 miliar, subsidair 6 bulan penjara, dan menyatakan barang bukti 5 bungkus besar daun ganja kering seberat 356,81 gram, 3 bungkus ganja kering seberat 21,52 gram, 1 plastik asoy ganjaseberat387gramdan1unitmobilZebraBB1010LRdipergunakan dalam berkas perkara terpisah terhadap terdakwa Riswan Efendi Manurung alias Bembeng. Majelis Hakim diketuai Dedi SH sependapat dengan tuntutan Jaksa Penuntut Umum (JPU) Sahat J Rumahorbo SH dengan mengatakan, terdakwa terbukti bersalah melakukan tindak pidana tanpa hak atau menawarkan narkotika golongan I dalam bentuk tanaman berupa ganja kering sebagaimana dalam dakwaan Pertama melanggar pasal pasal 114 ayat (1) jo pasal 132 ayat (1) UU RI No.35 Tahun 2009 tentang Narkotika. Terdakwa ditangkap polisi hari Senin, 25 Agustus 2011 sekira pukul 13.30 di Dusun Pinang Awan, Desa Aek Batu, Kec. Torgamba, Kab. Labuhanbatu Selatan, bersama temannya Riswan Efendi Manurung. Pada saat dilakukan penangkapan, terdakwa bersama temannya Riswan Efendi mengendarai mobil Zebra BB 1010 LR membawa ganja kering dimaksud dengan tujuan menjualnya kepada Syahrul dan Iful (DPO). Pada saat terdakwa dan temannya bertemu Syahrul, dengan tiba-tiba polisi datang menangkapnya. Setelah mendengar putusan yang dikatakan majelis hakim, terdakwa yang didampingi penasihat hukumnya menyatakan menerima putusan tersebut, demikian juga JPU. (a18)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.


SEJUMLAH warga melintas di atas jembatan yang lebarnya hanya 1,5 meter dan panjang sekitar 50 meter yang dibangun Jepang sewaktu zaman penjajahan (1940-an), dan sudah puluhan tahun belum lagi diperbaiki. Foto direkam beberapa waktu lalu.

Pembangunan Asahan Harus Merata

KISARAN (Waspada): Aksi pengumpulan koin dan barang bekas untuk pembangunan Jalan Kecamatan Bandarpulau tetap berlangsung. Karena hal itu merupakan teguran bagi pemerintah untuk membangun Asahan dengan merata yang dinilai gagal. Hal itu diungkapkan, Pengurus Bandar Pulau Asahan Community, Indra Dinata, dikonfirmasi Waspada, Minggu (26/ 2). Dia menuturkan, bahwa Kec. Bandarpulau merupakan korban politik dalam mengumpulkan suara sewaktu Pilkada Bupati 2010-2015.KarenasewaktupemilihanKec.Bandarpulaudiberikan janji akan dibangun jalan demi meningkatkan roda perekonomian masyarakat. “Namunkenyataanituhanya tinggal janji, sedangkan yang menanggungdampaknyaadalah masyarakat. Oleh sebab itu mere-

ka melampiaskan kekecewaan itu dengan mengumpulkan koin dan barang bekas untuk membangun jalan,” ujar Indra. Tidakmeratanyapembangunan itu, Indar menilai, bahwa pemerintah lebih memprioritaskanmemperindahibukotakabupaten,denganmembanguntugu, median jalan, taman dan lampu hias yang nilai cukup besar. Sedangkan masyarakat pelosok tetaptidakdiperhatikandansaran jalan terus menerus mengalami kerusakan. “Memperindahkotaituwajar dilakukan, namun sebaiknya

pemerintah harus memprioritaskandaerahpelosokyangmemberikan sumbangsih dalam menambah PAD, karena banyak kepala keluarga yang bergantung hidup dengan infrastruktur yang dibangun. Dan sudah puluhan tahunjalanKec.Bandarpulauyang dihuni oleh 10 desa tidak diperhatikan,” ujar Indra. Sementara anggota DPRD Asahan Syamsul Qodri Marpaung, menuturkan, tindakan pengumpulan koin olah masyarakat Badarpulau merupakan aspirasi masyarakat yang wajar. Namun tentunya diharapkan masyarakat untuk bersabar, karena wilayah Asahan cukup besar sehingga pembangunan dilakukan dengan bertahap. Disinggung dengan penghinaan terhadap pemerintah yang tidak mampu membangun de-

nganmeratadanmengutamakan keindahan ibu kota kabupaten, Syamsul tidak memberi tanggapan, namun dia berharap masyarakat untuk bisa melihat sistem pembangunan yang dilakukan. Karena dia menilai, pemerintahanmemulaipembangunan dari kota ke desa. Aksi pengumpulan koin dimulaisejakMinggu(19/2)dengan mendirikan posko di pinggir jalan besar Dusun I, Desa Padangpulau. Sampai saat ini sudah terkumpul sedikitnya 20 Kg koin (uang logam Rp 50- Rp 1.000) dan dua pick-up kecil barang bekas dan jumlah itu terus bertambah. Semua barang itu akan diberikan ke kantor DPRD, Bupati dan DinasPUKabupatenAsahan,agar pembangunan jalan di Kec. Bandarpulau bisa dilakukan secepatnya. (a15)

Sengketa Lahan Desa Bangun Masyarakat Rawan Mandi Darah KISARAN (Waspada): Sengketa lahan antara Kelompok Petani (Koptan) Serikat Petani Indonesia (SPI) dengan warga desa Bangun Kec. Pulaurakyat, Asahan rawan bentrok bahkan mandi darah, disebabkan satu orang telah tewas dari kerusuhan itu. Sementara Polres Asahan juga melakukan antisipasinya agar tidak menambah korban jiwa. Puluhan masyarakat Desa Bangun berunjukrasa ke kantor DPRD Asahan, Bupati Dan Polres Asahan, Senin (20/2) terkait sengketa lahan itu, untuk meminta pengamanan,perlindunganserta penyelidikan terhadap tewasnya PoridinSipakkar,45,wargaDusun II,DesaBangun,disebabkandikeroyok sehingga semua pelakunya dibekuk. Tidak hanya itu, situasi mulaimemanasantaraduabelah pihak, dan dikhawatirkan akan terjadi bentrok.

“Koptan SPI di Desa Bangun sudah mulai melanggar jalur, disebabkan mereka bertindak anarkis, memotong jalan masyarakatyanginginkelahannya,serta mengancam membunuh bila tanaman mereka dirusak,” ujar Kepala Desa Bangun, Supardi, saatberaudiensidenganKapolres Asahan AKBP Yustan Alpiani. Tidakhanyaitu,lanjutSupardi, menurut pendataan, tidak sedikit orang yang datang ke Desa Bangun yang tergabung dengan nama SPI tanpa melapor dengan perangkatdesa.Sehingga,banyak pendatangtidakdiketahuidengan jelas apa maksud dan tujuannya. Sama halnya dengan kasus PoridinSipakkaryangtewasdikeroyok yang diduga berasal dari Koptan SPI, dan hingga saat ini para pembunuhnya belum diamankan semua. “Bila masalah ini tetap bertahan, maka bentrok antara SPI

dengan masyarakat akan terjadi. Oleh sebab itu kami memohon kepada Polres Asahan untuk melakukan tindakan, sehingga bisa meredakan keadaan dengan menangkap semua pelaku pengeroyokan Poridin serta memberikan rasa aman sehingga tumpah darah antara masyarakat dengan SPI dapat dihindarkan,” ujar Supardi. Sementara Kapolres Asahan AKBPYustan Alpiani, didampingi Wakapolres Kompol Budiman Bostang, Kabag Ops Kompol Faisal Napitupulu dan Kasat Reskrim AKP Fahrizal, berharap masyarakat bisa menahan diri dan tidak terpancing untuk bentrok, karena Polres Asahan dengan Pemkab Asahan telah membentuk tim untuk penyelesaian masalah tersebut. “Masyarakat diharapkan bisa tenang dan tidak terbawa emosi, sehingga polisi dan tim yang telah

dibentuk bisa bekerja, dan masalah ini bisa diselesaikan dengan baik. Disebabkan penyelesaiannya tidak semudah membalikkan telapak tangan, namun membutuhkan proses berdasarkan hukum yang berlaku,” ujar Yustan. Untukmasalahini,kataYustan, Polres Asahan bertindak netral dan tidak berpihak kemanapun, karena siapa terindikasi melakukan tindakan anarkis maka akan diprosessesuaidenganperaturan. Namun yang paling prioritas utamaadalahpengamananlokasi sengketa (Desa Bangun). Dalam hal ini sangat diperlukan bantuan masyarakat untuk berpartisipasi dalam penyidikan, sehingga bisa diketahui dengan jelas siapa yang bersalah. Setelah mendengar penjelasan, masyarakat yang ikut berunjukrasa membubarkan diri dengan tertib. (a15)

Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan:

Maulid Di Brimob Subden 3/B T. Balai

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

TANJUNGBALAI (Waspada): Sat Brimob Polda Sumut Subden 3/B KotaTanjungbalai menggelar peringatanMaulidNabiMuhammad SAW di Masjid Al-Jihad Markas Komando, Minggu (26/2). Dalamperayaanitusejumlah anak yatim-piatu dari lingkungan sekitar asrama Brimob itu menerima tali asih berupa bingkisan dari Kasubden AKP Isril Noer. Tampil sebagai penceramah AlUstadz Syahlan Sitorus, seyogyanya diisiWali KotaTanjungbalai

Pemkab L.Batu Bentuk Tim Teliti PKS Pencemar Lingkungan RANTAUPRAPAT (Waspada): Pemkab Labuhanbatu dalam waktu dekatakanmembentuktimuntukmenelitidanmelihatsecaralangsung pabrik kelapa sawit (PKS) yang terindikasi mencemari lingkungan. Demikian salah satu butir kesimpulan yang dicapai dalam rapat terbatas terkait keluhan warga DesaTeluk Sentosa dan Sungai Sentosa, Kec, Panai Hulu, terhadap limbah PKS PTPN4 Kebun Ajamu yang terindikasi mencemari lingkungan di daerah itu, di Ruang Data dan Karya Pemkab setempat,baru-baru ini. Asisten Pemerintahan Drs Karlos Siahaan yang memimpin rapat mengatakan, Pemkab L.Batu pada dasarnya dapat merasakan keluhan warga di Panai Hulu. Namun pihaknya masih menunggu hasil uji laboratorium di Medan apakah limbah cair dari PKS PTPN4 Ajamu yang dialirkan ke sungai masih dalam ambang batas atau tidak. “Kita dalam menentukan sikap dan tindakan harus jelas dasar hukumnya dan jelas pula pokok permasalahnnya agar tidak menimbulkan masalah baru dikemudian hari,” ungkap Kalos. Ditanya tentang 15 butir kesepakatan yang dicapai antara pihak PTPN4 Ajamu dengan warga DesaTeluk Sentosa dan Sungai Sentosa, Karlos berharap agar kedua belah pihak dapat melaksanakan kesepakatan itu, karena apabila salah satu saja dilanggar pasti gejolak yang selama ini terjadi akan terulang kembali. Terkait laporan masyarakat bahwa pihak PTPN4 Kebun Ajamu melakukan pembuangan limbah padat (solid) dan pembakaran janjang sawit di areal perkebunan, Karlos mengatakan, hal itu tidak diperkenankan, karena telah melanggar ketentuan yang berlaku. Hadir pada kesempatan itu antara lain Kadis BLH, Kadis Sosnakertrans, Kabag Pemerintahan, Kabag Humas, Camat Panai Hulu, Kades Teluk Sentosa, Teluk Sentosa dan Kades Perk.Ajamu.(a18/c07)

WASPADA Senin 27 Februari 2012

Lelang Di Kejari R. Prapat Dituding Rekayasa RANTAUPRAPAT(Waspada): Lelang lima unit truk di lingkungan Kejaksaan Negeri (Kejari) Rantauprapat, baru-baru ini dituding rekayasa. Pasalnya, sejumlah rekanan tidak mengetahui prosedur pendaftaran hingga tiba-tiba diumumkan pemenang truk yang sebelumnya telah disita tersebut. Selain itu, sejak dua hari lalu, sejumlah rekanan dari Medan dan berbagai daerah seperti Mardi Munthe, Aditia Tarigan, Tomi danlainnyadiaulaKejariRantauprapatmenceritakan,merekapertama menemui seorang staf dan mengatakan bahwa dirinya tidak mengetahui prosedur pendaftaran. Sementara Johannes Ginting. selaku Ketua Panitia Lelang yang juga sebagai Kasi Datun di Kejari Rantauprapat. tidak dapat ditemui. Hingga hari terakhir pendaftaran, rekanan mengambil inisiatif menghubungiYoki, petugas dari Kantor Pelayanan Kekayaan Negara dan Lelang Kisaran, selaku perantara lelang terhadap barang rampasan untuk Negara dengan mengatakan agar bersabar sebentar. Pasalnya, siang itu Kepala Kejaksaan Tinggi Sumut (Kejatisu) sedang kunjungan di kantor Kejari Rantauprapat. “Tapi tiba-tiba sebelum jam empat sore kami diberitahukan oleh pak Yoki bahwa pemenang sudah ada. Kami bingung di mana dilakukan proses lelang dan siapa pesertanya, padahal sudah dua hari kami di sini dan mengapa kami tidak diberitahukan di mana mendaftar dan penyerahan administrasi lainnya,” kesal beberapa rekanan tersebut. Sebelumnya, perwakilan dari KPKNL KisaranYoki, saat dihubungi di hari yang sama terkait keluhan rekanan yang mengaku tidak diberi waktu untuk mendaftar, mengakui bahwa proses lelang dilakukan disalahsatu ruangan Kejari Rantauprapat. “Kalau nama ruangannya saya lupa. Tapi prosesnya secara terbuka,” terangnya. (c07)

Konjen Jepang Resmikan Gedung MTs Al Washliyah 63 Punggulan MEDAN (Waspada): Konsul Jenderal (Konjen) Jepang di Medan, Yuji Hamada meresmikan proyek bantuan hibah pembangunan gedung baru MTs. Al Washliyah 63 yang berlokasi di Jl. Syekh Silau Pasar XI Desa Punggulan, Kec. Air Joman, Kab. Asahan, baru-baru ini. Peresmian ditandai dengan penandatanganan prasasti dan pengguntingan pita oleh Konjen Jepang di Medan, Yuji Hamada bersama Kementerian Agama Kab. Asahan, Zulghofur. Bantuanhibahitu,kataYujiHamadadalamsambutannya,diberikan Pemerintah Jepang melalui program Grant Assistance for Grass-roots HumanSecurityProjectyangnilainya sebesarUS$82,768(sekitarRp720 juta), dan digunakan untuk membangun satu gedung 2 lantai dengan 4 ruang teori, 1 ruang laboratorium dan 1 ruang komputer. Dia juga mengatakan bahwa program Grant Assistance ini merupakan kerja sama dari rakyat Jepang yang ditujukan langsung kepada negara tujuan proyek. Sebagai negara sahabat yang peduli denganmitranya,IndonesiabanyakmembantuJepangdalamberbagai hal, dan sebaliknya Jepang juga membantu Indonesia dalam berbagai hal termasuk salah satunya infrastruktur pendidikan. Sementara Kepsek MTs. Al Washliyah 63 Punggulan, Daman Huri Lubis mengungkapkan, sekolah itu resmi berdiri pada tahun 1984 dengan tujuan melahirkan peserta didik yang mumpuni dalam ilmu pengetahuan baik segi agama, sosial maupun eksakta. Dia mengakui pendirian sekolah itu berawal dari fasilitas ruangan bekas MIS (Madrasah Ibtidaiyah Swasta) sebagai lokal belajar dengan jumlah siswa 24 orang, MTs. Al Washliyah 63 Punggulan terus berkembang dengan siswa 307 siswa (data TA 2010/2011). Pada kesempatan itu Daman Huri Lubis mengucapkan rasa terima kasih yang sebesar-besarnya kepada Pemerintah Jepang. Mewakili Kementerian Agama Kab. Asahan, Zulghofur juga menyampaikan terima kasih yang sama kepada pemerintah dan rakyat Jepang yang membantu Indonesia, khususnya Kab. Asahan dalam hal sarana pendidikan. (m22)

Yatim-Piatu Terima Bingkisan

Thamrin Munthe yang kebetulan berhalangan hadir. Kasubden dalam sambutannya mengatakan, hikmah Maulid Nabi salah satunya ialah keyakinan untuk tetap teguh menjalankan seluruh ajaran Nabi dan meninggalkanlarangannyasesuai pesan-pesan Allah dalam Alquran. Disamping mengikuti teladan hidup nabi yang berjiwa sosial, beradab dan berbudi tanpa brutalisme dan anarkisme. “Semoga dengan peringatan

Maulid ini, kita dapat menjadikan kepemimpinan Muhammad SAW sebagai inspirasi percepatan revitalisasi Polri guna mewujudkan masyarakat aman dan tertib, disamping menjadikan kita lebih teguh belajar sejarah hidup Rasulullah,”ujarKasubdendidampingi KetuaPanitiaIpdaSofyanNasution. Sementara Wali Kota TanjungbalaiThamrinMunthediwakili Sekda H Erwin S Pane mengungkapkanapresiasinyaterhadap keberadaan Brimob yang senan-

Waspada/Rasudin Sihotang

KASUBDEN 3/B Sat Brimob Polda Sumut Kota Tanjungbalai AKP Isril Noer (tengah) Sekdakot Erwin S Pane, Ust Syahlan Sitorus (kiri) diabadikan bersama anak yatim piatu.

tiasamenciptakankeamanandan kedamaian di tengah-tengah masyarakat Kota Tanjungbalai. “Bahwa seorang muslim dengan muslim lainnya bersaudara, diikat dengan keimanan dan diarahkan kepada tujuan yang samayaitumengharapkeridhoan AllahSWT,”ujarSekda.Dikatakan, rasa kebersamaan harus senantiasadipupukuntukmenumbuhkan rasa persatuan antara umat salah satunya dengan peringatan Maulid Nabi. Sedangkan Ust Syahlan Sitorus ceramahnya mengatakan bahwa Rasulullah semasa hidupnya merupakan seorang suri tauladan di tengah masyarakat. Bahkan hingga saat ini, keteladanan Rasulullah itu tetap menjadi pedoman di setiap lini kehidupan baik dalam pergaulan, kepemimpinan, sosial maupun keamanan. “Jadilah contoh yang baik di masyarakat yang senantiasa mengharap ridho Allah agar selamat dunia dan akhirat,” ungkap penceramah. Turut hadir acara Kapolsek SeitualangRasoAKPRuslanLubis, Danramil 08 Pulaubuaya Kapt Inf Ruslan, Camat Seitualang Raso Nurmalia, tokoh agama, tokoh masyarakat, dan seluruh jajaran Subden 3/B Sat Brimob Polda Sumut Kota Tanjungbalai. (a32)

Waspada/Rasudin Sihotang

KAPOLRES Tanjungbalai AKBP EP Sirait menyematkan tanda jabatan Kasat Narkoba yang baru AKP Nopiardi dalam upacara Sertijab.

Jangan Jadi Pengkhianat Komando TANJUNGBALAI (Waspada): Kapolres Tanjungbalai AKBP EP Sirait mengucapkan selamat bergabung kepada Kasat Narkoba yang baru dan mengingatkan agar jangan jadi pengkhianat komando. “Selamat datang di Polres Tanjungbalai, kenali lingkungan serta bawahan anda, bertugaslah dengan baik dan jangan sekali-kali jadi pengkhianat,” ujar Kapolres dalam amanatnya kepada Kasat Narkoba AKP Nopiardi pada upacara serah terima jabatan di Aula Mapolres, baru-baru ini. Mantan Kasat Narkoba Polres Sergai dan Dairi itu menggantikan posisi AKP D Pinem yang pindah tugas menjadi Pama di Dit Narkoba Poldasu. Dalam kesempatan itu pula, Kapolres mengingatkan agar Nopiardi tidak menunda dan segera menyelesaikan kasus-kasus yang sedang berjalan dan jangan dibiarkan mengendap. Sementara kepada Kasat Narkoba yang lama, Kapolres berpesan agar menjadikan kinerjanya selama 1,5 tahun di Polres Tanjungbalai menjadi pengalaman berharga dan motivasi menuju lebih baik lagi. Kapolres juga mengucapkan terima kasih atas pengabdiannya dan memintaagartetapmenjalinkomunikasidengannya.“Kalaubisa,jangan gantinomorHP,dankalaupunharusditukar,hendaknyasayadiberitahu agar hubungan tetap terjalin,” imbuh Kapolres. (a32)

Sumatera Utara

WASPADA Senin 27 Februari 2012


Wabup: Ganja Di Madina Harus Dinolkan Tahun Ini PANYABUNGAN (Waspada): Peredaran dan penanaman ganja di Kab. Mandailing Natal (Madina) di tahun 2012 ini harus dituntaskan dan dinolkan untuk menyelamatkan generasi muda Madina khususnya, dan Indonesia bahkan dunia umumnya. “Karena, ganja asal Madina saat ini sudah cukup dikenal di pasaran. Jika tidak cepat diberantas dikhawatirkan berkembang lebih luas tidak saja lingkup kecamatan, melainkan merembet ke kecamatan dan daerah lain di luar Madina,” ujar Bupati Madina, Hidayat Batubara melalui Wakil Bupati Madina, Drs. H. Dahlan Hasan Nasution kepada Waspada, Jumat (24/2) di ruang kerjanya didampingi Kabag Humas, Haposan, dan Kasubbag, Sarman Nasution. Komitmen pembasmian ganja di Madina dijelaskan wakil bupati setelah sebelumnya ia dan Badan Narkotika Kabupaten,

camat, tokoh masyarakat, dan Kepala Desa Hutatua Pardomuan, Hutabangun, Aek Nabara, dan Banjar Lancat, melakukan studi banding ke Chiangrai, Thailand 12 Februari lalu didampingi BNN. Kawasan Chiangrai tepatnya daerah Doitung di Thailand, dulunya merupakan kawasan penghasil ganja dan opium terkenal di dunia, yang dikelola seorang jenderal pelarian bernama Jenderal Kunsai dengan 40 ribu pasukan elit. Saat itu, kondisi masyarakat melarat, pemukimankumuhdan memprihatinkan, bahkan masyarakat kaum wanita terpaksa

Lanjutkan Pembangunan Jalan Menuju Galanggang BARTENG (Waspada): Warga di wilayah Desa Parannapa Jae dan Galanggang Kec. Barumun Tengah (Barteng) Kab. Palas meminta pembangunan jalan ke daerah itu berlanjut, karena saat ini 2,5 km masih jalan tanah dan sulit dilalui, apalagi di saat musim hujan. Tongku Siregar pejabat pemerintahan Desa Parannapa Jae kepada wartawan, Jumat (24/2), menjelaskan, akibat kondisi jalan tanah 2,5 km sangat sulit dilalui di musim hujan, baik kendaraan roda dua maupun roda empat. Kondisi ini sering membuat hasil pertanian warga rusak karena sulitnya transportasi. Karenaitu,wargasangatberharapagarPemkabPalasmembangun akses jalan ke daerah itu, baik melalui dana PNPM maupun APBD. Apalagi jalan tersebut merupakan sarana sangat vital, yang dilalui warga dari banyak desa menuju Pasar Binanga, termasuk Desa Silenjeng, Gading, dan Galanggang serta beberapa desa lainnya. Apalagisumberdayaalam,hasilpertaniandaridaerahitutergolong besar, termasuk hasil komoditi pertanian berupa padi, sawit, karet dan lainnya. Dan diperkirakan luas areal perkebunan rakyat di wilayah itu mencapai ratusan hektar. Warga berharap agar pada APBDTA 2012 ini, pembangunan jalan tersebut masuk dalam anggaran, apalagi Bupati Palas selama ini sangat antusias membangun daerah melalui sektor pedesaan. (a33)

Warga Bekuk Jambret Gaya Baru P. SIDIMPUAN (Waspada): Seorang diduga kawanan jambret gaya baru yang sudah masuk dalam Daftar Pencarian Orang (DPO), APK, 30, warga Kel. Ujung Padang, Kota Padangsidimpuan, dibekuk warga saat menjalankan aksinya, kemudian diserahkan ke Satuan Reskrim Polresta Padangsidimpuan, kemarin. DPO tertangkap setelah komplotan perampok modus baru tersebut melakukan aksinya terhadap Sofia Anni br Harahap, warga Kelurahan Padang Matinggi, Kec, Padangsidimpuan Selatan, Kota Padangsidimpuan belum lama ini. Demikian disampaikan Sofia Anni br Harahap didampingi suaminya Muharis dikediamannya, Kelurahan Padangmatinggi, Minggu (20/2). Kata Anni, saat itu, dia sedang dalam perjalanan dari pasar hendak pulang menuju ke rumahnya. Namun ketika memasuki pintu gerbang perumahan tersebut, korban dipepet dan kalung emas miliknya dirampas oleh dua orang yang berboncengan dengan mengendarai sepedamotor merk Honda Beat. Seingatnya, para pelaku tampaknya masih muda dan diperkirakan masihdudukdibangkuSMA.Tapianehnya,sesaatsetelahaksipenjambretan terjadi, datang tiga orang dari belakang dengan mengendarai sepedamotor tanpa nomor polisis (nopol) yang merk dan jenisnya sama. Mereka langsung memalangkan sepedamotornya didepan saya dan bertanya, “Ada apa Kak, ada apa Kak ?” papar korban menirukan ucapan tiga orang tersebut. Saat itu juga korban merasa kebingungan, padahal menurut korban yang menyapanya itu mengetahui kejadian tersebut, namun mereka tidak menolongnya untuk mengejar palakunya dan malah bertanya seakan-akan tindakannya itu mengalihkan perhatian saya kepada para pelaku tadi, sebut korban. Ada beberapa warga yang melihat kejadian tersebut dan langsung mengejar para pelaku, namun pelaku tidak berhasil ditangkap dan wargapun pulang sembari melihat APK bersama seorang temannya yang saat itu berada di Tempat Kejadian Perkara (TKP) dan bertanya kepada korban. Namun APK bersama temannya tidak ikut mengejar pelaku melainkan berbelok arah, sehingga timbul kecurigaan warga, APK dan temannya adalah komplotan pelaku perampokan tersebut. Kemudian warga menggiringnya ke TKP, namun setibanya di TKP salah seorang teman APK melarikan diri sehingga memperkuat kecurigaan warga bahwa APK dan teman-temannya itu komplotan dari aksi penjambretan tersebut. Dan akhirnya APK diamankan warga bersama korban kemudian diserahkan ke Polresta Padangsidimpuan untuk dimintai keterangannya, papar korban. Kapolresta Padangsidimpuan, AKBP Andi S Taufiq melalui Kasat Reskrim AKP Anjas Asmara Siregar dikonfirmasi Waspada mengatakan, APK diproses dalam kasus yang lain dengan modus yang sama, Rabu (22/2) petang. Menurut Kasatreskrim, APK seorang yang masuk dalam Daftar Pencarian Orang (DPO) Polresta Padangsidimpuan sejak Agustus 2011 yang lalu dengan kasus perampokan bersama seorang temannya. Sedangkan temannya itu sudah divonis pengadilan negeri Padangsidimpuan dan menjalani hukuman. (c13)

melacurkan diri demi menutupi kebutuhan. Melalui titah Ibunda Ratu Kerajaan Thailand saat itu, kawasan Chiangrai dan Doitung dikuasai dengan kekuatan militer dan Jenderal Kunsai berhasil ditangkap 2003. Dijelaskan, sejak 2003, kawasan ganja seukuran provinsi ditatakembali.Matapencaharian masyarakat diarahkan ke pertanian, dan kawasan itu diubah menjadi objek wisata. Hanya dalam jangka sembilan tahun, kawasan Chiangrai yang dulunya basis ganja,kinimenjadikawasanmakmur dan salah satu objek wisata bunga terkenal, salah satunya bernama bunga Rosella. Bunga Rosella merupakan bahan obat untuk semua penyakit. Chiangrai kini hadir dengan wajahbaruberubahjadipenghasil tanaman holtikultura dan objek wisata dengan masyarakat makmur dan kawasan pemukiman

gedung setelah dilakukan penataan pemerintah. Salah satu faktor pendukung adalah peningkatan infrasruktur jalan, sehingga rancangan pembangunan dan promosi kawasan itu menjadi lebih mudah baik itu untukpendatang,maupununtuk pemasaran hasil tanaman holtitulkura. Mengingat Chiangrai memiliki iklim dan aspek sosial yang memilikipersamaandenganMadina khususnya wilayah Kec. PanyabunganTimur, maka pembasmian ganja di Panyabungan Timur dimulai dari pencabutan tanaman ganja, pembangunan infrastruktur jalan, dan memberikan mata pencaharian yang baru bagi masyarakat setempat. Rencananya,usahamasyarakat akan dimodali, diawasi dalam pemeliharaan, serta pemasaran pun dibantu berdasarkan harga pasaran. Intinya, modal masyarakat hanya kemauan. Setelah itu

digalakkanpengembanganobjek wisata sekaligus mendirikan gedung wisata rohani Islam. Dijelaskan Dahlan Hasan, Madinaakanmenjadipilotprojek pembasmian ganja yang penanganannya secara multi lintas sektoral. Artinya, tidak hanya tanggungjawab daerah tapi melibatkan provinsi dan pusat. “Kalau memang diperlukan, kita akan melakukan shock therapy dahulu, setelahitubarukitabenahidaerah itudengankasihsayang.Kitaingin ganjahapusdariMadinayangdikenal kotasantridanSerambiMakkahnya Sumatera Utara,” ucap Dahlan. Dahlanoptimispembasmian ganja di Madina akan berhasil karena BNN sudah pernah turun operasi langsung ke lokasi di Tor Sihite, Kec. Panyabungan Timur. Dengan begitu, BNN diyakini memiliki perhatian serius dalam penanganan ganja di Madina, termasuk strategi pembasmian tanaman ganja. (c14)

28-29 Februari Muswil PP Sumut Di P. Sidimpuan P. SIDIMPUAN (Waspada): Musyawarah Wilayah (Muswil) Pemuda Pancasila (PP) Sumatera Utara di auditorium Sekolah Tinggi Agama Islam Negeri (STAIN)Padangsidimpuandigelar Selasa-Rabu (28-29/2). “Persiapan kita sudah mencapai 90 persen,” kata Penanggungjawab Panitia Lokal Muswil PPSumutjugaKetuaMPCPPKota Padangsidimpuan, Fadhriansyah Siregar alias Ucok Kodok, didampingi Ketua dan Sekretaris Panitia Lokal, Erwin Daulay dan Dedi Paisal Hasibuan, Sabtu (25/2). Muswil akan diikuti ribuan kaderPPseSumutiniakandibuka langsung Ketua Umum MPN PP, Japto Sulistyo Suryosumarno. Adapun suara yang diperebutkan kandidatcalonketuapadaMuswil nanti, 31 suara MPC, 1 MPW, dan 1 MPN. Disebutkannya,Muswilnanti akan dirangkai pelantikan pengurus sekaligus peletakan batu pertama kantor MPC PP Padangsidimpuan seluas 14 x 20 meter berbiaya Rp1,2 miliar di Jalan Sidimpuan By Pass. “Tahun ini MPCPPPadangsidimpuansudah memiliki kantor sekretariat di atas tanah seluas 15 x 25 meter, yang merupakan hibah putera daerah yang sukses di Jakarta dan peduli pembangunan tanah kelahirannya,SyarifuddinHarahap,”katanya.

Minta Doa Untukkesuksesanpelaksanaan Muswil PP Sumut ini, kata Fadhriansyah, panitia lokal tidak lupamenggelarberbagaikegiatan sosial keagamaan. Seperti pengajian akbar dan peringatan Maulid Nabi Muhmaad SAW di halaman Masjid Agung Al-Abror Padangsidimpuan, Sabtu (25/5) pagi. Pada kesempatan itu juga dilakukan penyerahan 150 kitab suci Alquran kepada sejumlah masjiddiKotaPadangsidimpuan. “Tidak lupa kita meminta kepada seluruh hadirin yang hadir untuk sama-sama mendoakan suksesnya Muswil PP Sumut ini,” ujar Ucok Kodok. Sekretaris Panitia Lokal MuswilPPSumutDediPaisalmenambahkan, seluruh keluarga besar PPPadangsidimpuanyangmenghadiri acara itu larut dalam doa bersamayangdipimpinAlUstadz RidwanHasibuan.Merekasangat terharu,khususnyamelihatkekhusukananggotamajelistaklimmendoakan suksesnya Muswil ini. “Dari situ kita bisa melihat besarnya harapan dan keinginan anggota majelis taklim dan jamaah yang hadir kepada PP untuk bersama-sama melakukan perubahanterbaikbagidaerahtercinta ini,” sebut Dedi. Dukung Aweng Ketika Fadhriansyah ditanya-

kankemanaarahdukunganMPC PP Kota Padangsidimpuan pada Muswil ini, dengan tegas dinyatakan memilih Anuar Shah alias Aweng sudah merupakan harga mati bagi MPC PP Kota Padangsidimpuan. “Pilihan untuk Aweng sudah harga mati dan tidak dapat ditawar-tawar lagi. PP Sumut di bawah pimpinan Aweng benarbenar sangat maju, dan kita semua bisa melihat itu,” ujarnya sembari menegaskan 16 dari 31 MPC PP se Sumut sudah menyatakan kebulatan tekad mendukung Aweng. Andar Isnan Pada kesempatan itu Fadhriansyah menambahkan, di Pemilukada Kota Padangsidimpuan tahun ini, seluruh kader dan keluarga MPC PP Kota Padangsidimpuanakanmendukung dan memenangkan pasangan bakal calonWali Kota/WakilWali kota, Andar Amin Harahap/Mhd Isnandar Nasution. “Dukungankepadapasangan bakal calon ini juga sudah harga mati bagi PP. Karena Andar merupakanBendaharaMPCPPPadangsidimpuan dan Isnandar anggota MPO kita,” tegasnya sembari menyebut MPW PP Sumut juga sudah menginstruksikan itu kepada seluruh kader dan keluarga PP di daerah itu. (a27)

dibilang sangat rendah. Karena tanpa budaya kerja keras ini berbagai persoalan akan sulit diselesaikan. Misalnya bagaimana persoalanmendesakuntukmembangun Madina bisa tercapai. Memang benar, kalau kita lihat secara kasat mata, pembangunan di wilayah Kab. Mandailing Natal sangat maju. Seperti perkantoran Bukit Payaloting yang tertata dengan mempesona, Masjid Agung Nur Alan Nur, dan juga ditopang sarana prasarana ekonomi dengan tersedianya 30 pasar, terdiri dari satu unit pasar kelas I di Panyabungan satu unit pasar kelas II di Kotanopan dan 28 unit pasar kelasIIItersebarpada23kecamatan. Namun di sisi lain, masih banyak warga Madina yang menjerit karena keterbatasan sarana prasanana. Untuk menghadapi tantangan ini tentu kita harus benar-benar menciptakan budaya kerja keras. Karena tanpa semangat kerja keras dan persatuan berbagai persoalan ini akan sulit tertangani. Jika budaya kerja keras ini tidak ditingkatkan, yakinlah tingkat produktivitas warga akan rendah dan sulit ber-

Amri Tambunan Lantik Lima Pengurus IKAPTK Se-Tabagsel P. SIDIMPUAN (Waspada): Ketua DPP Ikatan Alumni Perguruan Tinggi Kepamongan (IKAPTK) Sumatera Utara juga Bupati Kab. Deliserdang, AmriTambunan, melantik lima pengurus daerah IKAPTK se Tapanuli Bagian Selatan (Tabagsel) periode 2011-2016 di Asrama Haji PemkabTapsel, belum lama ini. Pengurus yang dilantik, DPD IKAPTK Kab. Tapanuli Selatan dengan Ketua Rahmat Effendi Hasibuan, Sekretaris Hamdy S Pulungan, dan Bendahara Tiorisma Damayanti. IKAPTK Mandailing Natal, H. Sahnan Pasaribu (Ketua), Budiman Nasution (Sekretaris) dan Ejer Nasution (Bendahara). IKAPTK Padangsidimpuan, H. Maramuda Nasution (Ketua), AR Marjoni (Sekretaris), Sofyan Arifin Hasibuan (Bendahara). IKAPTK Padanglawas, Nukman Harahap (Ketua), Gunungtua Hamonangan Daulay (Sekretaris), dan Ronny Saiful Lubis (Bendahara). IKAPTK Padangalawas Utara, Syarifuddin Harahap (Ketua), M Ali Hasibuan (Sekretaris), dan Andar Amin Harahap (Bendahara). Pelantikanditandaidenganacarapengukuhan oleh Bupati Tapsel, Syahrul M Pasaribu, sebagai yang mewakili lima kepala daerah se Tabagsel. Kemudian penyerahan bendera pataka sebagai pemersatu dan pengabdian masyarakat oleh Amri Tambunan kepada Ketua DPD IKAPTK yang dilantik. Juga dilakukan penyematan pin simbol penghormatan kepada alumni purna tugas atau yang sudah memasuki masa pensiun, Dahlan Hasan, M Idris, Amru Rangkuti, Azis Fahri, Syarifuddin Siregar, dan Harman Harahap.

Amri Tambunan dalam sambutannya mengaku sangat senangnya melihat keakraban yang terbina sesama anggota IKAPTK dan rasa salut atas dukungan yang diberikan kepala daerah se Tabagsel kepada para alumni perguruan tinggi kepamongan seperti APDN, STPDN, dan IPDN. Organisasi ini merupakan perkumpulan para pamong praja sejati, dan wadah alumni untuk membina silaturahmi. Organisasi ini juga menjadi kawah candradimuka bagi meningkatkan profesionalisme dengan cara diskusi, tempat bertukar pikiran dan pengalaman. “Jangan ragu menerapkan semua ilmu yang diperoleh untuk menjawab semua tantangan dan permasalahan yang ada. Seluruh masalah negara pasti dapat diselesaikan dengan kebersamaan,” katanya. Bupati Tapsel, Syahrul M. Pasaribu, mewakili kepala daerah seTabagsel berharap IKAPTK dapat mempercepat akselarasi pembangunan.“Alumni perguruan tinggi kepamongan merupakan aset yang sangat berguna bagi daerah. Di Tapsel hampir 95 persen anggota IKAPTK menduduki jabatan eselon,” katanya. Sedangkan Ketua IKAPTK Tapsel, Rustam Efendi Hasibuan, menyebut alumni PTK memiliki loyalitas tinggi bagi pemerintahan. Dia berterimakasih kepada Bupati Tapsel karena telah memberikan gedung eks Presiden Teater sebagai kantor Sekretariat IKAPTK. TuruthadirSekretarisDPPIKAPTKSumutjuga AsistenIIIPemprovsu,HAsrinNaim.Alumnisenior seperti Arsyad Lubis dan Dahlan Hasan Nasution, ratusan anggota IKAPTK dan undangan. (a27/a06)

Jembatan Tangsi Baru Anjlok Diterjang Banjir TAPANULI SELATAN (Waspada): Jembatan Jalan Lintas Pantai Barat Sumut Desa Tangsi Baru Kec. Angkola Sangkunur Kab. Tapanuli Selatan (Tapsel)anjlokditerjangbanjir,sehinggahubungan daratdarisimpangJalanNegaraJembatanDwikora Batangtoru ke Desa Rianiate sekitarnya terus ke Natal, putus total. Informasi dihimpun Waspada, Minggu (26/ 2), ketika hujan deras mengguyur Kamis kemarin sekira pukul 13:00, tiba-tiba datang air bah, sehingga membuat sisi jembatan terbawa arus. Akibatnya, segala jenis kendaraan tidak bisa lewat. Putusnya hubungan kedua daerah, otomatis menyulitkan masyarakat. Angkutan kebutuhan pokok ke kampung tidak bisa diangkat, sebaliknya produksi pertanian masyarakat belum bisa terjual, sehinga sementara ditumpuk di desa. Namun begitu mendapat informasi tentang terjadinya musibah tersebut, pihak PU Bina Marga Sumut turun ke lokasi memperbaikinya, namun karenaperalatankurang,terpaksakordinasidengan

PTPN 3 Distrik Tapsel di Batangtoru. Saat ini PU Bina Marga bersama PTPN 3 dibantu Koramil 19Siaissedanggiatmengadakanperbaikan,namun baru bersifat penanggulangan sementara, berbentuk bangunan darurat, terbuat dari pohon kelapa dengan target harus dapat dilalui. Pelda Manap yang ditemui di lokasi mengatakan,targetnyajembatandapatdilewatirodaempat, sehingga angkutan kebutuhan pokok masyarakat tidak terhalang, sebaliknya pemasaran hasil bumi mereka juga lancar. “Kasihan kita jika jembatan tidak berfungsi, setiap bahan yang keluar masuk akan dipundak, akhirnya menambah biaya. Harga jual produksi mereka menurun, sebaliknya pembelian kebutuhan pokok naik,” katanya. Selain itu jembatan Aek Baung juga di jalur lintas pantai barat dekat Desa Rianiate kecamatan yang sama, turut hanyut, namun karena sungai dangkal, tetap dapat dilalui kendaraan roda empat, sehingga tidak terlalu berpengaruhi kepada ekonomi masyarakat. (a26)

Peredaran Ganja Marak Di Lingga Bayu

Waspada/Sukri Falah Harahap

FUNGSIONARIS MPC dan MPO PP Kota Padangsidimpuan secara simbolis menyerahkan 150 Alquran kepada Kakan Kemenag, Efri Hamdan Harahap, untuk dibagikan ke sejumlah masjid. Berbagai kegiatan sosial keagamaan mereka lakukan menjelang Muswil PP Sumut di Padangsidimpuan.

Etos Kerja Madina Yang Madani KABUPATEN Mandailing Natalyangdimekarkanberdasarkan Undang Undang Nomor 12 tahun 1998, secara formal diresmikan oleh Mendagri 9 Maret 1999. Menjelang Hari Ulang Tahun ke-13 Kab. Mandailing Natal (Madina) perlu kiranya kita perkokoh persatuan dan kesatuan serta budaya bekerja keras demi tercapainya Madina yang madani. Mendukungsikapbudaya bekerja keras untuk percepatan pembangunan di wilayah Kab. Madina yang terletak pada0°10'-1°50'LintangUtara dan 98°10'-100°10' Bujur Timur dengan rentang ketinggian 0-2.145 m di atas permukaanlautdanmempunyailuas wilayah±6.620,70km2atau9,23 persen dari wilayah Sumatera Utara, sangatlah dibutuhkan. Hal ini untuk mengatasi persoalan-persoalan yang mendesak, dan sekaligus strategis untuk menumbuhkan etos kerja yang lebih baik, karena sudah tiga belas tahun usia Kab. Mandailing Natal budaya kerja keras ini boleh

Waspada/Sukri Falah Harahap

KETUA DPP IKAPTK Sumut, Amri Tambunan, menyerahkan bendera pataka kepada Ketua IKAPTK Tapsel, Rustam Efendi Hasibuan.

saing dengan daerah lain, lebihlebih di era globalisasi sekarang ini. Dengan segala harapan dan impian keinginan perbaikan dan perubahanKab.MandailingNatal tidak akan membawa hasil jika tidak dibarengi dengan budaya kerja keras dalam meniti masa depan yang cerah. Budaya kerja keras ini harus kita programkan bersama baik ia pemerintah dan masyarakat. Meski demikian, kiranya penting juga Bupati Madina di bawah pimpinan Hidayat Batubara, SE dan Wakil Bupati Bapak Drs. Dahlan Hasan Nasution memperlihatkan kepemimpinan yang baik sekaligus keteladanan. Karena dalam situasi seperti ini masih banyak permasalahan yang perlu ditata dengan baik demi tercapainya Madina yang madani. Dan juga para pejabat dilingkunganPemkabMandailing Natal perlu memperlihatkan kemampuan merumuskan kebijakanpublikyangsebesar-besarnya untuk kepentingan rakyat Kab. Mandailing Natal khususnya. Wibawa, martabat, dan kredibilitas kepemimpinan akan

terbangun apabila kita mampu memperlihatkan kepedulian terhadap aspirasi, keinginan, dan kebutuhan seluruh lapisan masyarakat, tanpa pengecualian. Jauh lebih penting lagi, sikap keteladanan seorang pejabat dan pemimpin, yang memang sangat diperlukan dalam kehidupan masyarakat kita yang bersifat paternalistik.Tanpa keteladanan, kredibilitas seorang pemimpin akan ambruk. Harapan dan kesempatan kini diberikan kepada pemerintahan baru, tentu dengan dukungan kita semua. Kinerja para SKPD baru diharapkan akan menjadi lokomotif untuk meningkatkan budaya kerja keras, mental kejujuran, bersih, dan tidak korupsi. Sembari mengayun langkah majudanmenataptajamkemasa depan, kita juga perlu menjaga dan mengembangkan pembangunan yang sudah ada. Tiga belas tahun usia Kab. Mandailing Natal sebagian pembangunannya sudah tertata dengan baik. Yakin dan percayalah, kalau kitabergandengtangandanmembudayakan kerja keras pem-

bangunan akan terus berkelanjutan.Tampilnya pemerintahan baru tentu saja menghadirkan harapan baru, yang dalam perspektif tertentu bisa menjadi beban. Namun, sejauh ekspektasi dapat dikelola justru membangun optimisme, dan membuat mata tidak pernah terpejam menyoroti jauh ke masa depan. Jauh lebih penting lagi bagaimana segala harapan itu ditransformasikandandiuraikankedalam program dan tindakan nyata. Kiranya sudah saatnya Bupati Madina menekankan pentingnyabudayakerjakeras. Para pejabat dan masyarakat perlu kerja keras. Tidak kalah pentingnya menumbuhkan kesabaran karena perubahan memerlukan proses dan waktu. Perbaikan tidak dapat dicapai ibarat membalik telapak tangan dan sim salabim, tapi butuh kerja keras. Di usia Kab.MandailingNatalke-13ini hanyasepenggalharapanyang terucap,Semogatahuninilebih baik dari tahun kemarin. * M.Alpin Lubis

PANYABUNGAN (Waspada): Peredaran narkoba jenis ganja diduga marak di Kec. Lingga Bayu, Kab. Mandailing Natal (Madina). Untuk itu Polres Madina dan BNK diminta serius melakukan pembasmian secara intensif di kecamatan tersebut. Demikian di sampaikan Ketua Fraksi Demokrat DPRD Madina, Ir.Ali Mutiara Rangkuty kepada Waspada, Minggu (26/2) via seluler. Dijelaskannya, berdasarkan informasi dari hatobangon dan tokoh masyarakat Kec. Lingga Bayu, sejumlah anak sekolah dan pemuda pengangguran diduga kuat terlibat sebagai pecandu dan pengisap ganja. Lokasi yang di nilai rawan ganja di kawasan itu antara lain, di Desa Sikumbu, Desa Lancat, Desa Pulo Padang, Desa Tapus, dan Desa

Parbatasan. Menurut Ali, jika kondisi ini di biarkan akansangatmemprihatinkan,danancamanserius dalam perkembangan generasi muda. Untuk itu kata Ali Mutiara, putra Simpang Gambir ini, masyarakat Lingga Bayu sangat berharap pihak Polres Madina dan BNK bisa membantu masyarakat dalam mengungkap dan menangkap siapa pengedar dan sumber barang ganja tersebut bisa beredar luas di Kecamatan Lingga Bayu. Selain masalah ganja, Ali Mutiara juga menyoroti tetap maraknya truk jenis tronton yang masih merajalela lewat di jalan provinsi jurusan Jembatan Merah – Simpang Gambir. Padahal, kehadiran truk tronton tersebut sudah pernah diprotes masyarakat Lingga Bayu dengan cara memblokir jalan. (c14)

Jelang Musda, Kantor AMPI Paluta Dirusak GUNUNGTUA (Waspada): Kantor Angkatan Muda Pembaharuan Indonesia (AMPI) Kab. Padanglawas Utara (Paluta) yang terletak di Jalan Sisingamangaraja, Lingkungan Satu, Kelurahan Pasar Gunungtua, Kec. Padangbolak, dirusak dan diobrak abrik, Kamis (23/2) kemarin, sekitar pukul 12:45 Staf administrasi di Kantor AMPI Paluta, Junita Dewi, 24, ditemui Waspada usaikejadian,membenarkanadasejumlahKetuaRayonAMPIdanSatgas datang ke Kantor AMPI sekira pukul 12:45 dengan niat bertemu dengan panitia Musda AMPI. Awalnya, sambung Junita, niat mereka yang datang itu baik, mereka duduk dan bercerita di kantorAMPI,namunhanyadalamhitunganmenit setelah disuguhkan minuman, puluhan kursi yang ada di ruang rapat tiba-tiba dilemparkan dan diobrak-abrik oleh mereka yang emosi, dan langsung pergi meninggalkan kantor ini. “Saya tidak tahu apa penyebabnya mereka perbuat seperti itu, saya hanya sebagai staf di sini dan bertugas memberikan mereka minuman. Entah kenapa mereka langsung memecahkan dan mengobrak-abrik seluruh isi ruangan. Kursi dirusak, meja rapat dibanting dan pintu dilempar,” ujar Junita dengan wajah masih ketakutan kepada Waspada. Ketua AMPI Paluta, Amas Muda Siregar, SE, begitu menerima informasi langsung turun ke kantor AMPI bersama Ketua MKGR, Ir. Tua Rohot

Siregar, lalu mereka memberitahukan kepada Kapolsek Padangbolak AKP JW Sijabat untuk dilakukan olah TKP. Selang beberapa menit, Kapolsek Padang Bolak AKP JW Sijabat bersama jajarannya melakukan olah TKP di Kantor AMPI Paluta. Akibat insiden ini, kerugian diperkirakan mencapaipuluhanjutarupiah.SelainkantorAMPI Paluta, peralatan kantor DPD Golkar Paluta yang dekat dengan lokasi kejadian itu pun turut dirusak. Ketua AMPI Paluta, Amas Muda Siregar, SE didampingi Ketua MKGR, Ir. Tua Rohot Siregar sangat menyayangkan peristiwa tindak kekerasan tersebut dan mengutuk dengan keras tindakan kelompok yang telah melakukan penyerangan dan pengrusakan kantor AMPI ini. Selain itu, keduanya juga mendesak pihak berwajib untuk segera mengusut tuntas pelaku penyerangan dan pengrusakan kantor AMPI tersebut. “Apa yang dilakukan mereka itu sama sekali tidak etis dan boleh dikata tidak bermoral. Apalagi yang diserang adalah kantor AMPI. Oleh karenanya, kami meminta pihak kepolisian harus mengusutpelakupenyeranganitu,”harapmereka. Kapolres Tapsel, AKBP Subandriya, SH dikonfirmasi melalui Kapolsek, AKP JW Sijabat, berjanji akan mengusut tuntas para pelaku pengrusakan Kantor AMPI tersebut. “Siapa pun pelakunya, pasti kita selidiki,” ungkap Kapolsek. (a35)

Sumatera Utara

B8 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:40 12:53 12:41 12:48 12:47 12:44 12:41 12:36 12:43 12:43

‘Ashar 15:57 16:11 15:57 16:06 16:05 15:59 15:57 15:53 16:00 16:00

Magrib 18:42 18:54 18:42 18:49 18:48 18:47 18:43 18:38 18:45 18:44



Shubuh Syuruq


19:51 20:03 19:51 19:57 19:57 19:56 19:51 19:47 19:54 19:53

05:11 05:25 05:12 05:19 04:19 05:14 05:11 05:07 05:14 04:14

05:21 05:35 05:22 05:29 05:29 05:24 05:21 05:17 05:24 05:24

L.Seumawe 12:46 L. Pakam 12:39 Sei Rampah12:38 Meulaboh 12:50 P.Sidimpuan12:37 P. Siantar 12:38 Balige 12:38 R. Prapat 12:35 Sabang 12:53 Pandan 12:39

06:36 06:50 06:36 06:44 06:44 06:39 06:36 06:32 06:39 06:39

Zhuhur ‘Ashar 16:04 15:56 15:55 16:07 15:53 15:55 15:54 15:51 16:11 15:55

WASPADA Senin 27 Februari 2012




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:47 18:41 18:40 18:51 18:41 18:40 18:41 18:38 18:53 18:42

19:56 19:50 19:49 20:00 19:49 19:49 19:50 19:47 20:02 19:51

05:18 05:10 05:09 05:21 05:07 05:09 05:09 05:05 05:25 05:09

05:28 05:20 05:19 05:31 05:17 05:19 05:19 05:15 05:35 05:19

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:39 12:41 12:51 12:43 12:40 12:47 12:35 12:46 12:39 12:38

18:42 18:43 18:51 18:46 18:42 18:48 18:38 18:48 18:42 18:40

19:51 19:52 20:00 19:55 19:51 19:57 19:46 19:57 19:50 19:49

05:09 05:11 05:22 05:14 05:11 05:19 05:06 05:17 05:09 05:09

05:19 05:21 05:32 05:24 05:21 05:29 05:16 05:27 05:19 05:19

Panyabungan 12:36 Teluk Dalam12:43 Salak 12:41 Limapuluh 12:37 Parapat 12:39 GunungTua 12:36 Sibuhuan 12:36 Lhoksukon 12:45 D.Sanggul 12:39 Kotapinang 12:34 AekKanopan 12:36

06:43 06:35 06:34 06:46 06:32 06:34 06:33 06:30 06:50 06:34

15:55 15:57 16:09 15:59 15:57 16:05 15:52 16:02 15:54 15:55

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:34 06:36 06:47 06:38 06:36 06:43 06:31 06:41 06:34 06:34

Zhuhur ‘Ashar 15:51 15:57 15:57 15:53 15:55 15:51 15:50 16:03 15:55 15:50 15:52




Shubuh Syuruq

18:40 18:47 18:44 18:39 18:41 18:39 18:39 18:46 18:42 18:37 18:38

19:48 19:56 19:52 19:48 19:50 19:48 19:48 19:55 19:51 19:46 19:47

05:06 05:12 05:12 05:08 05:09 05:06 05:05 05:17 05:10 05:04 05:06

05:16 05:22 05:22 05:18 05:19 05:16 05:15 05:27 05:20 05:14 05:16

06:30 06:37 06:36 06:32 06:34 06:31 06:30 06:42 06:35 06:29 06:31

Rampok Modus Penggembosan Ban Mobil Kembali Beraksi Ratusan Juta Lenyap TEBINGTINGGI (Waspada): Pelaku perampokan dengan modus penggembosan ban mobil kembali terjadi. Pelakunya sudah ada tertangkap beberapa bulan lalu. Kali ini yang menjadi korban seorang pengusaha asal Desa Sungai Langge, Kab. Simalungun. Ia kehilangan uang ratusan juta rupiah dari dalam mobilnya sepulang mengambil uang dari bank. Peristiwa tersebut dilaporkan korban Ihkwanuddin Nasution, 40, ke Polres Tebingtinggi, Jumat (24/2)siang.Didampingisopirnya, korban yang sehari-harinya membuka usaha jual beli mobil di kediamannya menuturkan, peristiwa itu berawal saat ia berangkat dari ke Silau Dunia, Kab. Sergai, Kamis (23/2) pagi, denganmengendaraimobilInova B 1363 KKF bersama sopirnya. Sampai di Silau Dunia, Kab. Sergai, mereka bertemu dengan orang yang hendak menjual truk denganperantaraanseorangagen. Saat itu terjadi tawar menawar harga,namuntidaktercapaikesepakatan. “Karena pajak kendaraannya mati, saya menawarkan harga jual truk itu sebesar Rp115 juta, sedangkan pemilik minta Rp120juta,karenatidakadakecocokan harga saya pun kembali pulang,” ucap Ihkwan. Ditengahperjalananmenuju pulang, persisnya di KotaTebingtinggi, Ihkwan dihubungi pemilik mobil dan mengatakan setuju dengan harga tawarannya. Saat

itu juga ia pergi ke Bank BCA Jalan Jenderal Sudirman Kota Tebingtinggi untuk mengambil uang. Dengan kantungan plastik berisi uang Rp130 juta, korban membawa uang itu ke dalam mobil dan menyimpannya di kotak tengah yang terdapat di samping bangku sopir. “Uang tersebut untuk membayar pembelian truk seharga Rp115 juta, selebihnya untuk memberiupahagendankeperluan lainnya,” ucap Ihkwan seraya menunjukkanbukutabunganbukti pengambilan uang dari bank. Sekitar 400 meter berjalan, mobil yang dikendarainya berhentidanparkirdidepanBank Muamalat Jalan Ahmat Yani, persisnya di samping restoran India. Korban sempat masuk ke dalam bank itu. Setelah keluar dari bank dia melihatjendela kaca mobilsopirdiketuk-ketukpetugas juru parkir di sana, lalu memberitahukan kepada sopir yang berada di dalam mobil, bahwa ban belakangmobilsebelahkirisudah bocor.

Polisi Tangkap Bandar Togel STABAT(Waspada):Duabandarjuditogeldantogasyangdiringkus aparat Polres Langkat di RM Bebek Presto Jalan Sudirman Kel. Perdamaian Stabat, baru-baru ini juga merupakan bandar togel untuk wilayah Deli Serdang, Tebingtinggi dan Sergai. ‘’Meski pengakuan tersangka hanya sebagai bandar di Langkat danSergai,kitamendapatbuktimerekajugabandartogeldiDeliserdang Dan Tebingtinggi,’’ kata Kasat Reskrim Polres Langkat AKP Aldi Subartono, Kamis (23/2). ‘’Saat kita amankan disita uang tunai Rp45 juta lebih beserta barang bukti lain termasuk dua senjata Airsof Gun,’’ kata Kasat Reskrim. Kapolres Langkat AKBP Leonardus Eric Bhismo didampingi Kanit Judisila Iptu Juriadi sebelumnya menjelaskan, omzet tersangka WRH, 42, warga Dolok Masihul Sergai diperkirakan Rp5 juta hingga Rp10 juta per hari untuk wilayah Stabat berdasarkan pengakuan tersangka. Sementara tersangka SMT, 26, warga Sidomulyo Stabat, anak dari seorang oknum Polres Langkat, diterangkan sebagai sub agen, bukan bandar. Sementara dua orang bagian pemasaran togel juga ditangkap aparat kepolisian sektor P. Brandan di kawasan Jalan Sudirman, Gang Amal, Kel. Brandan Barat, Kec. Sei. Lepan. Dari tersangka ST alias Santer, 36, warga Jalan Syakhyan Jainuddin, dan Zu, 32, warga Jalan Sudirman Ujung, Kec. Babalan, disita barang bukti uang tunai Rp535.000, handphone, dua rekap hasil penjualan dan pulpen. Kapolsek P. Brandan, AKP HM. Kosim Sihombing melalui Kanit Reskrim Iptu Iswanto, Kamis (23/2) mengatakan, ST dan JU sebagai pengumpul rekap hasil penjualan dari jurtul, mereka juga melayani para pemasang.(a03/a02)

Kabur Saat Hendak Sidang, Pelajar Cabul Kembali Dibekuk LUBUKPAKAM (Waspada): Sempat kabur dua hari saat hendak menjalani persidangan, pelajar kelas III SMK, terdakwa kasus cabul, MPS, 19, warga Gg. Saudara, Tanjungmorawa kembali diringkus pihak kejaksaan, di depan Suzuya Plaza, Tanjungmorawa, barubaru ini. Terdakwa yang dituntut tujuh tahun penjara ini kembali menjalani persidangan, dan kini terdakwa kembali meringkuk di Lembaga Pemasyarakatan Lubukpakam. Kaburnya terdakwa pada dua hari lalu, sempat menghebohkan pihak Kejari dan Pengadilan Negeri Lubukpakam. Pasalnya, terdakwa sebelum kabur, hari itu hendak menjalani persidangan di PN Lubukpakam, dalam acara pembacaan amar putusan. Sebelum bersidang, terdakwa dibesuk orangtuanya, lantas terdakwa pun dikeluarkan sementara dari dalam sel PN Lubukpakam. TerdakwaMPS,sebelummenemuiibunya,diamembukabajuseragam yang bertuliskan“tahanan”. Karena sudah bergabung dengan pengunjung lainnya, lantas kesempatan itu dimanfaatkan terdakwa kabur, dengancaraberjalansantaimenujubelakanggedungPNLubukpakam. Yakin tidak terpantau oleh petugas, cepat saja MPS melompat tembok pagar tembok PN Lubukpakam. Hal ini pun diketahui petugas, saat terdakwa hendak bersidang. Saat itu juga petugas melakukan penyisiran di lokasi awal kaburnya terdakwa, namun tidak ditemukan. Pengejaran terhadap terdakwa terus dilakukan, dan pada Rabu (22/3)malam,pihakKejariLubukpakamberhasilmembekukterdakwa di depan Suzuya Plaza, Tanjungmorawa. Dalam persidangan terungkap, terdakwa MPS melakukan perbuatan cabul terhadap korban, sebut saja “Bunga” (bukan nama sebenarnya, yang masih berusia 16 tahun). Perbuatan amoral ini dilakukan terdakwa di dalam rumah korban, Lubukpakam padaRabu(31/8-2011)pagisekirapukul 06:30, saat itu orangtua korban tidak berada di rumah. (a07)

Korban bersama sopirnya saat itu langsung memeriksa ban belakang mobil dan berusaha hendak memperbaikinya.Tetapi selang beberapa saat saja uang di dalam mobil sudah lenyap. Satpambanksempatmemberitahukankepadakorban,bahwa ada orang mengambil kantungan plastik dari dalam mobilnya. Satpambanksempatdilihatpelaku berbadan gemuk pendek memarkirkan sepedamotor Honda Supra X 125 les merah di depan mobil korban. “Sewaktu saya turun dari mobil dan hendak masuk ke dalam bank Muamalat sekira pukul 11:00, ban mobil tidak ada yang

bocor. Begitu hendak masuk ke dalam mobil petugas parkir memberitahukan bahwa ban belakang mobil sudah bocor sepertiterkenatusukanbesiberbentuk ‘V’. Diduga pelaku sudah membuntutinya sejak keluar dari Bank BCA,” tutur korban. Dia mengakui saat itu tidak langsungmembuatlaporanpolisi, karena setelah kejadian ada seseorang mengaku petugas intel memintai keterangannya. “Saya tidak tahu dia intel dari satuan mana, katanya, dia intel, jadi saya tidak langsung membuat laporan polisi,” papar korban. Korban baru membuat laporan polisi keesokan harinya, Jumat (24/2).

Jalan Menuju Rumah Wakil Rakyat Rusak Parah TANJUNGMORAWA (Waspada): Jalan menuju rumah salah seorang anggota dewan yang berada di Dusun IV Desa Buntu Bedimbar Kec.Tanjungmorawa Kab. Deliserdang kondisinya rusak parah dan hingga saat ini belum ada perhatian pemerintah setempat; khususnya anggota dewanitusendiriuntukmemperjuangkan aspirasi masyarakat. Hal itu diungkapkan salah seorangmasyarakatyangbertempat tinggal tak jauh dari lokasi kepada wartawan kemarin. Menurutnya, sepertinya tugas dan fungsianggotadewanuntukmemperhatikan dan memperjuangkan kepentingan rakyat di daerah yang diwakilinya sepertinya tidak sepenuhnya tidak dilakukan. Ditambahkan warga, jalan yang rusak dan berlubang tersebut sudah sekitar dua tahun rusak parah. Bila musim hujan jalanan menjadi becek, sementara musim kemarau jalanan tersebut

penuh debu yang bila dibiarkan tanpa ada perhatian akan menimbulkan penyakit dikalangan masyarakat disana. Yang membuat masyarakat di sana kecewa disebabkan karena di sana ada anggota dewan yang terhormat bermukim di sana,namunnampaknyajalanan tersebut tetap saja tidak ada perbaikan dan hingga kini terabaikan. Selain jalanan rusak dan berlubang,lingkunganGg.Bukityang juga merupakan tempat tinggal anggota DPRD DS, juga tidak terdapat lampu tiang, dan parit tidak terawat serta semak, seperti yang dikeluhkan salah seorang warga sekitar, Ali Umar. Sementara itu, Kepala Desa Buntu Bedimbar Kecamatan Tanjung morawa, M. Sahib alias Ucok mengatakan, usulan perbaikan jalan di Gg.Bukit sudah pernah dilakukan pemerintah desa setempat, sedangkan untuk


JALAN menuju rumah salah seorang anggota DPRD DS berinisial AS, SE di Gg. Bukit Desa Buntu Bedimbar, Kec. Tanjungmorawa berlubang dan rusak parah, serta parit yang ditumbuhi semak belukar.

betonisasiparitnyalewatMusrenbang dan sudah dua kali diusulkan, namun sampai saat ini belum juga realisasinya. “Kita berharap anggota dewan yang bermukim di sini dapat membantu percepatan perbaikan jalan ini,” harap Ucok. Terkait buruknya salah satu jalanyangberadadidusunIVDesa Buntu Bedimbar Kec. Tanjungmorawa mendapat tanggapan serius dari salah satu LSM (Lembaga Swadaya Masyarakat). Menurut aktivis LSM PHP (Perjuangan Hukum dan Politik) M.Aidi,S,Ag didampingi Dedy Irawan Ziliwu,SH, kepada Waspada, Kamis (23/2) di Tanjungmorawamenjelaskanseharusnya sebagai anggota dewan bisa menjaga citra ataupun nama baik anggota dewan di mata masyarakat yang diwakilinya dan jangan sampai masyarakat jadi pesimis terhadap kinerja wakil rakyat. Dedi menambahkan, seharusnya sebagai anggota dewan lebih memahami dan memaknai tugaspokokdanfungsinyasebagai angotadewansebagaimanadiatur dalam UU No 27Tahun 2009 dan dalam susunan Kode Etik DPRD Kabupaten Deliserdang. Dalam Kode Etik DPRD Kabupaten Deliserdang bertujuan memberikan prinsip etis, standar sikap, prilaku dan ucapan dalam melaksanakan tugas, fungsi, wewenang, hak dan kewajiban serta tanggungjawabnyagunamenjaga martabat, kehormatan, citra dan kredibilitas anggota DPRD serta menunjang optimalisasi, peningkatan kinerja anggota DPRD. DidalamUUNo27Tahun2009, lanjut Dedi, anggota DPRD juga mempunyai tugas dan kewajiban untukmengupayakanterlaksananyakewajibandaerah,dankewajiban memperjuangkan peningkatan kesejahteraan rakyat. (crul)

Kadis Kesehatan Tinjau Penderita Kaki Gajah BINJAI (Waspada): Kepala Dinas Kesehatan Pemko Binjai Dr. Agusnadi Tala, SpA bersama Kabid Pelayanan Kesehatan Dr. Mahaniari Manalu, belumlama ini meninjau penderita penyakit kaki gajah, Saliman, 74, warga Jalan Samahudi Kelurahan Binjai Estate, Kec. Binjai Kota. Kedatangan Kadis Kesehatan

membuat Saliman terharu sebab belum pernah seorang Kadis Kesehatan yang mau langsung meninjau pasien ke rumahnya, padahal Saliman pasien dari Puskesmas Binjai Estate. Pada kesempatan itu, Saliman yang sudah mempuyai 23 cucu ini menceritakan kalau penyakit yang dideritanya ini sudah

Ternak Lembu Bantuan Pemerintah Pusat Berkembang P. BRANDAN (Waspada): Bantuan ternak lembu dari Dirjen Peternakan Pusat kepada 13 peserta kelompok Peternakan Sei Lepan Langkat, mulai berkembang bekerjasama dengan kelompok Ternak Alur Dua. Restu Subagio yang juga Kepala Lingkungan dan pejabat Ketua Kelompok Ternak Alur Dua, di kantor Lurah Alur Dua, baru-baru ini menyebutkan, bantuan kepada kelompok Ternak Alur Dua Sei Lepan Lk II Paya Kanan, 32 ekor lembu dikelola secara swadaya. Dua ekor hasil pengembangan ternak itu kini sudah besar. Rinciannya, 16 ekor induk dan 16 ekor lagi pengembangan. M. Syamsir, Lurah Alur Dua mengharapkan usaha kelompok ini kompak dan bersama-sama menjaga aset pemerintah sehingga memperoleh hasil maksimal.(c01)

Kapolres Tebingtinggi ketika dikonfirmasi melalui Kani Resum Iptu Topan HT mengatakan, kasusnyamasihdalampenyelidikan. Sayangnyakorbantidaklangsung membuat laporan (LP). “Saat kejadian, memang saya ada mendengar sekilas peristiwa itu, namun masih samar-samar akan kebenarannya, karena tidak ada laporan korban. Baru saat ini korbannya melapor,” ucapTopan saat berada di ruang SPK. Kasus tersebut kini ditangani Sat Reskrim Polres Tebingtinggi, petugas sudah melakukan olah TKP,saksi korban tengah dimintai keterangan untuk proses penyelidikan lebih lanjut. (a11)

Waspada/Nazelian Tanjung

KADIS Kesehatan Binjai Dr. Agusnadi Tala, SpA didampingi Kabid Pelayanan Kesehatan Dr.Mahaniari Manalu memperlihatkan kaki Saliman, penderita penyakit kaki gajah.

lebih dua tahun, namun karena hanya berobat ke Puskesmas, penyakit kaki gajah yang dideritanya belum juga sembuh. Namun setelah mendapat bantuan perobatan dari Dinas Kesehatan Binjai dengan diberikan obat obatan, saat ini bengkak dikakinyasudahmulaimenyusut. Kadis Kesehatan Kota Binjai Dr. Agusnadi Tala mengatakan, pihaknya selalu melakukan tugas dengansistemjemputbola,bukan hanya menerima laporan, tapi terus melakukan pemantauan di lapangan dengan mendatangi lokasi yang dianggap rawan berkembangnya penyakit malaria. “Kepada pasien penderita penyakit kaki gajah ini, telah kami lakukan perawatan dengan memberikan obat dan terus dilakukan perawatan secara rutin, namun pasien tidak mau dirujuk ke Rumah Sakit Umum Dr Djoelham dan pihak Dinas Kesehatan telah menganjurkan agar segera dilakukan operasi, namun pasien tidak mau dan itu sudah bukan salah kami lagi,” ucap Agusnadi Tala. Diharapkan kepada masyarakat agar selalu berobat ke Puskesmas, sehingga diketahui kalau ada warga yang menderita penyakit tertentu, maka pihaknya akan melakukan bantuan dengan menurunkan tim. (a05)

Waspada/Armansyah Th

DIRJEN Otda Depdagri Prof Dr Djohermansah Djohan MA (dua kanan) didampingi Bupati Deliserdang H. Amri Tambunan dan Wabup Zainuddin Mars menerima bantuan untuk program Bedah Rumah Pemkab Deliserdang senilai Rp300 juta dari pengusaha Sumut H. Anif yang diwakili Noviandrie Budi Setia, di Desa Paluh Saji, Kec. Pantailabu Kab. Deliserdang.

Bupati DS Lantik 5 Pejabat Eselon II Ajak Investor Tanamkan Investasi Pariwisata LUBUKPAKAM (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan melalui Wabup H. Zainuddin Mars mengambil sumpah/janji serta melantik lima pejabat eselon II di jajaran Pemkab Deliserdang di Balairung Pemkab Deliserdang di Lubukpakam, Jumat (24/2). Lima pejabat yang dilantik masing-masing Drs. H. Rahmad Nasution, MAP yang sebelumnya Staf Ahli Bupati bidang Ekonomi dan Keuangan dilantik menjadi Kepala Dinas Kebudayaan dan Pariwisata menggantikan Drs. Haris Binar Ginting. Ir. H. Anda Subrata, MSi sebelumnya Kabag PenramSetdakabDeliserdangdilantikmenduduki jabatanKepalaDinasPerhubunganmenggantikan H. Abdul Malik Dalimunthe, SH, MM yang telah dilantik menjadi Kepala Dinas Sosial Deliserdang. Ir. Hj. Eka Rezeki Yanti Danil, MM dilantik menjadi Kepala Dinas Pertanian menggantikan Ir. H. Wirdan Yusuf Rangkuti MMA. Selanjutnya Manginar Silaen, S.Sos dilantik menjadi Kepala Badan Pemberdayaan Masyarakat Desa (PMD) Kab. Deliserdang serta Hj. Rosita Siregar, SE dilantik menjadi Staf Ahli Bupati bidang Ekonomi dan KeuanganmenggantikanDrs.H.RahmadNasution MAP. Bupati dalam sambutan tertulis disampaikan WabupH.ZainuddinMarsmengatakankehadiran pejabat kepala satuan perangkat pemerintah daerah dituntut memiliki kreatifitas tinggi untuk menghadapi arus perubahan dengan berbagai macam tantangan yang ada guna memenuhi aspirasi masyarakat yang terus berkembang sesuai tingkat kemajuan pembangunan yang dicapai. KarenanyasebagaipimpinanSKPDdimintauntuk sungguh-sungguh melakukan upaya peningkatan kinerja secara menyeluruh, terencana,terarah

dan terukur.

Ajak Investor Seperti pada Dinas Pariwisata, bupati minta kesungguhan kepala dinas untuk menata dan mengembangkan seluruh objek-objek wisata sebagai salah satu potensi daerah untuk dijadikan penopangpeningkatanperekonomianmasyarakat. Saudara harus mampu mengajak investor menanamkan investasi pariwisata di daerah ini sehingga Deliserdang ke depan dapat dijadikan sebagai salah satu daerah tujuan wisata di Sumut, tegas bupati seraya menekankan agar situs-situs sejarah harus menjadi perhatian untuk dijaga sekaligus dijadikan selain sebagai objek wisata juga menjadi pusat studi bagi masyarakat luas khususnya generasi muda bangsa. Hal yang sama juga ditekankan bupati kepada Kepala Dinas Perhubungan agar melakukan penertiban terhadap transportasi angkutan umum di jalan dan terminal serta bertindak tegas terhadap semua kendaraaan yang melanggar ketentuan melalui kerjasama dan koordinasi dengan instansi terkait. JadikankotaLubukpakamibukotaDeliserdang dalam menyongsong kehadiran Bandara Kualanamu menjadi kota yang nyaman dalam berlalulintas sekaligus mampu merebut penghargaan“Wahana Tata Nugraha”, harap bupati. Penegasan yang sama juga ditekankan bupati kepada Kepala Dinas Pertanian, Kepala Badan PMD maupun staf ahli yang baru dilantik untuk dapat bekerja secara sungguh-sungguh dalam semangatpengabdianyangtinggigunapencapaian visi misi pembangunan Deliserdang yang maju dengan masyarakatnya yang sejahtera, religius dan bersatu dalam kebhinnekaan.(a06)

Wali Kota Binjai Penuhi Janji, Siswa Dapat Buku Gratis BINJAI (Waspada): Wali Kota Binjai HM Idaham memenuhi janji, siswa SMA dan SMK baik negeri dan swasta mendapat buku pelajaran gratis. Idaham didampingi Asisten III Drs. T. Syarifuddin MPd, Kadis Pendidikan Binjai Drs. Dwi Anang Wibowo Ka. Bappeda H. Elyuzar Siregar, SH, M.Hum dan Kabag Humas Pemko Binjai Zulfikar, S.Sos, Jumat ( 24/2) menyebutkan, program pendidikan diprioritaskan sesuai visi dan misi Wali Kota Binjai. Pemberian buku pelajaran gratis dilakukan agar siswa dapat belajar dengan mudah dan orangtuasiswatidakterbebanilagidenganmasalah pembelian buku di sekolah. “Rp14.815.509.700 disediakan anggaran untuk penyediaan buku dan mobiler,” ujar HM Idaham, SH, Msi. Anggaran sudah tersedia di APBD Kota Binjai Tahun anggaran 2012, kemudian ada Dana Bantuan Daerah Bawahan (DBD).

Kadis Pendidikan Kota Binjai Drs. Anang Wibowo menyebutkan, penyediaan paket buku kepada siswa SMA dan SMK untuk meningkatkan kualitas pendidikan di Binjai. Dana penyediaan buku dari APBD 2012 untuk SMA dan SMK negeri tersedia Rp2.274.009.000. Kemudian anggaran DBD untuk penyediaan buku SMK swasta Rp2.604.000.000 dan SMA swasta Rp3.937.500.000. Perbaikan mobiler untuk SMA dan SMK negeri dan swasta dengan bertaraf internasional tersedia Rp6 miliar. Anang menyebutkan, buku pelajaran yang disediakan merupakan buku paket, bukan milik siswa, tetapi milik sekolah yang nantinya dipergunakan siswa berikutnya. Hal ini diminta kepala sekolah, guru dan siswa menjaga keutuhan buku dengan baik. Pelaksanaan pemberian buku pelajaran gratis dimulai pada tahun ajaran baru 2012. (a04)

RSU T. Tinggi Resmikan Unit Transfusi Darah TEBINGTINGGI (Waspada): Dalam meningkatkanpelayananmasyarakatdibidangkesehatan, RSUD dr. Kumpulan Pane KotaTebingtinggi terus melakukan pembenahan. Pembenahan meliputi kelengkapan sarana dan prasarana maupun tenaga pelayanan medis (SDM). Saat ini sudah tersedia Unit Transfusi Darah (UTD RS) dan Central Sterilization Supply Deparment (CSSD) di RSU milik pemerintah tersebut. Penggunaannya baru saja diresmikan oleh Wali Kota Tebingtinggi, Ir. H. Umar Zunaidi Hasibuan, MM baru-baru ini. Direktur RSUD Kumpulan Pane, dr. Nanang Fitra Aulia, Sp.Pk didampingi KTU Edy kepada Waspada di ruang kerjanya kemarin mengatakan, saat ini masyarakat Tebingtinggi maupun masyarakat di luarTebingtinggi dapat memanfaatkan fasilitas pelayanan transfusi darah tersebut, baik untuk melakukan donor darah dan sebaliknya pihak rumah sakit dapat segera membantu pasien yang membutuhkan darah. Pembenahan pelayanan kesehatan ini terus dilakukan secara bertahap, ke depan diharapkan tidak ada lagi pasien yang dirujuk ke Medan. “Dengan terus melakukan pembenahan secara bertahap, baik sarana dan prasarana serta pelayanan tenaga medis, target kita tahun ini mengejar iso 2000 harus tercapai. Untuk mendukung itu, saat ini kita sedang membangun tersedianya taman bunga di halaman agar RSU agar tampak lebih rindang dan alami,” ucap

Nanang yang pernah menyabet predikat dokter terbaik. Program peningkatan pelayanan kesehatan ini, katanya, didukung oleh PT. Askes (Persero) dengan memberikan bantuan 1 unit mobil ambulan. Penyerahannya dilakukan oleh direktur SDM dan Umum PT Askes (Persero), Dr. Zulfarman, M.Kes didampingi Kepala Divisi Regional I, dr. Zuchrady, MM sekaligus penandatanganan kerjasama pelayanan Jamkesda. Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM menyampaikan ucapan terima kasih atas bantuan yang diberikan sebuah mobil ambulan lengkap dengan peralatan pendukung di dalamnya demi peningkatan pelayanan kepada masyarakat Kota Tebingtinggi khususnya. “Tidak akan ada pelayanan bila peralatan tidak lengkap, tidak mungkin seorang dokter dapat mendiagnosis penyakit secara detail bila peralatannya tidak lengkap. Kepada tim medis danpetugas,berikanlahpelayananyangbaikdengan ‘3 S’ yakni, Senyum, Sapa dan Sentuh. Agar pasien merasa dekat dengan perawat maupun dokternya,” pesan Umar. Berdasarkan catatan, rumah sakit ini sudah mendapatkan penghargaan RSU Pemerintah terbaik Kelas B dalam penilaian kinerja RSU Pemerintah dan Swasta Provinsi Sumut, pada pertengahan Desember 2011 lalu dalam acara Kegiatan Hari Kesehatan Nasional di Kantor Gubernur Sumut di Medan. (a11)


WASPADA Senin 27 Februari 2012

C1 Ulama Aceh Gelar Muzakarah Di Pematangsiantar

Preman Aniaya Bocah Hingga Bengkak Mata LHOKSEUMAWE (Waspada): Seorang preman diduga menganiaya Feri Arianto, 15, Sabtu (26/2) sekira pukul 22:00 di Desa Pusong kawasan Pasar Buah Kota Lhokseumawe hingga mata kanannya bengkak, telinga luka dan leher seperti tercabik dengan kuku. Kini kondisi Feri masih terbaring di RS PMI Lhokseumawe. Menurut cerita ibu Feri, Nurlina, 40, Feri saat ini berkerja sebagai pelayan di sebuah warung kopi di Desa Uteun Kot, Kec. Muara Dua. Saat kejadian Nurlina tidak begitu tahu, karena laporan penganiayaan atas Feri tersebut dilaporkan temannya setelah kejadian itu kepada Nurlina. Setelah laporan itu, Nurlina bergagas pergi ke tempat kejadian, ketika melihat korban sudah diamankan oleh pedagang di pasar buah itu, dengan kondisi lemas. Tak menunggu lama, Feri langsung dilarikan ke rumah sakit PMI yang hanya berjarak sekitar 1 km dari TKP. Hasil visum rumah sakit, mengutip dari pembicaran dokter, Nurlina mengaku anaknya tersebut tidak mengalami luka di bagian dalam, kecuali di bagian mata, telinga dan leher. “Keterangan dokter memang anak saya tidak mengalami luka serius, tapi saat ini dia belum bisa bicara normal,” akui Nurlina. Dua jam setelah itu, keluarga korban melapor ke Polres Lhokseumawe. Pun begitu Nurlinan mengaku, tidak akan menerima kasus ini selesai dengan cara damai, ia tetap bersikeras si pelaku itu diproses secara hukum. ‘’Laporannya sudah kita terima tadi malam (kemarin red), dan kita sudah memanggil beberapa orang untuk kita mintai keterangan sebagai saksi. Tapi kita belum bisa memastikan siapa pelakunya, karena itu harus melakukan penyelidikan lebih lanjut untuk memastikan siapa pelakunya,” ucap Kapolres Lhokseumawe AKBP kukuh Santoso melalui Kasat Reskrim AKP Galih Indra Giri(cmk)

Alumni Timur Tengah Raker Perdana Di Insis LHOKSUKON (Waspada): Sedikitnya 30 orang alumni berbagai kampus di Mesir, Sudan, Yaman, Syria, dan Arab Saudi yang tergabung dalam Ikatan Alumni Timur Tengah (Ikat) Aceh Utara, menggelar rapat kerja perdana, di komplek The Institude for Islamic Studies of Samudera Pase (Insis) atau Ma’had Aly Samudera Pase, di Desa Alue Serdang, Baktiya, Aceh Utara, Minggu (26/2). “Raker ini melahirkan sejumlah rekomendasi, antara lain, wacana Ikat Aceh Utara mendirikan lembaga studi pendidikan Islam, menggelar riset dan pertemuan ilmiah bulanan dan kegiatan sosial lainnya,”kata Ketua Ikat Aceh Utara Tgk DR Ajidar Matsyah, LC. MA, kepada Waspada, kemarin. Ajidar berharap, rekomendasi ini didukung semua pihak, termasuk alumni Timur Tengah yang belum bergabung dalam Ikat Aceh Utara. “Mudah-mudahan rekomendasi ini menjadi motivator bagi kita semua untuk memberikan sumbangsih bagi kemajuan daerah, baik dibidang pendidikan, agama, maupun sosial,”tandasnya.(b19)

Pasar Pekan Harus Mampu Majukan Daerah SIMPANG JERNIH (Waspada): Kehadiran Pasar Desa yang kerap disebut Pasar Pekan/Mingguan diharapkan harus memberikan kemajuan atau keuntungan bagi pembangunan daerah seperti peningkatan ekonomi masyarakat. hal itu penting untuk menurunkan angka kemiskina, khususnya di kawasan pedalaman. “Pasar Pekan adalah salah satu sudut ekonomi masyarakat yang cepat dalam meningkat ekonomi masyarakat. Hal itu terwujud jika dikelola dengan baik,” ujar Sekretaris Daerah (Sekda) Kabupaten Aceh Timur, Syaifannur, SH.MM saat peresmian Pasar Pekan Simpang Jernih, Kamis (23/2) petang. Dikatakan, dengan hadirnya pasar pekan atau mingguan ini diharapkan juga pihak masyarakat Simpang Jernih akan semakin mudah dalam bertransaksi jual beli, sehingga tidak lagi merepotkan masyarakat harus bolak balik ke ibukota kabupaten atau luar daerah. “Dengan hadirnya pasar ini, diharapkan juga akan memberikan dampak positif bagi pembangunan daerah. Pasar ini akan dibuka setiap hari Selasa dalam setiap pekannya,” kata Sekda. Syaifannur mengatakan, masyarakat sudah sepatutnya bersyukur karena sebelum tahun 2007 untuk menuju Kecamatan Simpang Jernih harus menempuh jarak yang cukup jauh, namun seiring dengan percepatan pembangunan di daerah ini, jarak tempuh ke Kecamatan Simpang jernih hanya 2-3 jam melalui jalur darat. Dalam peresmian Pasar Pekan itu, tampak hadir Asisten II Keistimewaan Aceh, Ekonomi dan Pembangunan Setdakab Aceh Timur, Ir M Yasin, para SKPD, Kabag dalam Setdakab Aceh Timur, unsur Muspika dan para tokoh ulama dan masyarakat setempat. Selain meresmikan Pasar Pekan, Sekda Syaifannur juga berkesempatan meletakkan batu pertama pembangunan Masjid Raya Nurul Huda Kecamatan Simpang Jernih. (b24)

Waspada/Muhammad H. Ishak

SEKDA Aceh Timur Syaifannur ketika melakukan peletakan batu pertama pembangunan Masjid Raya Nurul Huda di Pusat Kecamatan Simpang Jernih, Kamis (23/2).

PEUREULAK BARAT (Waspada): Untuk menjalin ukhwaqh islamiyah dan keakraban, para ulama kharismatik Aceh merencanakan akan menggelar kunjungan silaturahmi ke Pondok Pesantren (Ponpes) Salafiah Darussalam di Kota Pematangsiantar, Provinsi Sumatera Utara. “Hari ini kita berangkat dari Aceh Timur menuju Kota Pematangsiantar, Sumut. Insya Allah besok kita akan gelar kegiatan muzakarah dengan ulama-ulama di sana. Ini hanya bentuk silaturrahmi untuk memperkuat ukhwah islamiyah,” ucap Ketua Panpel Pengajian Ulama – Umara se Aceh Timur, Tgk H Armis Musa kepada Waspada Sabtu (25/2). Kata dia, kunjungan silaturahmi kali ini melibatkan alim ulama dan para jamaah pengajian se Kabupaten Aceh Timur. Menurut H Armis Musa, dalam kunjungan itu juga berte-

Waspada/Zainuddin Abdullah

TERGANGGU : Meski adanya papan peringatan ada gangguan, Minggu (26/2) namun para pengendara kendaraan bermotor tetap merasa terganggu melintas di Jalan Merdeka ,Kota Lhokseumawe lantaran adanya proyek galian dan pekerjaan pribadi dengan menumpuknya bahan material bangunan tepatnya di Simpang Kutablang.

Laptop Pelajar Rawan Film ‘Biru’ IDI (Waspada): Membawa dan menggunakan laptop di sekolah belakangan bukan lagi hal yang baru, lebihlebih pelajar di perkotaan. Negatifnya, di dalam laptop para pelajar tak jarang yang menyimpan film-film ‘biru’ atau akrab disebut video porno. Akibatnya, belakangan tingkah sebagian pelajar tingkat SMP dan SMA sederajat mulai terlihat tidak senonoh terhadap lawan jenis (siswa tehadap siswi). “Laptop pada dasarnya sangat baik, namun karena bisa dibawa ke arah yang nelatif seperti menonton video porno, sehingga jika berda di tangan siswa/i lebih banyak mudharatnya,” kata Ketua Komisi E DPRK Aceh Timur Muzakir, SE kepada Waspada Jumat (24/2)

di Idi. Menurut politisi yang membidangi Bidang Pendidikan dan Keistimewaan Aceh itu, laptop adalah sebuah media audio visual yang sangat baik untuk perkembangannya zaman. Dibandingan dengan perangkat komputer, laptop dinilai mudah untuk dibawa kemana saja dan bisa diakses dimanapun, namun kalangan pelajar harus dibatasi dalam penggunaannya. Muzakir menyarankan, selain kontrol yang harus ekstra ketat dari orangtuan/wali di rumah, pihak sekolah harus melakukan razia ruang belajar dengan target laptop para siswa/ i dengan menindaktegas jika mendapatkan laptop video porno ataupun gambar telanjang. “Moral siswa kita belakangan menurun sekali, bahkan di sekolah-sekolah tertentu ada laporan siswa berani bercanda dengan guru,” katanya. Wakil Ketua Majelis Permu-

syawaratan Ulama (MPU) Aceh Timur Tgk H Azhar BTM secara terpisah mengatakan hal yang sama. Bahkan pihak ulama meminta agar Dinas Pendidikan (Disdik) setempat membuat aturan khusus untuk menertibkan siswa dalam penggunaan laptop di sekolah. “Kebebasan siswa dalam mengakses internet juga mempengaruhi siswa lebih leluasa dalam menonton dan melihat hal yang tidak sewajarnya,” sebutnya. Untuk itu, lanjut H Azhar BTM, dia meminta pihak sekolah khususnya tingkat SMA di Kabupaten Aceh Timur melakukan razia terhadap laptop pelajar. “Jangan hanya handphone (HP) yang dirazia, laptop juga harus dirazia. Apalagi di sekolah tingkat atas pihak sekolah memiliki tenaga pendidik yang mampu mengoperasionalkan laptop. Jadi di folder manapun disimpan bisa diperiksa,” tandas H Azhar BTM. (b24)

Caplok Desa Gajah Meuntah Sejak Tahun 1988

BPN Aceh Didesak Tak Perpanjang HGU PT Patria Kamo SUNGAI RAYA (Waspada): Setelah desakan dari masyarakat dan seluruh elemen sipil melalui musyawarah, akhirnya Camat Sungai Raya mengirimkan surat permintaan ke Badan Pertanahan Nasional (BPN) Provinsi Aceh agar tidak memperpanjang Hak Guna Usaha (HGU) PT Patria Kamoe. Permintaan resmi itu dituangkan Camat Sungai Raya dalam surat Nomor: 8507/197 tertanggal 22 Februari 2012. “Kita telah kirimkan surat resmi ke BPN Provinsi Aceh di Banda Aceh agar tidak memperpanjang HGU PT Patria Kamoe, sebab syarat untuk sebuah HGU tidak mencukupi, sejak dulu hingga sekarang,” beber Camat Sungai Raya Abdullah SP kepada Waspada Minggu (26/ 2) . Abdullah beralasan, permintaan itu disampaikan berdasarkan UU Nomor 5 Tahun 2010 dan PP No 11 Tahun 2010, dimana HGU PT Patria Kamoe telah menelantarkan lahan sejak keluarnya HGU. “Selain itu, UU No 32 Tahun 2004 tentang Pemerintahan Daerah sebagaimana telah diubah dengan UU No 8 Tahun 2005 bahwa HGU PT Patria Kamo terletak dalam

wilayah teritorial Desa gajah Meuntah (kecamatan Sungai Raya, Kab. Aceh Timur),” sebutnya. Tak hanya itu, sambung Camat Abdullah, hal-hal lain sebagai persyaratan sebuah HGU juga tidak bisa dipenuhi oleh PT Patria Kamoe. “Bagaimana mau dijadikan HGU, sementara wilayah HGU PT Patria Kamoe sebagiannya berada dalam pemukiman penduduk. Jika BPN tetap memperpanjang HGU ini, maka Desa Gajah Meuntah seluas 3.800 hektare akan lenyap dari peta dan kewilayahan Pemkab Aceh Timur,” tutur Camat Abdullah. Kuasa Hukum Masyarakat Gampong Meuntah, Safaruddin, SH kepada Waspada kemarin menyebutkan, langkah yang ditempuh aparatur Kecamatan Sungai Raya sangat tepat, karena HGU PT Patria Kamoe telah mencaplok seluruh areal Gampong Gajak Meuntah. “Bahkan selama ini masyarakat Gampong Gajah Meuntah kerap mendapatkan perlakuan diskrininatif dari PT Patria Kamoe, masyarakat sering di usir dari Gampong jika tidak bekerja di PT Patria Kamoe,” katanya.

Gajah Meuntah Sama Seperti Palestina Hal senada juga di sampaikan Geuchik Gajah Meuntah, Abdurrahman R. Dimana kondisi Gampong Gajah Meuntah belakangan sudah hampir sama seperti Palestina, pemerintahan dan rakyat ada sementara wilayah tidak ada. “Masyarakat juga sudah mengirimkan data dan surat ke DPRK Aceh Timur dan Bupati agar segera menyurati BPN Aceh supaya tidak memperpanjang HGU PT Patria Kamoe sebelum areal Gampong Gajah meuntah di keluarkan dari HGU PT Patria Kamoe,” sebutnya. Abdurrahman menyebutkan, Gampong Patria Kamoe, Kecamatan Sungai Raya, Kabupaten Aceh Timur sudah 25 tahun lebih menderita akibat areal desanya dicaplok oleh HGU PT Patria Kamoe. “Kami (masyarakat—red), kantor geuchik saja tidak ada, padahal kami dapat dana PNPM yang akan kami bangun kantor geuchik, tetapi perusahaan melarangnya, sehingga sampai saat ini kami tidak memiliki kantor Geuchik,” kata Abdurrahman. (b24)

Mengubah Mindset Penikmat Kopi Daerah MEDAN (Waspada): Keude Kupie Uleekareng & Gayo Jalan Setia Budi No. 62 AB menawarkan kepada para penggagum kopi Kota Medan menu-menu baru untuk bersarapan pagi sambil ngopi pukul 07:30 setiap harinya. Hal itu diutarakan Pemilik Keude Kupie Uleekareng & Gayo Al Junishar, biasa disapa Agam ketika melauncing tempatnya, Kamis (23/2). Menurut Agam, pada tahun 2010 berdirinya Keude Kupe Uleekareng & Gayo, tempattempat ngopi di Kota Medan terkesan di kelas bawah, belum ada tempat yang benar-benar menyajikan kenikmatan kopi yang sesungguhnya. Jelang setahun, muncul beberapa tempat, namun masih saja ada tempat yang menawarkan menu minuman lain, bukan kopi yang

sesungguhnya. “Berbeda di sini, kita menawarkan cita rasa kopi yang sesungguhnya dari kopi Uleekareng dan Gayo, untuk kopi Uleekareng sendiri merupakan jenis kopi Robusta yang diracikan sendiri bukan murni. Sedangkan kopi Gayo merupakan kopi Arabika yang kualitasnya lebih murni. Untuk semua bahanbahan itu kita ambil dari Banda Aceh untuk Uleekareng dan Gayo dari Takengen,” sebut Agam, sembari menyebutkan, kopi Uleekareng paling banyak di minati para pelanggan. Agam juga menyayangkan masih banyak tempat ngopi y a n g t u m b u h d i Me d a n menyajikan kopi-kopi luar negeri dan sachetan, bukan kopi-kopi daerah, seperti Sumut yang terkenal dengan kopi Sidikalang, maupun kopi

Uleekareng dan Gayo sendiri. “Selama ini kita kalau nongkrong di tempat-tempat ngopi pada umumnya masih menemukan kepenatan, bukan menjadi lebih rileks. Maka dari itu, di sini kita berupaya merubah paradigma itu agar para penikmat kopi lebih nyaman dan betah untuk ngopi. Untuk itulah tempat kita ini dilengkapi dengan ruangan khusus untuk rapat maupun keluarga, dilengkapi dengan infocus untuk nonton bareng,WiFi online dan lain-lain,” sebutnya. Lebih lanjut diutarakan Agam, selain itu kehadiran Keude Kupie Uleekareng & Gayo ini mencoba mengubah mindset para pelanggan bahwa ngopi itu yang paling enak pagipagi, bukan cuma sore atau malam hari. Harga yang kita


Para penikmat kopi sedang meramaikan Keude Kupie Uleekareng dan Gayo, Kamis (23/2). tawarkan pun terjangkau, dimulai Rp5 ribu hingga Rp10 ribu. “Jadi dengan harga segitu,

kalau sudah kena kopi Uleekareng & Gayo, pasti bisa ketagihan,” pungkas Agam. (m43)

patan dengan kegiatan acara Syiar Maulid Nabi Muhammad SAW. “Ini perjalanan yang pertama kali kita gelar oleh ulama-ulama yang tergabung dalam pengajian ulama-umara se Aceh Timur,” sebutnya. Ditambahkannya, dalam acara itujuga akan diadakan muzakarah dan Bahsul Masa-il seputar masalah keislaman dan ketauhidan antara lain adalah mengenai peranan thariqat dalam perbaikan bangsa dan thariqat menurut Alquran dan hadis serta akan membahasa pula ciri-ciri ulama. “Dalam muzakarah nantinya akan dibahas pula hukum mengqadha shalat yang tinggal dan membahas pengertian adil pada wali dan saksi dalam pernikahan,” sebut H. Armis Musa sembari menandaskan, rencananya kegiatan akan dimulai sejak Minggu (26/2) n dan akan berakhir Senin (27/2) hari ini. (b24)

400 Tokoh Agama Tujuh Kabupaten Ikuti Pelatihan Tajhiz Jenazah SIMPANG MAMPLAM (Waspada) : Sebanyak 400 Imum Chiek, Imum Neunasah, tokoh agama, tokoh masyarakat utusan Kabupaten Bireuen, Pidie, Pidie Jaya, Aceh Utara, Aceh Timur, Aceh Tengah dan Gayo Lues mengikuti pelatihan Tajhiz Jenazah di Dayah Thautiatut Tullab Arongan, Kecamatan Simpang Mamplam, Sabtu (25/2). Pimpinan Dayah Thautuiatut Tullab Tgk H Sofyan Mahdi yang akrab disapa (Abon Arongan) didampingi Tgk H Lutfi Arongan dalam keterangannya kepada Waspada menjelaskan pelatihan Tajhiz Jenazah yang diselenggarakan Dinas Syariat Islam Provinsi Aceh bekerjasama Dayah Thaitiatut Tullab Arongan untuk memperdalam tentang Tajhiz Jenazah bagi para

Imum Chiek, Imum Neunasah, tokoh agama dan tokoh masyarakat. Setelah mengikuti pelatihan ini para Imum Chiek, Imum Meunasah, tokoh agama dan tokoh masyarakat utusan tujuh kabupaten akan dapat memberikan penyuluhan kepada masyarakat di Kabupaten masing-masing untuk mengatasi kekurangan tenaga pelaksanaan Tajhiz Jenazah. Penyelenggaraan Tajhiz Jenazah berlangsung sehari penuh dibuka Kadis Syariat Islam diwakili Abd Gani , SAg, turut dihadiri Kadis Syariat Islam Kabupaten Bireuen Tgk Saifullah, SAg.MPd serta Muspika Kecamatan Simpang Mamplam. (b12)


PETUGAS dari BKSDA sedang menggendong Orangutan yang berhasil diamankan dari penangkaran milik Feri di Desa Landuh,Kecamatan Rantau,Kabupaten Aceh Tamiang, Jumat (24/2).

Petugas BKSDA Amankan Orangutan Di Aceh Tamiang KUALASIMPANG (Waspada): Petugas Balai Konservasi Sumber Daya Alam (BKSDA) Kabupaten Aceh Tamiang bekerja sama dengan sumatera orang utan conservation program (SOCP) mengamankan seekor orang utan milik Feri,33, warga Desa Landuh,Kecamatan Rantau,Kabupaten Aceh Tamiang. Orangutan diamankan petugas karena tidak memiliki izin penangkaran satwa yang dilindungi itu Jumat (24/2) Keterangan yang dihimpun Waspada, Jumat (24/2) menyebutkan, seekor orang utan milik Feri itu telah diasuhnya selama enam bulan. Tetapi karena Feri tidak memiliki izin penangkaran orangutan itu,makanya terpaksa diserahkan kepada petugas BKSDA yang datang langsung ke rumah Feri untuk mengambil satwa yang dilindungi itu. Menurut pengakuan Feri kepada wartawan, orang utan didapat di sekitar perkebunan PTP I di Desa Babo, Kecamatan Bandar Pusaka, Kabupaten Aceh Tamiang akhir Oktober 2011 lalu, karena merasa kasihan , dia berupaya memelihara orang utan itu .

Kepada petugas Balai Konservasi Sumber Daya Alam, Feri mengaku tidak mengetahui undang-undang tentang konservasi, dirinya memelihara satwa itu karena didasari kasihan dan hobi. “ Saya tidak tahu kalau hewan ini merupakan satwa yang dilindungi undang-undang,saya pelihara orangutan ini semata-mata karena kasihan dan hobi saja,” ungkap Feri kepada petugas BKSDA yang datang menjemput irangutan itu di kediaman Feri. Ketua Tim sumatera Orangutan Conservation Program, Zeni Saraswati mengatakan kepada wartawan, Jumat (24/2), berdasarkan UU Nomor 5 tahun1990 tentang konservasi sumber daya alam hayati dan ekosistem, orang utan merupakan satwa yang dilindungi . Karena itu, Zeni mengimbau warga Aceh Tamiang yang memelihara orang utan agar dengan suka rela menyerahkannya ke BKSDA untuk dilakukan rehabilitasi di pusat karantina Orangutan Sumatera di Batu Bedi ,Medan, Sumatera Utara. (b23)

Kualitas Badan Jalan Di Kota Langsa Dipertanyakan LANGSA (Waspada): Masyarakat Lorong Damai, Kecamatan Langsa Kota mempertanyakan kualitas jalan yang dibangun di lingkungan mereka. Karena baru satu bulan siap diaspal, batu kerikil berhamburan di permukaan, dan luas badan jalan juga jadi menyempit. Ketua pemuda Lorong Damai, John, kepada Waspada, Minggu (26/2) mengatakan, jalan yang dibangun pada lintasan di depan rumahnya itu, prosesnya memang agak beda dengan proyek jalan di tempattempat lain yang biasa dia lihat. Perbedaan itu, kata dia, antara lain terdapat pada plank papan nama. Informasi yang tertera disitu tidak menyebutkan berapa panjang dan lebar jalan. Yang disebutkan hanya volumenya 1 keg. Sehingga ketika pengaspalan dilakukan, masyarakat tidak bisa mengawasi apakah lebar dan panjangnya sudah mencukupi seperti yang ada di kontrak. “Kami tidak mengerti satu keg itu apa,” ujar John seraya menjelaskan sehingga masyarakat hanya bisa bertanya-tanya, saat melihat pengaspalan yang dilakukan

Waspada / Ibnu Sa’dan

BATU kerikil terlihat berserakan di atas badan jalan, padahal proyek pengaspalan jalan Lorong Damai ini selesai dilaksanakan sekitar satu bulan lalu. rekanan tidak memenuhi seluruh badan jalan. Padahal Lorong Damai itu sebelum pengaspalan dilakukan tergolong lebar, hampir mencapai enam meter luasnya. Bila dua mobil berselisih masih bisa melintas dengan lancar. Namun sekarang setelah pengaspalannya, jalan menjadi sempit, jika tidak ada yang berhenti ke pinggir mobil lain tidak bisa lewat. Beda lainnya lagi, tambah John, pelaksanaannya berada di luar waktu kontrak. Pada plank papan nama tertera jalan

yang sumber dananya berasal dari hibah 2011, selesai pengerjaannya pada tanggal 27 Desember 2011. Tapi dalam kenyatannya pengerjaan baru selesai dilakukan awal Januari Tahun 2012. Hasil setelah proyek dilaksanakan juga masih terdapat beda. Biasanya kalau di tempat lain yang John sering melihat, jika dibangun jalan aspal batubatunya tidak kelihatan di atas permukaan badan jalan. Tapi pada jalan satu keg ini batu kerikil berhamburan pada bagianbagian tertentu di atas permukaan badan jalan. (b20)


WASPADA Senin 27 Februari 2012

Pemkab Abdya Dinilai Abaikan Pembinaan Remaja

Dai Perbatasan Peringati Maulid LAE IKAN (Waspada): Dai perbatasan Prov. Aceh dan Kota Subulussalam yang tergabung dalam Forum Komunikasi Dai Perbatasan dan Daerah Terpencil (Fosda) Kota Subulussalam peringati Maulid Nabi Muhammad 1433 Hijriah, Jumat (24/2) malam di Masjid Al Furqan Desa Lae Ikan Kec. Penanggalan, Subulussalam. Acara bertema, Dengan Peringatan Maulid Kita Lanjutkan Sistem Dakwah Rasulullah Dalam Mansyiarkan Islam Secara Kaffah di Bumi Sada Kata Kota Subulussalam menampilkan pentausiyah Ustadz Tgk. Alamsyah HP Lembong. Selain Wali Kota, Merah Sakti, hadir Pabung Kodim 0109 Mayor Inf. M Saing, Wakil Ketua DPRK Karlinus, Plt. Kadis Syariat Islam Usni B, sejumlah Kepala SKPK dan kepala desa, undangan dan puluhan warga Desa Lae Ikan. Usman, unsur panitia dan dai dalam sambutannya mengatakan, dari 15 dai provinsi dan 10 kota, Pemko Subulussalam telah membantu 10 unit sepedamotor. Upaya meminimalisir penyakit masyarakat (pekat), judi, khamar miras dan lainnya, Usman ajak instansi terkait dan seluruh unsur masyarakat bekerjasama. “Jangan maling tarik maling,” tegas Usman. Menanggapi Usman soal sekretariat dai di sana, Merah Sakti berjanji mencari solusi. Warga muslim pun diminta lebih waspada dan tidak mudah terprovokasi dengan nilai-nilai negatif. Para dai diminta proaktif membina/memberi pencerahan kepada warga semua tingkatan. Di sisi lain, unsur petugas pos Perbatasan Sumut-Aceh di Lae Ikan, TNI/Polri dan instansi terkait diminta lebih ketat merazia angkutan, utamanya yang ditengarai pemasok miras atau pekat lainnya ke daerah ini dalam upaya penegakan Syariat Islam. Selain penyantunan sejumlah anak yatim, penampilan dua dai cilik binaan Fosda membuat suasana semakin hikmad. (b28)

Jaga Diri, Akhlak Usahawan Muslim BLANGKEJEREN (Waspada): Kegiatan usaha –dalam kaca mata Islam– memiliki kode etik yang bisa memelihara kejernihan aturan Ilahi, jauh dari sikap serakah dan egoisme, sehingga membuat usaha itu sebagai mediator dalam membentuk masyarakat yang saling mengasihi satu kepada yang lain. Hal itu disampaikan Ustadz Rahmatsyadani dalam khutbah Jumat (24/2) di Masjid At-Taqwa, Kota Blangkejeren. Hal itu menurutnya, dasarnya adalah hal yang menjadi keyakinan seorang pengusaha muslim itu sendiri, yakni harta itu pada dasarnya adalah milik Allah. Manusia seluruhnya hanya bertugas mengendalikannya. Orang yang bertugas mengendalikan tentu tidak berhak keluar dari aturan dan tujuan pemilik harta. Kalau itu dilakukan, maka ia kehilangan posisinya sebagai pengendali harta. Karunia itu bisa berpindah dari dirinya kepada orang yang lebih pantas melakukan tugas tersebut dan lebih mampu menjaga apa yang menjadi hak harta itu. (cjs)

Menanti Bupati Simeulue Masyarakat Ujung Tinggi Tunda Maulid SIMEULUE (Waspada): Karena Bupati Simeulue, Drs Darmili masih berada di luar daerah, warga Desa Ujung Tinggi, Kecamatan Simeulue Timur menunda pelaksanaan perayaan Maulid Nabi Besar Muhammad SAW yang direncanakan mereka semula dilakukan Sabtu (25/2). Hal yang sama juga oleh masyarakat Desa Kota Batu. “Maulid kami besok ditunda,” jawab Suhdinata, salah seorang pemimpin spiritual Desa Ujung Tinggi kepada Waspada di Sinabang, Jumat (24/2). Da menjelaskan, Maulid Nabi Muhammad SAW yang hendak mereka lakukan tahun ini berdasarkan hasil musyawarah desa dilakukan secara akbar. “Masyarakat kami akan menyediakan dua puluh buah balai (red 20 tong makanan),” sebutnya. Kepala Desa Ujung Tinggi Hardianis yang ditanyai Waspada kemarin membenarkan adanya penundaan jadwal pelaksanaan Maulid Nabi di Desa mereka yang seyogianya hari ini bergeser ke hari Senin (27/2). Menurutnya pergeseran itu sebagai bentuk penghormatan mereka kepada pemimpin daerah yang semula sudah mereka undang dan kemudian mengkonfirmasi bahwa jika pada hari Sabtu (25/2) tidak dapat hadir karena sedang menjalankan tugas di luar Simeulue. Penundaan pelaksanaan perayaan Maulid Nabi Besar Muhammad SAW karena menanti kehadiran Bupati Darmili juga terjadi di Desa Kota Batu. Menurut Oyon, 35, warga Desa Kota Batu, kemarin Maulid Desa itu diundur sehari dari Sabtu (25/2) jadinya pada hari Minggu (26/2). (cb04)

Kompol Goodman Sigiro Wakapolres Agara KUTACANE (Waspada) : Kompol Goodman Sigiro secara resmi menduduki jabatan Wakapolres Aceh Tenggara menggantikan Kompol Bambang Eko Subandono. Dalam acara lepas sambut yang digelar di Gedung Kesenian Kutacane, Sabtu (25/2) dan dihadiri Kapolres AKBP H.Trisno Rianto, Kabag, Kasat, Kapolsek dan jajaran Polres Agara, Eko Subandono yang mendapat tugas baru di Polda Aceh mengatakan, meski baru bertugas di Agara, namun hatinya sangat berat meninggalkan Bumi Sepakat Segenep. Selain telah banyak kesan positif yang didapati selama bertugas di Aceh Tenggara, Bambang juga telah merasa menjadi bagian dari masyarakat Bumi Sepakat Segenep yang berasal dari berbagai etnis. Kapolres AKBP H Trisno Rianto dalam sambutannya mengatakan, mutasi dan pergeseran jabatan dalam tubuh Polri merupakan hal yang biasa dalam rangka penyegaran dan peningkatan karir, sebab itu dukungan penuh kepada Wakapolres yang baru harus diberikan semua pihak, terutama untuk peningkatan tupoksi sebagai pelayan, pengayom dan pelindung masyarakat. (b26)

Polsek Badar Tangkap Pembawa Ganja KUTACANE (Waspada) : Tiga pembawa 10 kilogram ganja dibekuk petugas Polsek Badar, yakni AS, 20, warga Uning Sepakat, Gayo Lues, SA, 22, warga Dabun Gelang, Gayo Lues, dan F, 30, sopir angkutan umum, warga Aceh Tenggara. Barang bukti yang dititipkan pelaku di rumah pemilik doorsmer dicuri sebanyak 7 kg. Kapolres Agara AKBP Trisno Riyanto melalui Kanit Idik I Narkoba Aipda N Samosir, Jumat (24/2) membenarkan soal ditangkapnya 3 pelaku yang mencoba menyelundupkan barang haram dari Kabupaten Gayo Lues untuk dijual di Agara. Ketiga pelaku telah diserahkan Kapolsek Badar Iptu GM Sitompul ke Mapolres Agara bersama ganja 3 kg. Ketiga pelaku sesuai interogasi polisi mengakui mereka membawa ganja 10 kg diselundupkan menggunakan mobil penumpang Louser. (b25)

Tolak Pejabat Bermasalah Jadi Pj Bupati BLANGPIDIE (Waspada) : Mencuatnya sejumlah nama pejabat yang disebut-sebut akan diusulkan sebagai calon Penjabat Bupati Aceh Barat Daya membuat sejumlah aktivis LSM memberikan reaksi dan tanggapan yang beragam, apalagi pejabat yang namanya kini santer beredar di kalangan masyarakat dinilai memiliki latar belakang ‘hitam’ serta sejumlah persoalan lainnya. “Penjabat Bupati Aceh Barat Daya ke depan harus mempunyai integritas tinggi, netralitas dan sanggup menyatukan tokoh dan komponen masyarakat Abdya, karena tugasnya menyelesaikan tugas-tugas bupati lama dan itu hanya dapat terwujud jika pj bupati yang terpilih tidak memiliki latar belakang masalah,” ujar Julida Fisma, Ketua Ikatan Mahasiswa Muhamadiyah (IMM) Abdya dalam siaran persnya, Jumat (24/2). Pernyataan senada diutarakan M Syahril, koordinator LSM Himpunan Masyarakat dan Pemuda Abdya (HIPMA). Penjabat Gubernur Aceh Tarmizi A Karim mengaku belum bisa memberikan keterangan apapun. (cb05)


Waspada/Khairul Boangmanalu

WALI KOTA, Merah Sakti (baju putih) didampingi Karlinus (sebelah kiri Sakti) foto bersama dengan para dai, usai maulid di dalam Masjid Al Furqan Lae Ikan.

Pernyataan Soal 2.000 Senjata Berlebihan BANDA ACEH (Waspada): Pernyataan Asisten Deputi (Asdep) I Poldagri Menkopolhukam Brigjen TNI, Sumardi terhadap peredaran senjata ilegal di Aceh mencapai 2.000 pucuk, pernyataan itu dianggap berlebihan oleh Komisi A Dewan Perwakilan Rakyat (DPR) Aceh. Wakil Ketua Komisi A DPRA Abdullah Saleh yang menghubungi Waspada, Minggu (25/ 2) mengatakan, sebagai Asisten Deputi (Asdep) I Poldagri Menkopolhukam Brigjen TNI,

Sumardi tidak seharusnya mengeluarkan pernyataan itu. “Menurut kami, Komisi A, sangat berlebihan itu katakan senjata di Aceh masih 2000 pucuk lagi,”katanya. Karena, menurut Komisi A yang membidangi masalah hukum, politik dan pemerintahan pernyataan itu akan membawa dampak buruk terhadap image Aceh sendiri, “Seperti diketahui senjata milik mantan GAM telah dimusnahkan pada perjanjian damai pada Oktober tahun 2005 lalu dan ada juga yang diserahkan kepada TNI/ Polri, jadi tidak mungkin sampai 2000 lagi,”terang Abdullah Saleh, anggota DPRA dari Fraksi Partai Aceh itu.

Selain itu katanya, dampak dari pernyataan itu adalah Aceh akan dianggap seram oleh semua orang dari manapun asalnya, namun di sisi lain Aceh telah damai dan situasi telah kondusif jadi tidak perlu mengeluarkan pernyataan yang tidak sesuai dengan kenyataannya. Sebelumnya Asisten Deputi (Asdep) I Poldagri Menkopolhukam Brigjen TNI, Sumardi mengeluarkan pernyataan, masih ada 2.000 senjata ilegal di Aceh dalam pertemuan dengan Muspida Aceh Utara, tokoh ulama, tokoh masyarakat dan para Kepala Dinas di Kantor Bupati Aceh Utara, Rabu (22/ 2, Waspada, Kamis 23/2). (cb01)

Lagi, Aksi Penembakan Terjadi Di Aceh Besar BANDA ACEH (Waspada): Aksi penembakan kembali terjadi di Aceh Besar. Seorang buruh tani yang menjadi korban. Ikhsan, 25, warga Gampong Meureu, Kecamatan Indrapuri, Kabupaten Aceh Besar, mengalami luka tembak di bahagian bawah ketiak sebelah kanan dan kini sedang mendapat perawatan intensif di Rumah Sakit Umum dr Zainoel Abidin Banda Aceh. Aksi penembakan diduga dilakukan oknum anggota Polisi yang bertugas di Polda Aceh itu terjadi di dekat sebuah warung kopi di Meureu, Sabtu (25/2) petang. Informasi yangWaspada peroleh menjelang shalat Maghrib kemarin, penembakan itu terjadi sekitar pukul 17:30, saat sejumlah anggota Polda sedang melaksanakan kegiatan operasi ganja di Gampong Meure. Namun, padaa saat bersamaan petugas melihat Iksan sedang membawa kayu dan langsung ditahan anggota Polda yang sedang melakukan operasi ganja. Saat ditanya petugas, korban sempat membantah kalau kayu yang dibawanya itu adalah kayu dari lokasi HTI. “Korban mengatakan kayu yang dibawanya itu berasal dari kebun masyarakat,” sebut sumber Waspada di Banda Aceh. Sumber juga mengatakan, karena keberatan ditahan, lalu korban memanggil beberapa

orang temannya guna meyakinkan anggota Polda yang menahannya bahwa kayu yang dibawanya itu bukan kayu HTI. Namun, kata sumber lagi, niat korban itu menimbulkan amarah anggota Polda, sehingga terjadi perselisihan antara korban dengan polisi yang menyebabkan oknum anggota Polda Aceh mengeluarkan tembakan peringatan. Mendengar suara letusan senjata, sejumlah warga di sekitar lokasi kejadian langsung mendatangi TKP untuk mengetahui apa yang terjadi. “Saat itulah seorang oknum anggota Polda melepaskan tembakan terarah sehingga mengenai bagian bawah ketiak sebelah kanan korban,’’kata sumber. Sementara itu, sumber lain menyebutkan, kejadian itu berawal dari penangkapan sebuah truk bermuatan kayu oleh anggota Polisi dari Polda Aceh yang sedang melakukan operasi mencari ladang ganja. Melihat ada truk bermuatan kaya, anggota Poda Aceh itu kemudian menangkap truk bersama sopir bernama M. Basyir. “Truk tersebut bersama sopirnya kemudian dibawa oleh polisi. Namun dalam perjalan diberhentikan oleh warga. Warga meminta polisi membebaskan sopir bersama truknya itu, karena kayu yang dibawanya bukan kayu ilegal,” kata sumber lagi.

Menurut sumber, sempat terjadi keributan antara polisi dengan warga, sehingga aparat kepolisian yang diperkirakan berjumlah tujuh orang melepaskan tembakan yang menyebabkan warga mundur. “Saat itulah Saudara Ikhsan terkena tembakan. Padahal sebelumnya korban tidak bersama warga, dia terpisah dari warga. Entah bagaimana, tiba-tiba sudah bergabung bersama warga,” kata sumber lagi. Kabid Humas Polda Aceh Kombes Pol Gustav Leo yang Waspada konfirmasi membenarkan kejadian itu. Ia mengatakan, korban bersama sejumlah warga melakukan penghadangan terhadap aparat yang sedang membawa truk tersebut bersama sopirnya ke Pos Polisi terdekat untuk dimintai keterangan terkait kayu yang diduga ilegal yang berada di dalam truk. “Korban diduga terkena peluru nyasar yang dilepaskan anggota saat ribut-ribut dengan warga yang memberhentikan truk tersebut. Warga meminta agar truk dan sopirnya dibebaskan,” jelasnya lagi. Kabid Humas menambahkan, untuk mengetahui kejadian yang sebenarnya, pihak Kepolisian Resort Aceh Besar saat ini (tadi malam-red) sedang berada di TKP untuk menyelidiki kasus itu. “Anggota (polisired) juga akan diperiksa, tetapi yang penting penanganan korban dulu,” sambungnya. (b05)

Bupati Pijay Buka Konwil PII Aceh, Minta Cegah Narkoba MEUREUDU (Waspada) : Bupati Pidie Jaya (Pijay),Drs HM Gade Salam membuka Konferensi wilayah (Konwil) ke-26 Pelajar Islam Indonesia (PII) Provinsi Aceh di Meureudu yang dipusatkan di Aulan Kantor Bappeda Kabupaten Pidie Jaya, Sabtu (25/2) siang. Bupati Pidie Jaya yang juga mantan aktivis atau Keluarga Besar PII itu, dalam sambutan pembukaannya antara lain menyatakan, pihaknya sangat mendukung pelaksanaan Konwil di PII Aceh dilaksanakan di daerahnya. Menurut Gade Salam, salah satu bentuk dukungan itu adalah dengan menyediakan bangunan yang baru saja rampung di kompleks Pusat Perkantoran baru di kawasan Cot Trieng, Desa Manyang, Kecamatan Meureudu. Ketua Panitia Pelaksana Konwil PW-PII Aceh,Yusri Razali menyatakan, kegiatan yang

berlangsung selama lima hari, yakni 25-29 Februari diikuti sekira 30 peserta terdiri dari para Pengurus Daerah (PD) PII kabupaten/kota dan Pengurus Wilayah (PW ) PII Aceh plus para peninjau. Yusr i kepada kepada Waspada mengatakan, agenda utama Konwil adalah memilih ketua umum PW PII Aceh. Selain itu, Konwil dilaksanakan untuk merumuskan pola kebijakan organisasi internal maupun eksternal, membahas qanun jinayat yang hingga kini belum disahkan Gubernur Aceh, dan sederetan permasalahan lainnya yang muncul di berbagai daerah. Dalam kegiatan itu, panitia juga menggelar seminar pendidikan, kampanye gerakan pelajar cinta NKRI dan kampanye gerakan anti narkoba. Takhanya itu, juga dilaksanakan Muswil Badan Otonomi Brigade dan Korps PII Wati.

Meski semua agenda Konferensi dipusatkan di Aula Kantor Bappeda Pidie Jaya, namun pembukaannya berlangsung di Panggung Terbuka Mideuen Meurah Seutia, halaman Kantor Bupati Pijay persisnya di Pusat Kota Meureudu. DilaporkanYusri Razali, setidaknya ada lima kandidat bakal bersaing ketat merebut tampuk pimpinan di organisasi PW- PII Aceh. Mereka adalah Syahrul (mantan Ketua PII Pidie/Pijay), Alfajar (mantan ketua PII Aceh Besar), Aswadi (mantan Ketua PII Banda Aceh), Suryadi MZ (komandan brigade PII Aceh), serta Muhammad Iqbal. Disebutkan Yusri Razali, kelima kandidat calon ketua itu sejak dini telah memasang kuda-kuda untuk bersaing memperebutkan kursi ketua organisasi pelajar itu. Masingmasing calon punya dukungan tersendiri di daerah.(b09)

BLANGPIDIE (Waspa‘peduli’ terhadap pembinaan da) : Mentalitas dan Moraremaja dan kepemudaan di litas yang menghinggapi daerah saat ini, selain itu peran remaja dan pemuda di dapenting dari keluarga serta lingerah saat ini dianggap semakungan juga menjadi penentu kin mendekati dekadensi terhadap pengembangan kaserta reposisi yang cukup rakteristik mental para remaja mengkhawatirkan, infiltrasi dan pemuda. budaya serta arus komu“Saya sendiri juga sempat nikasi global yang sangat heran, kok bisa Pemkab Abdya kuat menjadi faktor kuat bersikap seperti itu dalam pemterhadap perubahan peribinaan remaja dan kepemulaku remaja dan pemuda daan, bahkan dalam sebuah sehingga cenderung mengiacara kepemudaan yang digelar Letkol Arm E.Dwi secara resmi oleh organisasi kis sikap dan jiwa nasioKaryono.AS pemuda juga minus peran nalisme serta budaya kebangsaan yang sebenarnya. Pemkab. Saya siap menjadi bapak angkat bagi Kondisi itu diungkapkan Komandan Kodim mere k a j i k a m e m a n g p e m k a b t e l a h 0110 Aceh Barat Daya (Abdya) Letkol Arm E.Dwi mengabaikannya dan saya harap juga ada Karyono AS kepada Waspada seusai penutupan kepedulian dari pihak lain tanpa harus mengacara perkemahan pramuka yang berlangsung gantungkan diri kepada pemkab yang seperti di komplek Makodim 0110 Abdya, Minggu (26/ memang tidak memiliki tujuan yang jelas dalam 2), menurut Dandim selain karena faktor program pembangunan karakteristik kebanginfiltrasi budaya luar serta komunikasi global saan di sini,” tukas Vian. yang semakin tinggi, kurangnya pembinaan Kodim Gelar Perjusami Se-Abdya terhadap para remaja dan pemuda dari pemeMasih terkait kondisi itu, Kodim Abdya rintah daerah juga menjadi penyebab semakin menggelar acara kepramukaan yang diikuti oleh lemahnya peran remaja dan kepemudaan seluruh wilayah binaan di semua kecamatan dalam peningkatan eksistensi budaya yang dengan melakukan beragam kegiatan. Acara berkarakteristik kebangsaan. dimulai pada hari Jumat (24/2) dan ditutup pada “Kita jelas sangat menyesalkan terhadap hari Minggu (26/2) dikuti ratusan peserta. Acara sikap pemerintah daerah yang terkesan menga- Perkemahan Jumat Sabtu Minggu atau disingkat baikan pembinaan terhadap remaja dan kepe- PERJUSAMI itu menfokuskan terhadap mudaan, sehingga peran mereka (remaja dan pembentukan karakter serta kreatifitas para pemuda) sedikit terlihat kecil dan tidak terlalu remaja yang tergabung dalam seluruh Kwartir menonjol, ini menjadi tanda tanya yang sangat Pramuka yang menjadi binaan Koramil yang besar bagi kita disini kenapa sikap pemerintah berada di seluruh kecamatan di Abdya. daerah terlalu mengesampingkan pemba“Acara perjusami ini diikuti oleh seluruh ngunan mental serta pembinaan kepemudaan, Kwartir Pramuka Saka Kartika yang selama ini padahal potensi mereka sangat besar jika dibawah binaan kodim 0110 Abdya, kegiatan memang diberikan peluang untuk mengem- ini menitik beratkan terhadap pengembangan bangkan diri dan kreatifitas,” tutur Dandim karakter dan mentalitas diri yang disiplin serta Letkol E.dwi karyono.AS. religius, namun kita juga mencoba mengemMenyikapi kondisi tersebut, Dandim yang bangkan kreatifitas dari setiap potensi yang memiliki sapaan akrab Bang Vian menyerukan mereka miliki,” jelas Lettu Inf .Tomi Marantika, agar adanya peran aktif dari pihak lain selain panitia pelaksana PERJUSAMI Kodim 0110 pemerintah daerah yang dinilai tidak begitu Abdya. (cb05)

Peserta Ujian Tulis TPBI 5.377 Siswa BANDA ACEH (Waspada): Hasil evaluasi akhir pelaksanaan Tes Penjajakan Bidang Ilmu (TPBI) di Unsyiah menunjukkan jumlah pesertanya mencapai 5.377 orang. Calon peserta ujian tulis TPBI tersebut terdiri atas kelompok IPA 4.573 orang, dan IPS 804 orang. Menurut Kepala Humas Unsyiah A. Wahab Abdi, Sabtu (25/2), menyebutkan, jumlah itu hampir memenuhi kuota yang disediakan di Unsyiah yang jumlahnya 5.960 orang, terdiri atas kelompok IPA 4.600 orang, dan IPS 1.360 orang. Kata dia, dibandingkan tahun 2011, jumlah peserta Ujian Tulis TPBI tahun ini meningkat tiga kali lipat. “Tahun lalu jumlah peserta TPBI hanya 1.800 orang,” katanya. Wahab kepada para peserta ujian diharapkan dapat mengikuti ujian tulis TPBI dengan baik. Sebab, hasil ujian menjadi acuan dalam penerimaan calon mahasiswa jalur USMU Unsyiah. “Berdasarkan skor TPBI kita akan mengun-

dang mereka untuk masuk Unsyiah melalui jalur USMU,” Wahab Abdi. “Undangan nantinya ditujukan langsung kepada siswa yang bersangkutan, tidak lagi melalui kepala sekolah.” Wahab memberi contoh, jika peserta memperoleh skor terbaik dan ikut kelom-pok IPA, maka yang bersangkutan diundang untuk menjadi calon mahasiswa Unsyiah dan bebas memilih program studi apa saja dalam kelompok IPA. “Jadi hasil tes ini sangat berguna bagi siswa kelas III SLTA yang hendak melanjutkan pendidikan ke perguruan tinggi, walaupun bukan ujian masuk perguruan tinggi,” ujar Wahab. Ditambahkan, kalau pun belum ber-hasil memperoleh skor yang baik, ujian tulis TPBI dapat menjadi ajang try out bagi siswa SLTA, dan sekaligus untuk mengukur kemampuan mereka dalam mempersiapkan SNMPTN tahun ini. “Ini penting mengingat persaingan untuk masuk perguruan tinggi semakin ketat dari tahun ke tahun,” tambah Wahab. (b07)

Mahasiswa Keluhkan Ketiadaan Jaringan Internet Di UGL Kutacane KUTACANE (Waspada) : Kalangan mahasiswa yang haus akan informasi dan ilmu pengetahuan mengeluh. Kendati memiliki gedung yang terbilang mewah, namun fasilitas pendukung bagi mahasiswa di UGL masih sangat minim. ” Beberapa bulan lalu, mahasiswa di Universitas Gunung Leuser Kutacane, masih bisa bernafas lega karena masih ada jaringan internet , tapi itu pun hanya berlangsung satu bulan, setelah itu kembali gak jelas,” ujar Ari, salah seorang mahasiswa UGL Kutacane. Kami juga tak tahu, sambung Hendra, kenapa di tengah besarnya perhatian Pemerintah Aceh dan Pemkab Agara terhadap perkembangan dan kemajuan UGL yang disertai dengan pengucuran dana yang sangat besar, malah untuk kebutuhan mahasiswa seperti jaringan internet saja, rasanya jadi sulit terpenuhi dan bisa disebut mustahil Padahal, bila menilik kebutuhan mahasiswa akan informasi dan bahan-bahan kuliah yang diperlukan, ditambah dengan jumlah mahasiswa yang melebihi 5.000 orang, keberadaan jaringan internet sangat dibutuhkan. Dengan adanya jaringan internet biaya mahasiswa untuk memenuhi kebutuhan bahan kuliah semakin murah dan semakin gampang. Namun sayangnya, urai Indra, meski mahasiswa jumlahnya mencapai lima ribuan, gedung juga terbilang mewah dan perhatian pemerintah

sangat besar, untuk memasang jaringan internet saja tampaknya tak ada kepedulian dari pihak kampus. Akibatnya, sebagian besar mahasiswa yang ingin mengakses dan data dan informasi terkait masalah bahan kuliah, terpaksa mengungsi mencari lokasi yang menyiapkan jaringan WiFi, bila tidak di warnet maka mahasiswa akan lari. Seharusnya, timpal mahasiswa lainnya, bila pihak rektorat dan badan pengurus harian serta pihak yayasan menaruh kepedulian terhadap kualitas lulusan UGL, pemasangan WiFi di Kampus UGL tak perlu ditanyakan dulu baru dipasang karena itu sudah menjadi kebutuhan pokok mahasiswa. Rektor Universitas Gunung Leuser (UGL) Kutacane Prof Dr Hasnudi ketika dikonfirmasi via telepon selular, Kamis (23/12) mengatakan, belum terpasangnya jaringan internet berupa WiFi di kampus UGL Kutacane, karena ada syarat yang tak mampu dipenuhi pihak kampus. Pihak Telkom, kata Hasnudi, meminta syarat pihak Kampus membeli perangkat HP Flexi minimal 1.000 unit. Hal itu akibat adanya MoU antara pihak kampus dengan Telkom Aceh dan syarat itu sulit terpenuhi. ”Jadi nanti kami pasang sendiri WiFi dan untuk itu sedang kita persiapkan, tenang aja pak,’’ kata Hasnudi kepada Waspada melalui SMS yang dikirimkannya, Kamis (23/2). (b26)

Polres Aceh Singkil Gelar Penyegaran Sejumlah Jabatan SINGKIL UTARA(Waspada): Kapolres Aceh Singkil AKBP Bambang Syafrianto, SIK menggelar penyegaran sejumlah jabatan dijajarannya ditandai dengan Sertijab, Kamis (23/2) di Aula Mapolres Kampuang Baru, Singkil Utara Serah terima jabatan(Sertijab) belasan perwira yang dipercaya mendapat jabatan baru dengan pejabat lama dilaksanakan Wakapolres Kompol Asep Iskandar di Aula Mapolres secara singkat dan sederhana Para perwira yang diberi kepercayaan jabatan baru masing-masing, Kompol Baik Tarigan sebagai Kabag Sumda Polres Aceh Singkil menggantikan AKP Ishaq yang dimutasi menjadi Kabag Sumda Polres Aceh Tengah AKP M Nasir sebagai Kabag Ren Polres Aceh Singkil, sebelumnya Kapolsek Singkil, AKP M Ali Hasan sebagai Kapolsek Singkil sebelumnya Kasat Pol Air. Iptu Antoni Tarigan sebagai Kasat Pol Air Polres Aceh Singkil sebelumnya Kapolsek Suro, Ipda Asmadi Kapolsek Suro sebelumnya KBO

kasatres Narkoba Polres Aceh Singkil AKP Saiful Hadi, SE sebagai Wakasat Intelkam Polresta Banda Aceh sebelumnya Kasat Intelkam Polres Aceh Singkil, AKP Zainudin, SPd, Kasat Intelkam Polres Aceh Singkil sebelumnya Kasat Intelkam Polres Langsa. AKP Haryono, SE sebagai Kasat Sabhara sebelumnya Kapolsek Simpang Kanan, AKP Masril sebagai Kassubag Bin Ops Bag Ops Polres Aceh Selatan sebelumnya Kabag Sabhara Aceh Singkil Iptu Firdaus, SPd sebagai Kapolsek Simpang Kanan sebelumnya Kapolsek Kota Baharu, Ipda Dwikora David sebagai Kapolsek Kota Baharu sebelumnya KBO Sat Intelkam Polres Aceh Singkil. Kemudian Iptu M Ismail sebagai Kasubbag Progar Bag Ren Polres Aceh Singkil sebelumnya Kapolsek Pulau Banyak dan Ipda Samsuar sebagai Kapolsek Pulau Banyak sebelumnya Wakapolsek Singkil. (b27)



Kasus Pencurian 1 Kg Emas Di Pantonlabu Dinilai Janggal

Pelajar SMP Bireuen Ikut Try out BIREUEN (Waspada): Sebanyak 5.472 pelajar SMP di 17 kecamatan di Bireuen, Sabtu (25/2)-Minggu (26/2), mengikuti try out di sekolahnya masing-masing, untuk persiapan menghadapi Ujian Nasional (UN), yang dilaksanakan Dinas Pendidikan Kebudayaan Pemuda dan Olahraga (Disdikbudpora) kabupaten setempat. Sekretaris Disdikbudpora Bireuen, NasrulYuliansyah kepada wartawan, Jumat mengatakan, try out yang diikuti pelajar SMP untuk melihat kemampuannya menjelang mengikuti UN dalam waktu dekat ini. “Semoga pelajar yang mengikuti try out ini dapat memberi ilmu tambahan untuk mengikuti UN nanti, makanya kita harap pelajar mengikutinya dengan serius,” imbuhnya, seraya menambahkan, mata pelajaran try out, Sabtu Bahasa Inggris dan Bahasa Indonesia, Minggu, Matematika dan IPA. (cb02)

H Muchtar Yusuf Paratex Kembali Geuchiek Pulo Ara Geudong Tungoh BIREUEN (Waspada) : H Muchtar Yusuf Paratex terpilih kembali secara aklamasi untuk memimpin Desa Pulo Ara Geudong Teungoh Kecamatan Kota Juang priode 2012-2018. Pilkades Pulo Ara Geudong Teungoh turut dihadiri dan disaksikan Camat Kota Juang Dahlan,SE, Sekcam, Kasi Pemerintahan, unsur Muspika Kecamatan Kota Juang dan Tuha Peueut, Tuha Lapan desa setempat. Hasil penghitungan suara yang dilaksanakan panitia pukul 14:00 hingga pukul 15:15 dari 1.256 pemilih yang hadir memberikan suara di tiga TPS dalam Pilkades yang digelar di Meunasah desa setempat Sabtu (25/2), sebanyak 1.211 pemilih masih memberikan kepercayaan kepada H Muchtar Yusuf Paratex untuk memimpin Desa Pulo Ara Geudong Teungoh. Sedangkan rivalnya Zulfikar MH SPd hanya meraih 145 suara. H Muchtar Yusuf Paratex menjawab pertanyaan Waspada menyatakan bersyukur dan berterima kasih kepada segenap lapisan masyarakat Desa Pulo Ara Geudong Teungoh yang masih memberikan kepercayaan kepadanya untuk memimpin desa kedua kalinya. (b12)

Waspadai Bencana Alam, PKS Rekrut Relawan KRUENG GEUKUEH (Waspada): Mewaspadai bencana alam yang rentan terjadi akhir-akhir ini, Dewan Pengurus Daerah Partai (DPD) PKS Aceh Utara melakukan rekrutmen relawan penaggulangan bencana. Acara dipusatkan di Komplek PT AAF Krueng Geukueh, Aceh Utara, 25-26 Februari. Ketua DPD PKS Zukarnaini kepada Waspada, Minggu (26/ 2) mengatakan, untuk meningkatkan partisipasi masyarakat dalam penanggulangan bencana, maka pihaknya merekrut relawan. Dalam rekrutmen ini, PKS menjaring sebanyak 60 relawan dari berbagai kecamatan di Aceh Utara. “Setelah pendaftaran, mereka langsung kita berikan pelatihan, baik dalam bentuk teori maupun fisik selama dua hari, sejak Sabtu. Pelatihan ini bertujuan, agar mereka menjadi relawan yang profesional dalam menangani becana. Karena relawan itu tak mesti kuat fisik, tapi mereka harus punya ilmu pengetahuan tentang bencana alam,” sebutnya. Pelatihan itu diisi pemateri dari unsur TNI, Tagana dan PMI. Menjawab Waspada, Zulkarnaini yang didampingi Ketua Pantia Luthfi Ali berpesan kepada peserta, menjadi relawan merupakan pekerjaan yang mulia sebagai bentuk kepedulian terhadap sesama, dalam meringankan penderitaan korban bencana alam. (cmk/b16)

Dua Warga Subulussalam Pasien Perdana RSIA SUBULUSSALAM (Waspada) : Menyusul peresmian pembukaan pelayanan kesehatan Rumah Sakit Ibu dan Anak (RSIA) Kota Subulussalam oleh Wali Kota Subulussalam Merah Sakti, Kamis (23/2), Suti, pemakai Kartu Jaminan Kesehatan Aceh (JKA) dan Riska pemakai Kartu Jaminan Kesehatan Masyarakat (Jamkesmas) menjadi pasien perdana di rumah sakit itu. Riska, 4, putri kedelapan pasangan Rustam, 45, dan Sarinah, 35, menderita kaki membesar dan Suti, 25, terancam buta. Pasien warga Desa Pegayo, Kec. Simpang Kiri, Subulussalam ini masuk ke RSIA didampingi Dewan Kesehatan Rakyat (DKR) Rafandi. Riska dan Suti dibawa ke ruang IGD untuk mendapat pemeriksaan ringan sejumlah dokter dan perawat. Tampak di sana Direktur RSIA dr Asman Tinambunan. Pihak RSIA berjanji dalam waktu dekat melakukan penanganan pasien lebih serius setelah kelengkapan laboratorium dan lainnya betul-betul berfungsi, meski Suti dipastikan harus ditangani khusus dokter spesialis mata. Ditegaskan, sembilan dokter umum ditambah perawat dan tenaga medis lainnya, RSIA tipe C itu cukup ideal. “Akan ditambah empat dokter spesialis,” kata Asman. (b28)

Petani Pante Karya Butuh Bibit Tanaman PEUSANGAN SIBLAH KRUENG (Waspada) : Desa pegunungan terpencil Pante Karya di Kecamatan Peusangan Siblah Krueng, salah satu desa pegunungan terpencil dari 608 desa di 17 kecamatan di Kabupaten Bireuen. Desa yang berpenduduk 185 KK (925 jiwa) mayoritas petani miskin yang menggantungkan hidupnya dari hasil pertanian pelawija, tanaman perkebunan, pinang, coklat dan sawit. Masyarakat sangat mendambakan bantuan pemrintah untuk membangkitkan petani miskin yang masih lumpuh terkena imbas konflik beberapa tahun lalu. “Pemerintah baru-baru ini memberikan bantuan bibit pohon sengon, kami tolak. Pasalnya, bibit pohon hutan itu tidak bermanfaat bagi petani, kondisi hutan di desa pegungan terpencil Pante Karya masih lestari. Bantuan bibit pohon sengon ke desa Pante Karya sama halnya menabur garam ke laut. Laut memang sudah asin tak perlu diasinkan lagi. Demikian juga hutan di desa pegunungan Pante Karya masih tetap terjaga kelestariannya belum perlu pohon penghijauan,” kata Geuchiek Pante Karya Zulkifli Latif. Dia mengemukakan hal itu saat menyampaikan laporan tentang kondisi desa di hadapan Bupati Bireuen pada peresmian jembatan gantung bantuan PNPM (Program Nasional Pembangunan Masyarakat), Kamis (23/2). Geuchiek Zulkifli Latif menyampaikan harapan petani miskin Pante Karya agar pemerintah dapat membantu bibit tanaman pertanian dan perkebunan yang bermanfaat bagi petani untuk membangkitkan sector pertanian dan perkebunan. Bupati Bireuen Nurdin Abdul Rahman menyambut baik harapan petani dan Geuchiek soal retribusi PAD galian C akan dipertimbangkan untuk desa Pante Karya. (b12)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


WASPADA Senin 27 Februari 2012

Waspada/Mustafa Kamal

RAZIA SENPI ILEGAL: Seorang petugas keamanan dari Polresta Lhokseumawe sedang memeriksa tas salah satu penumpang bus dari arah Medan di depan Mapolres setempat. Razia ini rutin digelar seiring keluar maklumat Kaploda Aceh melakukan razia senjata api (senpi) ilegal sejak 21 Februari lalu yang diperkirakan masih banyak beredar Aceh. Foto direkam, Jumat (24/2) malam.

Hasil Produksi Gas Exxonmobil Dipertanyakan LHOKSEUMAWE (Waspada): 50 Persen dari 500 ribu jiwa penduduk Kabupaten Aceh Utara miskin. Padahal, Aceh Utara merupakan daerah tempat berdirinya berbagai proyek vital, karena itu, hasil produksi gas yang telah dieksplorasi Exxonmobil selama 30 lebih dipertanyakan. Pasalnya, perusahaan raksasa itu tidak pernah mempublikasikan berapa jumlah produksinya selama ini. Harusnya, dengan adanya Exxonmobil, jumlah angka kemiskinan dari tahun ke tahun dapat ditekan, dengan memanfaatkan dana pembinaan lingkungan secara optimal. Dana tersebut dapat dipakai untuk pemberdayaan ekonomi, pendidikan, kesehatan, dan melaksanakan pembangunan yang tepat dan berhasil guna. Memang, pengentasan kemiskinan merupakan tanggungjawab pemerintah, tapi secara moral Exxonmobil harus bertanggungjawab. Pada era tahun 1970-an, masyarakat menyerahkan sawah dan ladang mereka kepada perusahaan minyak dan gas tersebut dengan harapan akan terciptanya kemakmuran. Memang, secara seremonial, Exxonmobil telah memberikan berbagai bantuan kepada masyarakat, seperti pembangunan rumah ibadah, sunatan massal, beasiswa serta bantuan lainnya. “Saya menilai, bantuan yang diberikan selama ini belum tepat dan berhasil guna. Kalau sudah tepat, tentunya sekarang ini, sudah banyak masyarakat yang sejahtera. Tapi apa

yang terjadi, data dari BPS yang saya baca beberapa waktu lalu, 50 persen dari 500 ribu jiwa masyarakat Aceh Utara miskin. Ini merupakan hal yang aneh, karena Aceh Utara itu ladang gas,” kata Muhammad Husein, mantan aktivis Unimal dan pemerhati sosial, Minggu (26/2). Untuk pendidikan, harusnya Exxonmobil membangun fakultas pertambangan atau menyekolahkan anak-anak Aceh ke luar negeri bidang ekspolitasi Migas. Sehingga ke depan, putra-putri Aceh dapat mengetahui berapa banyak kandungan gas yang bersemanyam di perut bumi yang mereka tempati. “Harusnya, dana pembinaan lingkungan dapat dipergunakan untuk hal ini. Kita juga tidak tahu, berapa banyak dana tersebut. Hasusnya dana ini dipublikasi, biar masyarakat tahu. Dalam UU, setiap tiga bulan sekali, ada laporan dari pertambangan dan energi dan Pemerintah Aceh, berapa sebenarnya keluaran hasil produksi gas di Exxonmobil. Kemudian disebutkan, berapa jatah Aceh dan berapa jatah Pusat. Informasi ini sangat tertutup. Kalau saya jadi gubernur, sehari 7 kali panggil orang Exxon,” kata M. Husein. Agar ini dapat dijalankan, Pemda Tingkat Dua, dan Pemerintah Provinsi Aceh, serta pihak dewan berhak mempertanyakan hal itu, meskipun itu merupakan kewajiban Pemerintah Pusat. DPR dan pemerintah jangan hanya terima tiket pesawat dan hotel atau royalti lainnya.

Untuk menjalankan misi ini, Indonesia boleh merujuk kepada Malaysia. Petronas sekarang ini dijalankan putra-putri terbaik mereka. “Kalau mau, Indonesia juga bisa melakukan hal ini, kita hadirkan pakar dari UI dan dari Petronas atau dari Kanada. Hal ini tidak mustahil untuk dilakukan jika ada kemauan,” katanya. Saat ini, PT Arun NGL dan Exxonmobil menginformasikan kepada semua orang, kalau gas di Aceh Utara habis pada tahun 2014. Pernyataan ini tidak ada yang mampu memberikan satu jaminan yang pasti, kalau gas benar-benar habis. Kebenaran informasi itu tidak bisa kita ketahui karena keterbatasan ilmu pengetahuan. Karena itu, Kepala daerah yang terpilih pada Pemilukada mendatang, jangan asyik memikirkan perut dan partainya saja. Armia Ramli, Humas Exxonmobil, Minggu (26/2) siang ketika dikonfirmasi persoalan di atas mengatakan, semua hal itu sudah ada aturan main yang baku. Tidak mungkin Exxonmobil bisa masuk Indonesia jika tidak mengikuti aturan yang telah ditentukan. Karena itu, alangkah baiknya, semua kita bisa berpikir terbalik. Tentang hal itu, Pemerintah Republik Indonesia lebih mengerti.“Coba anda pikirkan, apakah anda bisa pergi keluar negeri, tanpa mengikuti aturan di negara tujuan tersebut. Dan jatah yang diberikan kepada pemerintah tidak dikurangi Rp5 pun. Karena semuanya mengikuti aturan,” kata Armia Ramli. (b18)

Populasi Nyamuk Meningkat Tajam Di Pantonlabu PANTONLABU (Waspada): Populasi nyamuk di seputaran Pantonlabu, ibukota Kecamatan Tanah Jambo Aye, Aceh Utara, dilaporkan meningkat tajam dalam dua pekan terakhir. Warga mulai resah. Mereka minta Dinas Kesehatan segera menurunkan tim untuk melakukan pengasapan atau fogging. Amiruddin, 35, salah seorang warga Dusun I Pantonlabu, kepada Waspada, Minggu (26/2) menyebutkan, nyamuk yang muncul mendadak dalam dua pekan terakhir itu kebanyakan berbadan mungil dan sa-

ngat liar seperti nyamuk yang sering ditemukan di hutanhutan. “Kalau menggigit, posisi badannya tegak dan gigitannya terasa sangat gatal. Parahnya lagi, nyamuk ini seperti tidak mempan dengan obat anti nyamuk. Mereka tidak mati atau pergi meski seisi rumah sudah penuh dengan kepulan asap obat nyamuk,”imbuh Amiruddin. Keluhan serupa disampaikan Razali, 46, Kepala lorong IV Pantonlabu dan Abdul Rafar, 34, warga Desa Samakurok, desa

tetangga Pantonlabu. Ditemui terpisah, keduanya sepakat minta Dinas Kesehatan Aceh Utara segera menurunkan tim untuk melakukan fogging atau pengasapan di titik-titik yang dicurigai sebagai sarang jentik nyamuk. “Kalau kondisi ini dibiarkan, kita khawatir warga, termasuk anak-anak, rawan kena penyakit. Apalagi, beberapa jenis penyakit berbahaya, termasuk Demam Berdarah Dengue (DBD) dan Malaria, katanya tertular lewat gigitan nyamuk,”pungkas Razali.(b19)

Air Terjun Aceh Utara Kurang Terawat LHOKSEUMAWE (Waspada) : Objek wisata Blang Kulam yang dikenal dengan keindahan air terjunnya, kini kondisinya sangat memprihatinkan karena tidak terawat. Padahal objek wisata yang terletak di Desa Sidomulyo, Kec. Simpang Kramat, Aceh Utara tersebut memiliki daya tarik dengan tidak menepikan nilai-nilai Islami. Objek wisata tersebut keberadaannya kini antara ada dan tiada, karena masyarakat luar Kota Lhokseuamawe dan Aceh Utara atau luar Aceh, bahkan turis mancanegara sekalipun masih melihat objek wisata itu sebatas sungai atau DAS biasa. ”Sebenarnya saya ingin mempromosikan, tapi dilematis,” ucap Duta Pariwisata Aceh Utara, Vivi Angraini, kemarin. Manurut Vivi, objek wisata Blang Kulam sangat indah, baik sisi air terjunnya mencapai 75 meter, air sungai yang bening, kicauan burung yang riuh, pepohonan yang masih lebat dan hijau. Semua itu, apabila masyarakat serta stakeholder komit mengembangkan, Vivi yakin pertumbuhan ekonomi masyarakat di sana bisa tumbuh pesat. Lanjut Vivi, tidak ada alasan

PANTONLABU (Waspada): Kasus pencurian 1 kilogram emas dari brankas atau lemari besi Toko Emas Delima Jaya, di jalan Tgk Chik Di Tiro, Pantonlabu, Kecamatan Tanah Jambo Aye, Aceh Utara, yang terjadi Rabu (22/2) lalu, dinilai janggal. “Lemari besi tidak bisa dibuka begitu saja. Ada sandi rahasia atau kode tertentu yang hanya diketahui pemiliknya atau sipengunci. Jadi agak aneh jika maling bisa tahu kode rahasia itu,”kata seorang pedagang yang juga memiliki lemari besi di Pantonlabu, Minggu (26/2). Menurut pria yang tak ingin namanya disebutkan ini, kalaupun maling mengantongi kuncinya, lemari besi tetap saja tidak bisa dibuka tanpa kode rahasia. “ Misalkan kodenya 1234. Kalau salah satu angka ini salah, maka lemari tidak akan terbuka secara normal,”imbuhnya. Seperti diketahui, Toko Emas Delima Jaya

Pantonlabu dibobol maling, Rabu (22/2) dinihari. Pelaku dilaporkan berhasil membawa kabur sekitar 1Kg emas yang sudah diolah menjadi aneka perhiasan. Emas ini disimpan dalam brankas atau lemari besi. Usman, 30, pengelola sekaligus penjaga toko, mengaku, kunci brankas itu selalu disembunyikan dalam sampah dekat etalase atau lemari kaca tempat memajang perhiasaan emas ketika toko dibuka. Kunci ini, kata Usman, ditemukan oleh maling, sehingga brankas bisa dibuka secara normal. Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Marzuki, mengatakan, polisi sudah memeriksa sejumlah saksi terkait kasus itu, termasuk pengelola sekaligus penjaga toko, Usman. Namun sejauh ini, identitas tersangka belum teridentifikasi. “Masih proses penyelidikan,”kata AKP Marzuki via telefon, kemarin siang.(b19)

Diduga Terlibat Kasus Korupsi

Warga KDSP Jalan Siap Laporkan Geusyik Ke Polisi SEUNUDDON, Aceh Utara (Waspada): Masyarakat Keude Simpang Jalan (KDSP), Kecamatan Seunuddon, Aceh Utara menolak tawaran Camat untuk mengeluarkan nota dinas (ND) kepada Jailani JB. Masyarakat meminta Jailani JB segera dicopot dari jabatan sebagai Geusyik Gampong KDSP Jalan. Fadli Amsa, tokoh Pemuda Gampong KDSP Jalan kepada Waspada, Jumat (24/2) siang melalui telepon mengatakan, masyarakat tidak bisa memaafkan kesalahan yang diperbuat Jailani JB, karena dinilai sudah keterlaluan. Kesalahan berbagai kesalahan telah diperbuatnya, mulai dari utang piutang dengan gampong, menggadaikan sepedamotor dinas hingga menilep dana bantuan pembangunan meunasah. “Kita tidak bisa terima perbuatannya itu. Kalau memang camat dan Kabag Pemkim dan Gampong tidak mampu menyelesaikan persoalan ini, maka kami semuanya sepakat untuk melaporkan indikasi kasus korupsi yang dilakukan Jailani JB ke pihak Kepolisian,” kata Fadli Amsa diamini Muhammad Nasir Is, tokoh masyarakat gampong itu. TM. Yakop, Kabag Pemkim dan Gampong ketika dikonfirmasi Waspada, Jumat (24/2) via telepon membenarkan, kalau pihaknya telah

meminta bantuan camat menyelesaikan perkara tersebut di tingkat kecamatan. Setelah didudukkan ke dua pihak, ternyata tidak menghasilkan solusi, karena masyarakat menolak tawaran yang diberikan. Kata TM, untuk memecat geusyik dari jabatannya butuh proses hukum yang panjang. Dalam qanun No.4 Tahun 2009, disebutkan, geusyiek dilarang melakukan KKN. Dengan adanya dugaan indikasi korupsi, jabatan geusyik tidak bisa dicopot dengan serta merta, karena harus lebih dulu menjadi terdakwa. “Kita sudah sarankan, agar persoalan ini dapat diselesaikan secara kekeluargaan. Kalau dilanjutkan ke meja hukum, nantinya dapat terputusnya talisilaturahmi, apa lagi tinggal satu kampung. Selain itu, dapat merugikan waktu, karena harus memenuhi panggilan menjadi saksi-saksi,” kata TM. Seperti diberitakan sebelumnya, timbulnya reaksi masyarakat Gampong Keude SP Jalan akibat adanya dugaan korupsi bantuan meunasah yang dilakukan Jailani JB. Sementara itu Jailani mengaku dana bantuan telah lebih dulu dikomunikasikan dengan perangkat gampong dan dia mengaku tidak makan uang bantuan. (b18)

Ribuan Warga Bireuen Antri Buat Akte Kelahiran Blanko Kosong BIREUEN (Waspada): Ribuan warga Bireuen antri untuk buat akte kelahiran Blangko akte kelahiran di Dinas Kependudukan dan Catatan Sipil (Disdukcatpil) Bireuen, dalam dua hari terakhir ini. Sementara itu, blankonya kabarnya dalam tiga hari terakhir kosong karena belum dikirim dari Jakarta. Informasi diperoleh, ribuan warga Bireuen dalam tiga hari ini terus berdatangan ke kantor Disdukcatpil setempat untuk membuat akte kelahiran, namun yang diperoleh jawaban blanko habis. “Kami sekarang membutuhkan akte kelahiran, namun blangko di kantor Disdukcatpil habis,” kata Ari seorang warga setempat yang

diiyakan sejumlah warga. Kepala Disdukcatpil Bireuen, Muzakir Azis, melalui Kabid Pencatatan Sipil, Sulaiman kepada wartawan yang dikonfirmasi secera terpisah, tidak membantah ribuan warga Bireuen antri membuat akte kelahiran, namun pihaknya sudah mengajukan permohonan ke Jakarta untuk meminta dikirim blankonya, tapi hingga sekarang belum tiba ke Bireuen. “Sudah kita kirim permohonannnya ke Jakarta, sekarang ini warga yang hendak buat akte kelahiran mencapai 8 ribu orang,” katanya, seraya mengingatkan kepada warga yang belum memiliki akte kelahiran bila blanko telah dikirim dari Jakarta supaya membuatnya. (cb02/b17)

Ingin Merampas Sepedamotor Teman Sendiri Dibacok BANDAR JULI (Waspada) : Nasib naas menimpa Husaini,17, pelajar warga Bireuen Meunasah Reuluet, Kecamatan Kota Juang. Dia mengalami luka di bagian leher akibat dibacok oleh temannya sendiri berintial Zul, 16, dengan sebilah pisau saat berboncengan di kawasan Desa Batee Raya Kecamatan Juli, Jumat (24/ 2) malam sekira pukul 21:00. Kapolres Bireuen AKBP Yuri Karsono, SIK melalui Kapolsek Juli Iptu Saleh Amri yang dikonfirmasi Waspada, Minggu (26/2) membenarkan. Pelaku Zul setelah diditahan di Polsek Juli dan Sabtu (25/2) sudah dijemput petugas Polres. Dalam pemeriksaan pendahuluan, kasus pembacokan itu mengarah kepada perampasan sepeda motor, ujarnya. Korban Husaini dalam keterangannya kepada Waspada di ruang SMF Bedah RSUD Dr Fauziah Bireuen, Minggu (26/2) mengatakan, dia bersama Zul merupakan teman akrab se desa. Dia diajak Zul ke Batee Raya menghadiri pesta perakawinan di rumah temannya disana. Tanpa curiga dengan mengendarai sepedamotor Yamaha Jupiter Z, BL 5130 ZK Husaini

membongceng Zul langsung menuju Desa terpencil Batee Raya sekitar 7 km jaraknya dari Kota Bireuen. Tiba di kawasan sepi Zul menodongkan pisau ke lehar Husaini. Dalam kondisi terancam Husaini menghentikan sepeda motor menangkis todongan pisau Zul yang mencoba menggorok lehernya, sehingga terjadi duel antara keduanya dan Husaini berhasil merampas pisau di tangan Zul lalu dibuangnya di lokasi kejadian. Meski Husaini mengalami luka gorokan dibagian lehernya masih sadar langsung memacu kendaraannya meninggalkan Zul. Setiba di Poskamling Desa Alue Unoe yang bertetangga dengan desa Batee Raya Husaini minta tolong warga setempat dilarikan ke UGD RSUD Dr Fauziah untuk mendapat pertolongan medis. Muhammad Basyah,50, ayah korban yang ditemui Waspada di RSUD Dr Fauziah mengatakan puteranya Husaini merupakan teman karib sekampung, dan menurut keterangan putranya, Zul mencoba menggorok leher puteranya karena ingin merampas sepedamotor. (b12/ cb02)

Mutasi, 15 Kasek Jadi Guru Biasa

Waspada/Mustafa Kamal

PEMANDANGAN objek wisata air terjun Blang Kulam di Desa Sidomulyo, Kec. Simpang Kramat, Aceh Utara yang sangat indah. Namun, saat ini lokasi wisata ini tidak terawat baik. Foto direkam beberapa hari lalu. tempat wisata itu bertentangan dengan Syariat Islam, karena semua itu tergantung keseriusan pemerintah dalam menata sebuah objek wisata jangan sampai salah dimanfaatkan. Seperti membuat satu peraturan berkunjung, dan personel Sat-

pol PP dan WH disiagakan dan pemuda setempat dirangkul, serta dibuat pembatas pengunjung laki-laki dan perempuan. Kepala Bidang Pariwisata dan Kebudayaan Dishubbudpar Aceh Utara Nurliana saat ini belum bisa dihubungi. (cmk)

SUBULUSSALAM (Waspada): Mutasi di lingkup Dinas Pendidikan, Kebudayaan, Pemuda dan Olahraga (Disdikbudpora) Subulussalam, Jumat (24/2), 15 Kepala Sekolah (kasek), satu di antaranya SMP diberhentikan. Mereka menjadi guru biasa di tempat berbeda. Mereka, A Murad, Rizal U, Daili Amdar, Suryadi, Sugianto, Mawardi, Salmi, Suhada, M Amin, Jayari, A Hamid, Misbah, Suryati, Afipuddin dan Yusmar (SMP). Lalu 25 guru biasa menjadi kasek dan 16 kasek dirotasi pada jabatan serupa. 25 kasek itu, lima tingkat SMP yakni Asnizar Simpang Kiri 3, Tri Gunanto Longkib 2, M Husein Sultan Daulat 2, Buyung Berutu Penanggalan 3 dan Saidiman Sultan Daulat 1. Tingkat SD, Ali Nasir Suak Jampak, Saifullah Bakal Buah, Zulkifli Suka Maju, Siti Fadilah Pasir Panjang, Zarmawi Dah 4, Raimah Subulussalam 7, Yusro Jatmiko Bakal Buah 2, Jusniliarnis SP III Ginasing, Eko Wahyudi Muara Batubatu, Sumardi Sibungke, Sutik SP V Bukit Alim, Safril

Siperkas, Ulil Amri Sibuasan, Ismail Sahputra Binanga, Erwan Suak Jampak Lama, Syahadat Tualang dan Sofyan Sikelondang Tingkat TK, Helpi Lae Motong, Yulis Km 8 Kampung Badar dan Saridah Belegen Mulia. 16 Kepala SD dirotasi, Zairi Kampung Badar, Yazir Ahmad Subulussalam 4, Ernawati Bancin Pasir Panjang Makmur, Sabaruddin Lae Simolap, Upik Hadisah Jontor, Saidinnas Lae Saga, Siti Mulia Teladan Baru, M Amin SKPC Penuntungan, Burhanuddin Kuala Kepeng, Suriadi UPT XV Buluh Carak, Zulkiran SP II Namo Buaya, Asriyal SP II Sikerabang dan A Hamid Dah serta Mawariah TK Sada Kata dan Yanar SMP 2 Rundeng Pelantikan dan pengambilan sumpah oleh asisten II H. Azwir, mewakili Wali Kota Subulussalam di aula Setdako disaksikan Pabung Kodim 0109 Mayor Inf. M Saing, anggota DPRK dan Kepala Disdikbudpora Nurhayat dihadiri sejumlah Kepala SKPK dan undangan lain. (b28)

C4 O

1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive PS PW RT VR EW

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window


PROMO ASTRA DAIHATSU All New Xenia DP 15%, Terios, Gran Max Pick Up, 10x10 dan Sirion. Dapatkan Cash Back & Discount Besar Hub. 0813 6100 7907 & 0853 6103 1609

DAIHATSU Zebra MB 1.3 Dijual. Prima 21. Thn. 96, BK Medan, Tape, Velg Racing, cantik, jarang pakai. Harga 26Jt/Nego. Hub. 0812 6393 235

* DAIHATSU 100% BARU * Terios.........DP 20 Jt-an...........Angs. 4 Jt-an Xenia........DP 22 Jt-an...........Angs. 3 Jt-an Pick Up..... DP 7 Jt-an............Angs. 3 Jt Luxio......... DP 18 Jt-an..........Angs. 3,9Jt

Hub. PT Capella Medan (JOSUA) 0812 6311 0820

DAIHATSU Terios Warna hitam, Hub. 2007 Velg Racing, BK 3 angka. Pilihan Km. 4 Puluh Ribuan. Satu tangan. Harga 157Jt. Nego. Yang berminat Hub. 0812 6510 0389 DAIHATSU Xenia Thn. 2011 XI BK Mdn asli. Silver Tipe Famili Sangat mulus. Km. 800 Meter yang paling lengkap. HP. 0853 6232 8839. Pak Haji Rusno.

HONDA Freed, Thn. 2011, Hitam, 0852 7597 7335 M-ETERNA 91 BK 909 - EH. Warna Abu-abu (Original). Kondisi mulus sekali. Hub. 0821 6399 3022 MITSUBISHI Colt Diesel Dijual. 120 PS Truck 2005/2006. Bak Aceh (Tinggi) 1 tgn dari baru mobil cantik, terawat, siap pakai. Hub. 0853 6123 9899. Bisa Bantu Kredit.

MITSUBISHI BARU DISKON KANDAS T120ss, L300 FD, Colt Diesel, Dakar. Harga mulai 0%. DP kecil. Proses cepat. Hub. Anggun 0812 6477 8869

MITSUBISHI N-Lancer Dan Gan DOHC. Thn. 90. Rp. 27,5Jt Nego. HP. 0812 6027 130 MAZDA E2000 Th. 97. W. Merah metalic, AC DB, Tape, VR, BR, PS, PW, CL, BK Medna. Jok kulit, body kaleng, mulus seperti baru. Hub. 0813 6233 0595

OPEL BLAZER LT Injection Hitam Met Th. 96. Mulus, orisinil sekali, mesin sehat, AC Dingin, Hrg. 46Jt. Nego. Abis. Hub. 0812 64777088

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

SUZUKI Sidekick ‘96 Medan Asli, AC, Tape, Full musik, VR, SL, PW, Hijau Met, Mulus sekali HP. 0812.6424.995





Carry Pick Up...DP 10.1Jt Hadiah: CD Audio Mega Carry......DP 15.5Jt APV Arean........DP 19.4Jt KC Film & Aksesoris Splash...............DP 18.1Jt Hadiah: KC Film Swift ST..............DP 21.5Jt SX4....................DP 28.8Jt & Sensor Parking New Ertiga............Indent Proses Cepat, Data Dibantu Pasti OK! Hub: 0852 6114 6499 - 061 9110 0699


SUZUKI 100% BARU Pick Up, APV, Swift, Splash, Karimun, SX4 New Ertiga. Dapatkan Discount Special proses mudah data dijemput. Hub. 0812 650 7716, 0853 7305 0707

SUZUKI Carry Futura Pick Up. Thn. 2005. W. Hitam, mobil cantik. mesin sehat, seksi bagus. @ nego. Hub. 0812 6525 760

DEALER RESMI SUZUKI MOBIL Carry PU 1.5 FD. Rp. 9 Jt-an Angs. 2.696.000,APV PU. Rp. 16 Jt-an Angs. 2.743.000,Indent Suzuki Ertiga Sekarang Juga! Hub. 0812 654 0809 / 7772 2121 SUZUKI 100% BARU Carry PU, APV, Swift, SX-4, Splash, New Ertiga, Discount Special, Data Dijemput. 0812 8732 8287 TOYOTA Kijang LGX Capsul Th. 2001 W. Silver metalic, AC DB Tape, Full musik, VR,BR, PS, PW, CL. BK Medan. Body kaleng mulus seperti baru. Hub. 0813 9754 5210 TOYOTA Kijang Capsul. Th. 97. W. Biru metalic. AC, Tape, VR, BR, PS, CL, BK Medan asli, body kaleng mulus, seperti baru. H. Nego. Hub. 0852 6129 5788


Peralatan Bengkel Sepeda Motor Lengkap dengan Spare Part/Tinggal Buka Kompresor, Kunci-kunci BHS BU. Rp. 25.000.000 (Harga). Hubungi: HENDRA 0813 7005 7871 - 0812 6078 8312


- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

DICARI MOBIL OVER KREDIT APV/Avanza/ Innova/L200/Escudo Kontan Pun Ok! Hub. H. IPUL 0812 6038 5555





Hubungi Daeler SUZUKI


JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN * Jl. GURU PATIMPUS 11-D Simpang Jl. Kelapa TEL. 4151018 - 4535762 MEDAN

Pencairan 1 juta - 1 M. Tanpa Usaha. Proses 3 Jam cair. Jaminan: SHM, SK Camat, SKT, HGB. BPKB Spd. Mtr, Mobil truk (bantu pelunasan BPKB). Hub. 0813 7044 6633, 0813 7044 6668



Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat


Yang Butuh Bibit & Informasi Tentang Gaharu Hub. Pak Jamal di Tg. Morawa HP. 0813 7091 2113


Jl. Jemadi 67 Medan HP. 0813 6130 9280 - 0852 1369 9288






0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi


0821 6217 1934

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

UMROH MULTAZAM 1. 2. 3. 4. 5. 6. 7. 8.



(Untuk Ambeien)

Umroh Reguler 9hr, 13hr Bulan Maret - April - May Umroh dan Arbain di Madinah 20hr Umroh Plus Turkey - Awal April Umroh Plus Mesir - Bulan April Umroh Plus Jordan Aqsha - Bulan May Umroh Plus India Kashmir Umroh Plus Dubai ONH Plus/ Khusus Thn 2014

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar.

Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00Wib hr Minggu Pkl. 09.00-11.00 Wib Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE:

KANTOR PUSAT MULTAZAM MEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887












Mengobati: KANKER PAYUDARA, KANKER RAHUM, KISTA KANKER USUS, KANKER HATI, KANKER OTAK, TUMOR, DLL. ALAMAT: Jln. Pasar III Krakatau Gg. Mulia No. 14B Medan HP: 0821 6020 9118 (Bisa di panggil ke Rumah)






Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

Ultra Violet Tanwing (Australia) * Depot Mineral, RO dan HEXAGONAL * Menyediakan Mobil Tangki Air Pegunungan * Menyediakan Segala perlengkapan Depot * Menyediakan Teknisi Depot * Melayani pemindahan Depot






Pemasangan Depot Air Minum berkualitas dengan

TOYOTA Innva 2.0E Plus 2009, Hitam, Mulus, Lengkap, AC BR, VR, Pajak full 1 tahun, Harga 184Jt/ nego Hub. 0852.7054.4544



Cucu Asli Mak Erot Bersama


TOYOTA Avanza Thn. 2004-G. Biru met, mbl sangat mulus. Hrg. 108Juta Jl. Pimpinan No. 23 HP. 0812 630 1881

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

061-4576602. Terimakasih


TIMOR - D.O Thn. 97, warna hitam, BK Medan, aC, PW, PS, BR, Tape 1 CD, sangat mulus. Harga 43Jt/ Nego. Hub. 0812 6384 5941 STYLER D/P RINGAN KREDIT 1 s/d 4 TAHUN

Apabila anda mencurigai sesuatu, silahkan hubungi kami di


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI apabila anda ingin TI-HA dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA.



11 CM Rp. 165.000 12 CM Rp. 180.000

Pelanggan Yang Terhormat


TOYOTA Avanza Tipe W. Hitam Thn. 2007 Dijual. BK Medan Asli Rp. 130 Juta atau Kijang Super G. Short W. Biru met Th. 1995 1800cc Rp. 1,5Juta, dua2 nego. Hub. 0813 6227 1115 Jl. Amaliun No. 146 Dpn SD Kartini TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Th. 2002. Hitam met, mulus, VR, BR, PS, PW, CL, RMT, E. Miror, AC DB, Full sound Pake TV ada 3 bisa karaoke. Hrg. 136Jt. Nego. Hub. 0821 6312 2295

9 CM Rp. 126.000 10 CM Rp. 140.000

Senin, 27 Februari 2012


KRISNA WATER 1. Pemasangan Depot Air Minum Sistem

Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410




Keterangan lebih lengkap silahkan hubungi:



BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS W ANIT A: ANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333






Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


izin kejari: no. B.78/N.4.3/DSP.4/12/2008

Kami memberi bukti bukan janji alat vital besar dan panjang ditempat No. suntik No. silikon, murni tradisional ramuan alami dan Do’a. dijamin paten dan permanen, tanpa ada efek samping bebas pantangan untuk semua usia, ras dan agama.

Mahar terjangkau dan BERGARANSI.

Menjadikan alat vital keras kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, loyo dan kurang gairah kembali perkasa. Menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan dan menangani yang gagal di tempat lain.

Untuk Wanita: (Bisa Berdarah Lagi)

Terapi perawan/ virgin bisa langsung cek ke dokter. Menyembuhkan keputihan bau tidak sedap, ingin terasa gigit, payudara montok padat dan kenyal.


Sanggup atasi problem al: Ekonomi, bangkruk, terlilit utang rumah tangga sering cekcok, bubarkan perselingkuhan, buka aura, pelaris, berbagai macam susuk pengasihan pelet, dll. Praktek/ Alamat:

Praktek tetap Jl. SM. Raja depan Kampus UISU Gg. Khotib No. 3 Praktek mulai jam 08.00-12.00 Telp. 0812.6880.7666 - 0878.6767.6333






TERIMA PANGGILAN 0812.2822.4745

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop) Telp: (061) 91263040, 76553544

MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201


WASPADA Senin 27 Februari 2012

07:30 Bo On The Go 07:00 - KISS Pagi 08:00 Dink,The Little Dinosaurus 07:30 - Sinema TV Pagi I 09:30 - Hitzteria 08:30 Dink,The Little Dinosaurus 11:30 - Patroli II 12:00 - Drama Asia 09:00 New Chhota Bheem Aka (Korea): Bima Sakti Dong Yi 09:30 New Chhota Bheem Aka 13:30 - Drama Asia Bima Sakti (Korea): 10:00 Properties In HarmonyPink Lipstick Minggu 15:00 - KISS 10:30 Foody With Rudy 11:00 BRI Indonesia 16:00 - Fokus 11:30 Topik Siang (Live) 16:30 - Drama Asia 12:00 Klik ! Weekend (Korea): 13:00 Kampiun Sepakbola Miss Ripley Nasional 18:00 - Drama Asia: 13:30 Total Football Return Of 14:00 Mantap (Live) The Condor 15:00 Divisi Utama 2011-2012 Heroes 17:30 Topik Petang (Live) 19:00 Satria 18:00 Indonesia Super 20:00 - Tutur Tinular League 2011-2012 22:00 - Buaya Show 20:30 Kembali Bergoyang 22:30 Sinema Aksi The Land That 23:00 - Mega Asia Time Forgot Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan 00:30 Topik Malam (Live) 01:00Worlds Most AmazingVideos

07.00 Go Spot 07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Kabar Kabari 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30RHS(RahasiaHidup Selebriti) 18.00 Mimo Ketemu Poscha 19.30 Mega Sinetron : Yusra DanYumna 22.30 D’Journey 23.00 Box Office Movie Enf Of Days


07.00 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Cinta Dan Uya Sama Sama Kuya 17.00 Liputan 6 Petang 17.30 SCTV Musik Special Konser HBD Cherrybelle 19.30 SCTV Sinetron : Putih Abu Abu 20.30 Cahaya Gemilang 21.30 SCTV SInetron : Anissa Dan Anissa 22.30 Liputan 6 Terkini 22.03 SCTV FTV Utama Pengantinku Datang Dari Kota

07:00 Disney Club 08.00 Cerita Pagi 10.30 Di Antara Kita 11.00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15:30 Lintas Petang 16:00 Animasi Spesial 17.45 Animasi Spesial The Owl 18:00 Filler Didi Tikus 18.10 Shaun The Sheep 19:00 Fathiyah 20.00 Tendangan Si Madun 21.00 Si Miskin Dan Si Kaya 22.00 Dewi Dewi Show 00.00 Premier Highlights 00.30 Lintas Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports


07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 IBU 11:00 Insert 12:00 Go Go Girls 13:00 Jelang Siang 13:30 Reportase Siang 14:00 New Happy Family 14:30 Keluarga Minus 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 Bioskop TRANSTV Spesial 22:00 Bioskop TransTV : Never Say Never Again 00:00 Kakek-Kakek Narsis 01:00 Bioskop TransTV : Falling Down 03:00 Reportase Malam

06.30ApaKabarIndonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30SatuJamlebihDekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30ApaKabarIndonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend

08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Petualangan Panji 15:00 Berita Global 15:30 Fokus Selebriti 16:00 Top Banget 16:30 Tamu Gokil 17:00 Pat & Stan 17:30 Spongebob Squarepants 18:45 Indonesian Premier League 21:00 Big Movies 23:30 Movies

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Browniess 15:30 Asal Usul Flora &. . . 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam 00:00 Mata Lelaki 00:30 Sport7 Malam 01:00 Redaksi Ma **m31/G

Album Adele Saingi Soundtrack Bodyguard Adele berterimakasih dengan keberhasilannya meraup Grammy Awards membuat album ‘21’ nya bertengger di posisi nomor satu peta 200 tembangtembang top dunia terjual 237.000 copy pada mingguminggu awal bulan Februari.





Telp. (061) 882.8692 - 0852.7035.3438


(TEMPAT KURSUS TERBAIK DI MEDAN) Word + Excel............................................................. 200 Rb (2 minggu) Word + Excel + Internet..................................... 300 Rb (3 minggu) Ms. Office + Internet............................................... 450 Rb (1 bulan) Design Grafis (Komplit)........................................ 600 Rb (1 bulan) Autocad 2D, 3D.......................................................300 Rb (10 hari) Merakit komputer/ Installing............................ 400 Rb (6 hari) Bhs Mandarin............................................................ 500 Rb (Paket) Bhs Inggris................................................................... 400 Rb (Paket) Daftarkan lsg belajar, waktu bebas, Tanpa batas usia Jl. Sei Batang Hari No. 170 Medan Telp. (061) 844.2158 - Website:


LOWONGAN DICARI Tukang pangkas, Beragama Islam Hub. 0812.6314.9919 0813.7634.9719 APOTEK DENGAN SISTEM RETAIL

Komputerisasi membutuhkan: APOTEKER PENGELOLA APOTEK (APA) - Pria/ wanita, tamatan profesi Apoteker - Memiliki STRA - Memiliki jiwa kepemimpinan - Memiliki keahlian komputer Antar lamaran kerja & CV (Pasphoto uk. 4x6: 1 lbr) ke: Jl. Gajah Mada No. 2M - Medan Ruko berspanduk “Disini akan dibuka Apotek”, paling lama 29 Feb 2012


GURU/ TENTOR BIMBEL SD dan SMP (semua pelajaran) SMA, (Mate, Fisika dan Kimia) Lamaran dikirim ke: PRENTICE EDUCATION Jl. Gatot Subroto Komp. Makro BIsnis Centre Blok B No. 3 (samping Lotte Mart/ Makro) Medan HP. 0878.6990.3486


Kami perusahaan percetakan memerlukan beberapa tenaga kerja di Bidang SABLON, dengan syarat sbb: - Pria,max.30tahun(belumberkeluarga) - Tamatan min. SMA/ sederajat - Lebih diutamakan yang berpengalaman min. 2 - 3 tahun - Bertanggung jawab, Rajin, jujur, dan mampu bekerja sama Lamaran lengkap dikirimkan Via pos ke alamat: Jl. Timor No. 10 V V/ 43 Medan 20231 (Tidak melayani lamaran yang diantar langsung) Paling lambat 7 (tujuh) hari sejak iklan dipasangkan)


Untukpembukaankantorbaru,Perusahaan Industri,DevelopmentdanManagemenbisnis bukacabangdiMedan,membutuhkanSDM Potensial untuk berbagai Posisi: ADM/ Staf, Pembukuan, Gudang, Supervisor, Wakil & Kepala Cabang, syarat: - P/W Single, Usia max. 27 thn - Pend. minimal SMU/ SMK sederajat, Tidak sedang kuliah - Mengikutipelatihan(adakarir,bukankerja kontrak) - Bagi pelamar dari luar kota disediakan mess Segera datang langsung, bawa lamaran lengkap ke:


Jl. M. Nawi Harahap No. 23B Medan (dekat Simpang Limun) Tgl. 27 s/d 29 Februari 2012, Pukul 10.30-14.00 WIB TERBATAS & MENDESAK !!!


DIBUTUHKAN WANITA Umur 15 thn s/d 25 thn Muslim Fotocopy KTP Bekerja di warung nasi cita baru Tinggal ditempat

Jl. Sunggal Simp. Batang Hari No. 61 Medan HP. 0813.6107.2513 - 0813.9727.5212



Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

R UKO Dijual 2½ Tkt, Tnh 3,6x30m Jl. Klambir 5 dkt Galon 0852.7597.7335


- 25x12m, Jl. Letda Sujono masuk Gang ±60m, sebelum tol Mdn - 22x15m, Jl. Perwira depan Kodam Mdn Hub. 0813.7651.1726

DIJUAL/ DIKONTRAK Rumah bertingkat, Ukuran 14,5x22,5m, 4 KT + 3 KM Full keramik, Sertifikat Hub. 0812.646.5696


Rumah permanen, Siap huni Jalan AR. Hakim Gg. Kolam No. 16 Medan (dekat Pasar Impres), LT. 113m², 3 KT, 2 KM, Garasi, PLN, PDAM, Telp, SHM, Full keramik, Harga nego H u b T e l p ( 0 6 1 ) 7 3 2 2 . 9 1 9 H P. 0821.6396.2568 Tanpa perantara/ Agen


Uk. 10,4x18,3m, SHM Jl. Beringin Psr. VII Tembung Gg. Bacang No. 8 Hub. 0853.7375.5731, TP


hanya 8.000 unit penjualan. Tembang IWill Always Love You-nya Whitney Houston nongkrong di posisi ke 3 dengan 195.000 unit penjualan. Album Home Dierks Bentley berada di urutan ke 7 dengan penjualan 55.000 copy. Penjualan album keseluruhannya pada minggu awal bulan Februari total berjumlah 6,8 juta unit naik 17 persen dibandingkan dengan minggu sebelumnya hanya 5,8 juta keping dan naik 6 persen dibandingkan penjualan tahun 2011 berjumlah 6,4 juta unit. Penjualan track digital totalnya 28,9 juta downloads naik 10 persen dibandingkan minggu-minggu sebelumnya berjumlah 26,4 juta copy naik 8 persen jika dibandingkan dengan tahun 2011 berjumlah 6,4 juta unit. Nur/thr





Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Geisha di kampus IBBI diabadikan para penggemarnya.



HILANG/TERCECER TELAH TERCECER Sertifikat tanah Hak Milik No. 410 Desa Sambirejo, Kec. Binjai -Langkat A/n. Kusnadi, disekitar antara Sambirejo, KW, Begumit, Stabat, Hubungi HP. No. 0813 9723 3828. Bagi yang menemukan diberi hadiah sepantasnya.


1 (satu) buah BPKB No. C4309341B, A/n. Ihda Arsyahmarbun.Bagi yg menemukan harap hubungi: Zul No. 0813.6125.3222




Geisha Meet And Greet Di Kampus IBBI



TELP: 0821.6969.6868 - (061) 6969.6868

Taman Citra Mandiri, Jl. Karya Jasa Blok M No. 4, depan DIM Hub TP. 0812.6402.4004 1 unit Ruko di Jl. Babalan No. 106 P. Brandan (depan Bioskop Brandan Teatre) Hub. 0812.703.4030

albumVan Hallen 3 berada pada urutan satu de-ngan penjualan 179.000 copy pada minggu pertama pe-lemparannya ke pasaran. Kom-pilasi Now 41 berada di rangking ke 3 dengan 142.000 unit pen-jualan ketika album Scars & S tories’-nya Fray masuk di urutan nomor 4 dengan 87.000 keping penjualan. Sementara album Fray terbit tahun 2009 berada di puncak dengan penjualan 179.000 unit. Paul McCartney dengan tembang Kisses on the Bottom berada di rangking ke 5 dengan penjualan 74.000 unit di masa awal peluncurannya. Whitney Houston dengan album Whitney: The Greatest Hits masuk lagi di posisi 6 dengan penjualan 64.000 unit. Sedangkan debut Whitney Houston malah menurun sampai peringkat 72 dengan

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Rumah di Jl. Palem Raya Blok J No. 1 (Jl. Palem IV Ujung) Komp. Palem Kencana Jl. Binjai Km. 12, Posisi rumah disudut hubungi alamat diatas


Sementara album baru A Different Kind of Truth- Van Halen menduduki rangking dua terjual 187.000 keping. Adele memenangkan enam Grammy meliputi kategori album, rekaman dan tembang terbaik tahun ini. Ini merupakan penampilan Adele pertama sejak operasi kerongkongan tahun lalu. Dengan selama 20 minggu berturut-turut menempati rangking pertama 200 tanggatangga lagu top dunia menyaingi popularitas soundtrack film Bodyguard dilantunkan mendiang Whitney Houston

juga mencomot urutan ke satu 200 lagu-lagu hit dunia selama 20 minggu berturut-turut pada tahun 1992-1993. Adele juga berada pada posisi 9 dengan perangkat debut album ‘19’ terjual 36.000 copy atau meningkat 103 persen dari penjualan sebelumnya. Ini pertama kali bagi seorang musisi yang dua albumnya masuk dalam sepuluh besar 200 tembang-tembang populer dunia sejak 19 Maret 2011. Sementara Justin Bieber nongkrong di urutan ke 4 dan tembang Never Say Never: the Remixes (EP) dan My World 2.0 menduduki rangking ke 8. Mayor itas album Van Hallen masuk sepuluh besar 200 peta lagu hit dunia seperti Van Hallen II dirilis tahun 1979 berada pada posisi ke 6 dan

BPKB mobil Daihatsu BK 1119 DC, A/n. Syahril Harahap. Alamat Jl. Madio Utama Gg. Kalikwalik No. 27 Medan, No. BPKB : 5846168-B, bagi yang menemukan mohon diantar ke: Jl. Kutilang Gg. Kutilang 2 No. 6 Bandar Kalipa Tembung, tidak akan dituntut dan diberi imbalan yang sepantasnya




Kampus STIE-STMIK IBBI di Jalan Sei Deli Medan Sabtu (25/2) siang sontak heboh, pasalnya grup musik Geisha bertandang kesana mengadakan meet and greet. Kontan saja para mahasiswa maupun My Geisha lainnya yang mendengar kabar tersebut ramai-ramai menuju kampus IBBI. Informasi semula mereka akan datang pukul 11.00 ternyata diundur ke pukul 13.00, namun tak menyurutkan penggemar Momo dan kawankawantetapbertahansambilme-nyaksikanlomba karaoke digelar STIE-STMIK IBBI dalam rangka merayakan HUT-nya ke-16. Uniknya lomba karaoke ini diikuti tidak saja mahasiswa ataupun mahasiswi IBBI, tapi juga pelajar SMA lainnya yang ikut bertanding khusus membawakan lagulagu Geisha. Tepat pukul 13.00 rombongan grup band Geisha yang memang sudah lama dinanti pun tiba di kampus IBBI. Karuan saja suasana heboh pun tak terelakkan, hingga memaksa petugas keamanan kampus mengamankan situasi, tapi tetap saja fans Geisha mengambil kesempatan untuk foto bareng termasuk para karyawan kampus IBBI yang tampak begitu bersuka cita menyambutkan kedatangan Momo bersama teman-temannya. Menurut Romi Aji Setiawan selaku humas IBBI menyebutkan, kegiatan meet and greet bersama Geisha memang digelar dalam rangka

hut IBBI ke-16. Banyak kegiatan dilakukan sejak awal bulan Februari diantaranya pertandingan Futsal, lomba pidato bahasa Inggeris, Indonesia dan Mandarin, pertandingan catur, modern dance sampai pemilihan Putra-Putri IBBI 2012. Puncak HUT IBBI ke 16 bakal diadakan bulan April mendatang dimeriahkan grup band Geisha berlangsung seharian penuh di Pardede Hall Medan, sementara saat acara meet and greet bersama Geisha turut dihadiri antara lain Ketua HUT IBBI Lusiah,SE,MM,Wakil Ketua III STMIK IBBI Andriasan Sudarso,SMn,MM danWakil Ketua II STIE Budijanto,SSi,Msi. Momo sendiri dihadapan para penggemarnya sempat menyanyikan satu lagu hitsnya secara acapella, begitu juga para peserta lomba karaoke tak mau kalah ikut membawakan satu lagu yang membuat Momo tersipu, karena re-maja tersebut begitu fasih melantunkan lagunya hingga Robby sang penulis lagu ikut berduet dengan remaja tersebut bernama Johana. Disela-sela kehebohan suasana, Momo menyebutkan, tidak menduga bakal mendapat sambutan meriah di Kampus IBBI.Tapi dia sendiri menyatakan sangat senang, apalagi nantinya di puncak hut IBBI mereka juga bakal manggung dan mengharapkan semua maha-siswa maupun mahasiswi IBBI bisa bersama-sama bergembira dan bernyanyi bersamanya di bulan April mendatang. (m19)

Top Chef All Star Sajikan Kompetisi Memasak






TELP: 082169696868 - (061) 69696868



Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

Reality show kompetisi memasak Top Chef dari saluran Sony Entertainment Television mengumpulkan tim para bintang terdiri dari 18 cheftestant (kontestan chef) yang hampir menang di musim-musim sebelumnya untuk mengetes kemampuan dan kegigihan mereka. Pemenang dua penghargaan Primetime EmmyTop Chef kembali ke kota NewYork dalam musim ke-8 nya dengan pembawa acara Padma Lakshmi dan ketua dewan juri Tom Colicchio, bersama juri Gail Simmons dan juri baru: Anthony Bourdain, chef dan penulis buku ternama. Tak ketinggalan sejumlah selebriti, termasuk Joe dari The Jonas Brothers dan Cookie Monster ikut jadi juri tamu. Ditayangkan tiap Senin jam 20:15 mulai 27 Februari, Top Chef membawa dalam kompetisi masak kelas dunia dan keahlian di bisnis restoran

yang sangat kompetitif dan penuh tekanan. Reality show ini menghadirkan para chef berbakat yang berkompetisi untuk meraih titel Top Chef yang telah diakui sebagai ajang pembuktian kemahiran di dunia kuliner. Ditonton rata-rata dua juta orang tiap episodenya, musim ini bisa dikatakan sebagai musim terkeras yang pernah ada dan tidak boleh dilewatkan terlebih dengan banyaknya ketegangan dan berlimpahnya talenta para cheftestant. Top Chef All Star adalah musim Top Chef yang berhasil memenangkan penghargaan Primetime Emmy tahun 2010 untuk kategori Program Reality Show Kompetisi Terbaik, mengalahkan Project Runway, Dancing with the Stars, dan American Idol, serta merebut titel itu dari The Amazing Race, yang sudah tujuh kali berturut-turut memenangkan penghargaan kategori ini. (m19)



Teori Agen Perubahan Dan Agama


Segitiga Gus, Gatot, AY


aru dua nama menyatakan siap dan tegas mencalonkan diri menjadi Gubsu periode 2013-2018 yaitu Pangkostrad Letjen TNI AY Nasution ketika berkunjung ke Medan menemui Walikota Rahudman Harahap, dan Gus Irawan Pasaribu, Dirut Bank Sumut yang akan mengakhiri jabatannya pada Juni 2012. Gus yang juga Ketua Umum KONI Sumut lebih agresif dalam ‘’mendeklarasikan’’ pencalonannya (Waspada 24/2). Sudah barang tentu keduanya (AY Nasution dan Gus Irawan) pantas memperoleh ‘’credit point’’ dan apresiasi dari sikap tegasnya itu, tidak ‘’mau-malu kucing’’ lagi sebagaimana banyak diperlihatkan para tokoh lain yang namanya acapkali disebutsebut oleh media massa namun tidak berani berterus terang ingin maju. Bagaimana dengan sang ‘’incumbent’’? Plt Gubsu Gatot Pujo Nugroho pun sudah memberi sinyal positif akan maju dalam Pilkada Gubsu 2013. Sekalipun belum tegas tapi publik maklum karena Gatot mungkin takut dicap lebih mementingkan ambisi pribadi, memanfaatkan jabatannya, ketimbang mengurus kepentingan warga Sumut walau tinggal setahun lagi. Posisi Gatot dinilai paling strategis. Hampir semua calon tampak jelas ingin berdampingan dengannya. Kendalanya pada posisi saja. Hampir pasti Gatot menolak jika dipasangkan sebagai Cawagub lagi meskipun partainya papan tengah dikarenakan posisinya saat ini Plt Gubsu dan kinerjanya relatif sukses dalam arti jalannya roda pemerintahan di Pemprovsu lancar dan sosok Gatot dikenal supel pada semua golongan dan relatif bersih. Hemat kita, memang tidak begitu banyak tokoh yang bisa maju dalam Pilgubsu mendatang, jika ketiga tokoh tersebut benar-benar memperoleh dukungan ‘’sampan’’ dari parpol. Misalnya AY Nasution memperoleh restu dari Partai Demokrat, Gus Irawan memperoleh lampu hijau dari Golkar, dan Gatot hampir pasti memperoleh dukungan dari PKS dan parpol Islam. Berarti, tinggal calon dari PDIP saja yang masih belum kelihatan bayang-bayangnya. Partai berlambang banteng moncong putih ini hampir pasti tidak akan memajukan kadernya sebagai Cagubsu karena memang Intisari tidak ada yang menonjol, misalnya punya kemampuan cukup, kredibilitas dan elektabilitas tinggi, serta modal akseptabilitas plus Pilgubsu2013harusmam- profesional. itu, persaingan mendapatkan sampu melahirkan memimpin panJustru dari parpol dipastikan seru. Tidak mudah kredibel, cakap mensejah- mendapatkannya. Berarti perlu modal besar investor kakap. Apalagi kalau dalam interakan 12 juta warga dari ternal parpol terdapat 2 sampai 3 tokoh yang Sumut sama-sama berambisi ingin maju. Seperti AY Nasution masih akan bertarung dengan sejumlah tokoh politik yang sudah kawakan di Demokrat, kader pula. Begitu pula dengan Gus Irawan mengingat cukup banyak kader senior Golkar yang juga punya ambisi maju meskipun peluangnya tidak sebesar Gus. Tapi, andai pun Gus ‘’ditelikung’’ di Golkar diyakini masih banyak parpol yang bersedia mengusungnya plus lewat jalur independen pun kans tokoh ini patut diperhitungkan. Mengingat tahapan Pilkada Gubsu 2013 tidaklah terlalu jauh lagi maka kesiapan para calon harus sudah solid. Kalau mendeklarasikan diri saja dengan menyatakan ‘’Saya siap maju’’ tidak berani imej yang timbul di masyarakat tidak serius. Belum lagi bicara visi dan misi serta tantangan untuk teken kontrak politik dengan elemen masyarakat. Kesan yang terlihat pada sejumlah figur yang cenderung ‘’malu-malu kucing’’ mereka takut kalah atau ragu-ragu untuk bertarung di medan pesta demokrasi melihat kandidat potensial sudah melakukan kampanye dini lewat program ‘’road show’’ guna mendekati masyarakat di berbagai kabupaten-kota. Mumpung masih belum diawasi oleh KPU dan Panwas seharusnya momentum kosong ini dimanfaatkan dengan melakukan sosialisasi. Hanya sejumlah tokoh memanfaatkan dan itu sahsah saja sejalan dengan perkembangan politik dan demokratisasi Oleh karena itu kita yakin tidak hanya segitiga: Gus, AY, dan Gatot yang sudah mempersiapkan dan mengaktifkan tim sukses menuju Pilgubsu 2013, tapi sejumlah tokoh lainnya pun segera punya nyali. Jangan lagi ‘’malu-malu’’ karena dipastikan akan terlambat dan pada akhirnya menyesal dan gagal total. Ibarat pepatah ‘’arang habis besi binasa’’. Habis tenaga, pikiran, dan dana dengan sia-sia. Pada hakikatnya semakin banyak Cagubsu dan Cawagubsu yang maju tahun depan semakin banyak pilihan warga Sumut dan positif guna mendapatkan pemimpin yang benar-benar berkualitas. Tidak lagi sekadar popular seperti halnya Syamsul Arifin di masa lalu, tapi Pilgubsu 2013 mampu melahirkan memimpin yang mampu dan cakap mensejahterakan 12 juta warga Sumut. Dan banyaknya calon yang muncul membuat tahapan menuju Pilgubsu semakin meriah sehingga pertarungannya nanti diperkirakan jauh lebih menarik dibandingkan Pilgubsu 2008. Mengenai calon independen sangat mungkin muncul 1-2 dua pasangan, namun sulit memenangkan Pilgubsu jika tidak memiliki dana besar untuk menggerakkan tim sukses di semua kabupatan-kota. Lain halnya calon dengan sampan parpol mereka sudah memiliki mesin penggerak massal. Soal mesinnya mampu ‘’berlari kencang’’ atau kehilangan ‘’tenaga kuda’’ semuanya tergantung ketersediaan fulus. Mudah-mudahan Pilgubsu 2013 sukses. Rakyat sebagai penentu harus mencari tahu ‘’track record’’ untuk menimbang-nimbang siapa calon pemimpinnya yang terbaik. Mampu bekerja, memiliki tanggung jawab, dan anti-korupsi untuk masa depan Sumut lebih baik. Dan tidak lagi terkecoh dengan slogan kosong: tidak lapar, tidak bodoh, tidak sakit dll.+


Faks 061 4510025

Facebook Smswaspada

+6285763196160 Saya hobbi sekali ber wirit yasin sekali seminggu.karena ada tiga yang didapat. satu menyambung silaturahmi, dua dapat siraman rohani dapat tanya jawab dengan ustad. tiga siraman jasmani makan nasi soto panas dan kue yang lezat2 ada bolu ada risol ada bika ambon . dari lb katorong di pondok nyo nan langang tembung +6285297403121 Buat No HP +6285760762376, komentar anda di Ruang Opini Waspada tgl 22 Peb 2012 ada benarnya, tapi pernahkah anda berpikir kenapa ?, kemungkinan hal ini dikarenakan karena sikap Jahil, Jumud dan Juhud kita, para ulama atau orang yang diulamakan mencampur aduk antara yang “Haq dan Bathil”, yang ironi malah menyembunyikan “Haq” padahal mereka mengetahuinya. Menurut saya biarlah semua ini berjalan mengalir bagai air, kita semua memiliki “Potensi” dari Allah, pergunakanlah sebaik-baiknya, sehingga kita selamat dunia akhirat. +6282165293457 JANGANLAH MEMBUAT KERUSAKAN DI MUKA BUMI,.Allah telah memberikan rezeki kepada kita melimpah ruah dari segala tempat,tetapi mereka memungkiri nikmat Allah(tidak bersyukur).maka Allah menimpakan kepada mereka bahaya kelaparan, dan ketakutan.di sebabkan apa yg selalu mereka perbuat. +6282165293457 Sifat orang2 mukmin yg sudah mengikat janji dengan Allah. 1.taubat.2.beribadat.3.memuji Allah.4.menuntut ilmu. 5.rukuk. 6.sujud.7menyuruh berbuat makruf.8.melarang perbuatan mungkar. 9. memelihara hukum-hukum Allah, dan gembirakanlah orang2 mukmin. Orang2 yang khusuk dalam shalatnya. dan orang2 yang memelihara shalatnya. +6285763196160 Indonesia ku sayang Indonesia ku malang kenapa nggak Inggris menjaja mu sayang dulunya sayang? kalau Inggris merawatmu pasti jadi negara Islam kalau Belanda penuh ke bohongan dan adu domba ajaran Belanda. dari lb ktorong di pndk nan langang tmbg +6285296158985 Kantor SAMSAT Pangkalan Brandan dan pelayanan SIM keliling sarang pungli.Biaya pengurusan pajak kendaraaan bermotor bus membengkak hingga hampir 100%,diluar biaya yg tertera di Nota Pajak STNK. Tolong pak Kapoldasu,mohon ditertibkan para anggotanya. +6283199206046 Saya M.Ridwan.lbs sebagai anggota pemuda Pancasila berharap seluruh anggota PP di Sumut. tetap mendukung abangda Anuar(aweng)Shah sebagai kandidat tunggal ketua MPW pemuda Pancasila di Sumut, karena semenjak diera kepemimpinannya PP di Sumut ini telah menjadi Barometer diseluruh organisasi. dan makin top dì mancanegara sehingga Pancasila banyak dipelajari dinegara maju. +6287713910905 Apa maksud Tirtanadi setiap hari airnya mati, apa ada kerjasama dengan perusahaan TPT Penampungan Air ya? Pengawas yang baru diangkat perlu mengawasi lancarnya air ke pelanggan, bukan masalah manajemen atau keuangan saja, dari masyarakat yang selalu menderita ketiadaan air karena tidak sanggup beli TPT penampungan.

WASPADA Senin 27 Februari 2012

Oleh M Ridwan Lubis Kedudukan sebagai khalifah itu tidak bersifat gratis alias cek kosong tetapi di dalamnya terkandung tuntutan terhadap sikap pertanggungjawaban.


epanjang sejarah umat manusia telah memikirkan penyebab utama motor penggerak fenomena dan proses dan kekuatan setiap kejadian yang bertanggungjawab atas nasib mereka. Berangkat dari prinsip relativitas antara subyek dengan obyek, manusia melihat dirinya adalah salah satu subyek dari sekian banyak subyek di alam semesta. Dalam kaitan itulah yang menyebabkan manusia melakukan penyembahan terjadap benda-benda yang dipandang memiliki kekuatan adikodrati seperti matahari, pohon, gelombang laut, batu besar, ular naga dan sebagainya. Apabila subyek-subyek tersebut sifatnya dinamis lalu kemudian melakukan rekayasa terhadap subyek yang dipandang adikodrati itu yaitu dengan melukiskan penghubungan antara manusia dengan kekuatan yang maha dahsyat itu yang dijelmakan dalam bentuk patung. Terlepas dari cara pengungkapan yang disamarkan dalam bentuk kekuatan animis, dinamis, dewa, Tuhan baik yang diartikan Tuhan yang tunggal atau Tuhan yang metafisik, agen perubahan selalu dibayangkan berada di luar diri manusia—yang membentuk dan mengendalikan kehidupan baik individu maupun kolektif termasuk biografi manusia maupun sejarah masyarakat (Piötr Sztompka, Sosiologi Perubahan Sosial, 2008, hal 223). Lambat laun pemahaman manusia terhadap agen perubahan mulai diturunkan ke bumi yaitu berbagai kekuatan alamiah. Terjadinya perubahan di dalam masyarakat manusia adalah akibat dari berbagai faktor seperti fisik, biologis, iklim, geografis maupun astronomi. Apabila pada pola yang pertama tergambar ketakutan manusia terhadap kekuatan adikodrati sehingga diikuti dengan berbagai upacara guna membujuk kekuatan luar itu berdamai dengan manusia. Dinamika dan kreatifitas manusia hampir tidak mengalami perkem-

bangan kecuali dalam bentuk aktualisasi berbagai bentuk persembahan kepada kekuatan adikodrati itu. Sebaliknya, peralihan menuju kepada agen perubahan model yang kedua menunjukkan perkembangan yang sangat radikal. Perubahan pemahaman terhadap agen perubahan itu dapat dilihat sebagai bentuk perubahan dari cara pandang berorientasi eksternal kepada berorientasi internal. Manusia yang semula sangat mengagungkan adikodrati berubah menjadi manusia mengagungkan dirinya sendiri. Ketika itulah terjadi sekularisasi agen perubahan. Agen perubahan ditempatkan di dalam diri “manusia besar” seperti nabi, pahlawan, pemimpin, komandan, penemu, pencipta, manusia genius dan lain sebagainya. Namun apabila perubahan itu tidak didasari kepada keyakinan terhadap agama maka manusia berubah akan mempertuhankan dirinya atau tetap mengakui adanya Tuhan bahkan melaksanakan ritual agama akan tetapi tidak mengindahkan kaidah-kaidah moral. Kedudukan agama dalam teori agen perubahan adalah penegasan agama bahwa manusia itu tidak ada dengan sendirinya akan tetapi ia berasal dari ciptaan Maha Kuasa—yang dengan sifat Rahman dan RahimNya menganugerahkan kepada manusia kedudukan sebagai pengelola alam semesta (khalifah). Namun kedudukan sebagai khalifah itu tidak bersifat gratis alias cek kosong akan tetapi di dalamnya terkandung tuntutan terhadap sikap pertanggungjawaban kepada Sang Maha Pencipta. Manusia didorong untuk selalu berkreasi yang bertujuan untuk kemaslahatan seluruh alam semesta. Manusia harus menyadari bahwa mengeksploitasi alam semesta adalah tugas pokok dan fungsi manusia akan tetapi eksploitasi itu tidak membelokkan manusia dari tujuan luhur yaitu mendekatkan diri kepadaNya. Dalam kaitan inilah dapat dipahami kenapa Alquran berulangkali memberikan penegasan tentang

kesatuan antara iman dengan amal saleh karena dua karakter inilah yang dapat melahirkan agen perubahan secara paripurna. Manusia menjadi agen perubahan oleh karena Allah membekalinya dengan dua potensi yaitu wahyu dan akal. Wahyu memberikan pengetahuan tentang sesuatu yang tidak bisa dijangkau oleh akal manusia seperti kewajiban berbuat baik dan meninggalkan perbuatan yang buruk. Informasi penting lagi dari wahyu adalah penegasan bahwa kehidupan yang sesungguhnya itu adalah alam akhirat. Karena di akhirat manusia akan dituntut untuk mempertanggungjawabkan seluruh perbuatan yang dilakukannya selama hidup di dunia. Selain wahyu, Allah juga membekali manusia dengan akal untuk digunakan melakukan observasi, analisis, prediksi, interpretasi, komparasi sehingga melahirkan kesimpulan. Apabila akal melakukan tugas pengembangan terhadap apa yang diamati, diketahui dan dirasakan maka agama yang tersimpul dalam wahyu menjadi dasar untuk menarik titiktitik simpul dari semua kejadian di alam semesta. Demikianlah kaidah kehidupan

berjalan secara seimbang sehingga menuntun manusia untuk memperoleh kehidupan yang bahagia di dunia dan di akhirat. Konsep agen perubahan yang paripurna itu terbukti dalam sejarah Islam telah melahirkan berbagai manusia besar sebagaimana yang diistilahkan oleh Syed Hossein Nasr dengan kelompok manusia yang minoritas namun kreatif (the creative minority). Seorang ulama yang bernama Ibn Sina, beliau ahli dalam berbagai ilmu keagamaan mencakup akidah, syariat dan akhlak namun di balik itu dengan etos keilmuannya mampu melahirkan berbagai karya monumental dalam ilmu kedokteran sehingga melahirkan ensiklopedi kedokteran yang diberi judul Al Qanun fi Al ‘Ilm Al Thibb yang kemudian dalam terjemahan latinnya dikenal dengan sebutan Canon. Ensiklopedia ilmu kedokteran tersebut sampai sekarang tetap menjadi kenangan manis bagi pengkaji literatur ilmu kedokteran. Demikianlah sekelumit kaitan antara teori agen perubahan dengan agama. Penulis Dosen UIN Syarif Hidayatullah Jakarta.

Menyoal Status Anak Di Luar Nikah Oleh Honriani Nst, ST Secara Islam, walaupun pernikahannya siri tapi anak hasil pernikahan tersebut tetap memiliki hak yang sama dengan anak hasil pernikahan yang resmi oleh negara, memiliki hak waris dan hak perwalian karena anak tersebut tetap dinasabkan kepada ayahnya.


umat, 17 Februari 2012 tepatnya pukul 13:16WIB Mahkamah Konstitusi (MK) memutuskan anak di luar perkawinan tetap memiliki hubungan perdata dengan laki— dibuktikan berdasarkan ilmu pengetahuan dan teknologi dan/atau alat bukti lain menurut hukum ternyata mempunyai hubungan darah sebagai ayahnya. Putusan No.46/PUUIX/2011 tersebut dibacakan Ketua MK Moh. Mahfud MD dengan didampingi delapan hakim konstitusi lainnya di Ruang Sidang Pleno MK. “Anak yang dilahirkan di luar perkawinan mempunyai hubungan perdata dengan ibunya dan keluarga ibunya serta dengan laki-laki sebagai ayahnya yang dapat dibuktikanberdasarkan ilmu pengetahuan dan teknologi dan/atau alat bukti lain menurut hukum mempunyai hubungandarah,termasukhubunganperdata dengan keluarga ayahnya,” ucap Mahfud membacakan amar putusan. ( Putusan ini sebagai jawaban terhadap perkara yang diajukan Hj Aisyah Mochtar atau Machica Mochtar yang menikah siri dengan Drs Moerdiono – mantan mensesneg era Orde Baru – pada 20 Desember 1993. Gugatan ini dilandasi adanya pandangan negatif di tengah masyarakat terhadap statusnya sebagai istri siri dari Drs Moerdiono dan tidak terpenuhinya hak-hakanak—MIqbalRamadhan—hasil pernikahan tersebut. Adapun permohonan yang diajukan Machica adalah (pertama) pengakuan terhadap status pernikahannya dengan mengacu pada pasal 2 ayat 1 dan menggugat keberadaan pasal 2 ayat 2 undangundang perkawinan UU No 1 tahun 1974. Adapun bunyi Pasal 2 ayat (1) Perkawinan adalah sah apabila dilakukan menurut hukum masing-masing agama dan kepercayaannya itu. Ayat (2)Tiap-tiap perkawinan dicatat menurut peraturan perundang-undangan yang berlaku. Maka berdasarkan pasal 2 ayat 1 pernikahan antara Machica dengan Moerdionoadalahsah.Namunkeberadaanayat 2membuatpernikahanitutidaksahdalam pandangan negara, karena nikah siri merupakan perkawinan yang tidak tercatat yang menimbulkan efek anak tidak bisa memiliki akte kelahiran dan terhambat mendapatkan akses pendidikan. Padahal nikah siri marak karena UU perkawinan yang mempersulit seorang pria untuk berpoligami dan menikah di bawah usia yangtelahditetapkannegara–yangbertentangan dengan agama Islam. Sementara nikah siri dan menikah pada usia dini–selama rukun nikah dipenuhi–merupakan pernikahan yang sah dalam agama Islam. Dan sejatinya orang beriman lebih takut melanggar hukum agamanya daripada hukum negara. Jelas

kondisi ini tidak akan terjadi jika hukum agama(bacaagamaIslam)diadopsinegara menjadi hukum negara/UU dan UUD. Sebaiknya negara membuat undang-undang negara yang sesuai agama bukan yangbertentangandenganagama,sehingga tidak muncul permasalahan seperti ini. Mengadopsi hukum agama Islam sebagai UU negara sesuatu yang sangat pantas di negara ini karena hukum agama Islam sesuai fitrah manusia—menghasilkan keadilan dan juga karena mayoritas penduduk negara ini penganut agama Islam. Adapun perkara (kedua) yang diajukan Machica menggugat pasal 43 ayat 1 yang mengakibatkan anaknya tidak mendapat hak konstitusinya dari ayahnya yang tertuang dalam pasal 28B ayat 1 dan 2 serta pasal 28D ayat 1 UUD 1945. Putusan kontroversi DarigugatanMachica,hanyasatuyang dikabulkan MK, yaitu mengubah pasal 43 ayat 1 UU perkawinan. Putusan ini mengakibatkan adanya hubungan perdata antara anak yang dihasilkan di luar pernikahan dengan ayahnya yang bisa dibuktikan dengan teknologi–seperti test DNA. Jelas putusan ini mengundang kontra, karena dalam putusan yang dibacakan ini tidak dinyatakan bahwa anak hasil di luar pernikahan jika anak hasil nikah siri. Apalagi penjelasan dari pihak yang mengeluarkan putusan pun mengatakan bahwa yang dimaksud dengan di luar pernikahan adalah nikah siri atau anak hasil perzinaan, kumpul kebo, selingkuh dan lain sebagainya—yang penting anak tersebut bisa dibuktikan hubungan darahnya melalui teknologi yang canggih. Jelas putusan ini menabrak nilai-nilai suci yang diajarkan agama manapun. Mengapa demikian? Karena putusan ini akan membuka kran bagi perzinaan, perselingkuhan, dan jenis seks bebas lainnya. Khususnya bagi perempuan, mereka akanmudahmelakukanseksbebaskarena tidaktakutlagijikaperbuatannyamenghasilkan anak. Adapun bagi laki-laki— menurut Mahfud MD—akan menutup seks bebas karena khawatir perbuatannya akan menghasilkan anak. Ini merupakan argumen konyol, karena zaman sekarang banyakterjadiseksbebasyangtidakmenghasilkan anak disebabkan pemerintah memprogramkan bagi-bagi kondom. Jika memang putusan ini dimaksudkan Mahfud MD untuk mengurangi perzinaan, seharusnya yang dikabulkan adalah gugatan Machica yang pertama yaitu pengakuan nikah siri dan tidak perlunya pemaksaan pencatatan pernikahan negara, atau negara mempermudah proses pencatatan pernikahan bagi pasangan yang mau menikah dan mempermudah urusan akte kelahiran. Cara yang lebih jitu lagi untuk mengurangi–bahkan menutup

peluang seks bebas adalah dengan menerapkan hukum Islam—tentang keluarga, tentang kewajiban menutup aurat, termasuk juga tentang minuman keras dan Narkoba. Selain banyak yang kontra, ada juga yangprodenganputusantersebut,mereka itu tidak lain adalah para pemuja dan pengusung kebebasan. Hebatnya, mereka mengajukanargumenyangbisamenghipnotis rakyat karena argumennya seolah sangat manusiawi. Padahal jika dikaji lebih dalamargumentersebutmenjerumuskan manusia ke jurang kehancuran. Misalnya argumen bahwa putusan ini memberikan perlindungan kepada anak, dan menghilangkan diskriminasi terhadap anak hasil di luar nikah. Mariberpikirlogisdanreligis;Machica, Moerdiono, anaknya, dan pihak yang terlibatdalampernikahansiritersebuttidaklah salah. Karena pernikahan itu sesuai ajaran agama Islam. Saat itu ada pasangan yang akan menikah, ada wali nikah yakni ayah kandung Machica, ada penghulu, dan ada saksi. Artinya rukun nikah secara Islam telah terpenuhi. Adapun tidak diakuinya hak-hak yang dihasilkan dari nikah siri tersebut itu disebabkan UU negara yang tidak mengadopsi ajaran/ hukum Islam. PadahalsecaraIslam,walaupunpernikahannya siri tapi anak hasil pernikahan tersebut tetap memiliki hak yang sama dengan anak hasil pernikahan yang resmi oleh negara, memiliki hak waris dan hak perwaliankarenaanaktersebuttetapdinasabkan kepada ayahnya. Berbeda halnya jika anak yang dihasilkan merupakan anak hasil seks bebas, tidakadapernikahan/nikahsiri,makaanak hasil seks bebas inilah yang tidak memiliki hakwarisdanhakperwalian.Orang-orang pengusung kebebasan tentu akan berargumenlagibahwatelahterjadidiskriminasi dan penelantaran terhadap anak hasil seks bebas. Padahal yang bersalahkan orang yang telah berzina tersebut. Perlu difahami juga bahwa pengusung kebebasan juga membenarkan aktivitas zina/sex bebas. Tuduhanbahwaakanterjadipenelantaran dan diskriminasi terhadap anak hasil seks bebas, sudah dijawab secara tuntas oleh Islam. Dalam kasus perzinaan, maka yang disanksi oleh Islam adalah pelakunya. Jika pelaku belum menikah maka sanksinya adalah jilid/dera sebanyak seratus kali :”Maka deralah tiap-tiap seorang dari keduanya seratus kali dera”(HR Muslim,Abu Dawud,danat-Tirmidzi).Sementarauntuk pelaku zina yang sudah pernah menikah maka sanksinya hukum rajam:”Seorang perempuan janda yang berzina dengan laki-laki duda keduanya wajib didera seratus kali dan dirajam (dilempari batu sampai mati)” (HR Muslim, Abu Dawud,dan at-Tirmidzi). Sanksiinijelasakanmenimbulkanefek jera di tengah masyarakat, tentu seseorang akan berpikir seribu kali jika ingin melakukan seks bebas, karena dia sadar sanksi yang akan dikenakan. Sanksi ini tidak pandang bulu, akan dikenakan baik kepada rakyat biasa ataupun keluarga dari kalangan pejabat, jika memang terbukti atau mengaku telah melakukan seks bebas/ zina. Adapun terkait anak hasil zina, me-

mang Islam mengajarkan anak tersebut tidak akan mendapatkan hak waris dan hak perwalian saat nikah. Namun bukan berarti anak ini akan ditelantarkan oleh negara, karena negara akan memberikan hak pengasuhan kepada pihak ibu dan keluarganya.Jikapihakibudankeluarganya mampu, adapun jika pihak ibu dan keluarganya tidak mampu maka negara akan membiayai hidupnya. Kemudian akses pendidikan,Islamtidakmengajarkanharus ada akte kelahiran, siapapun Muslim ataupun non muslim, kaya ataupun miskin, anak hasil pernikahan ataupun anak hasil diluarpernikahanmakabiayapendidikannya akan ditanggung negara. Namun, perlu kita fahami dan sadari bahwa negara yang mampu menerapkan hukum Islam ini hanyalah negara khilafah. Maka jika pembaca menginginkan kehidupan yang adil, non diskrimasi, pendidikan yang bermutu dan gratis, pelayanan kesehatan yang berkualitas dan gratis, kehidupanyangsejahteradanmakmur.Maka saatnya melakukan pengkajian lebih mendalam terhadap Islam dan memperjuangkan tegaknya hukum-hukum Islam secara kaffah di muka bumi ini dalam bingkai Khilafah Islamiyah. Wallahu a’lam Penulis adalah Anggota DPD I Muslimah Hizbut Tahrir Indonesia Sumut.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Survei LSI: Megawati masih teratas - Masih punya kharisma, he...he...he * BBM naik, Rp100 ribu disiapkan bagi penduduk miskin - Makin banyaklah orang miskin mendadak * Pemprovsu-Pemko Medan tidak menerima CPNS - Kemana-kemana ku harus mencari, kata Ayu Ting Ting!


D Wak


WASPADA Senin 27 Februari 2012

Nasib Angelina Nasib Bunga

Halaman Masjid Agung Medan Diawal-awal tahun 2012 timbul lagi permasalahan masjid. Yang menjadi permasalahan bukan masjidnya, tetapi halamannya, yaitu halaman Masjid Agung Medan, mereka memanfaatkan halaman masjid tersebut sebagai lahan tempat parkir kendaraan roda dua maupun roda empat bagi mereka yang mau ke SUN Plaza. Sudah jelas bahwa Masjid adalah rumah Allah yang wajib dijaga kebersihannya luar maupun di dalam. Saya tidak menyatakan kasus halaman Masjid Agung Medan, kenapa.....? Karena setiap rumah Allah yang dibangun oleh umat Islam adalah tempat beribadah, bukan tempar parkir. Karena bagaimanapun ceritanya, setiap Masjid yang dibangun sudah pasti dipersiapkan tempat wudhu, WC dan halaman parkir demi untuk jamaah yang mau shalat, i’tikaf dan ibadah-ibadah lainnya. Timbulnya persoalan ini karena tidak adanya transparansi uang masuk dan keluar dari hasil uang parkir, mungkin ada di antara pengurus yayasan Masjid Agung Medan yang tidak fair didalam pengelolaan keuangan. Maka wajar muncul di permukaan media dengan berita, halaman Masjid Agung Medan. Sehingga timbul kata-kata dari luar Pengurus Yayasan Masjid Agung Medan perlu diaudit keuangannya, dan ada lagi menyatakan pengurus harus mundur. Hal ini mungkin ketidakpuasan terhadap beberapa orang pengurus yayasan Masjid Agung Medan. Oleh karena itu saya memberikan masukan atau saran: 1. Agar dimusyawarahkan Yayasan Masjid Agung Medan dengan melibatkan BKM Masjid Agung, MUI Medan dan tokoh-tokoh Agama. 2. Persoalan masalah halaman Masjid ini sebenarnya sangat kecil dan tidak perlu disampaikan ke Kantor Gubernur. 3. Pintu masuk kehalaman Masjid dikunci lagi dengan catatan di luar pintu kecil di sebelah kiri ataupun kanan. Dibukanya pintu kecil adalah untuk lalu lalang mereka yang mau shalat. 4. Pada hari Jum’at pintu besar dibuka sampai selesainya shalat Jum’at. 5. Pengurus Yayasan Masjid Agung Medan coba ada pendekatan dengan Bos Sun Plaza, walaupun mereka tidak terlibat persoalan parkir di halaman Masjid, sedikit banyak bos tersebut berpikir, karena sebagian besar yang parkir dihalaman Masjid adalah mereka yang berbelanja di SUN Plaza, di samping karyawannya juga ikut parkir di halaman Masjid. Wassalam, M.AMIN, BA. Pengurus BKM Masjid Al-Furcon Stabat

Sumbang Saran Pengelolaan Masjid Agung Asswrwb. Saya sangat berterima kasih harian Waspada dalam beberapa hari terakhir ini membuat berita dan ulasan tentang Masjid Agung Medan yang kita banggakan di Sumut ini. Sebagai salah seorang jamaah masjid Agung Medan, ingin saya menyumbangkan saran sbb,: 1. Saya sangat setuju penertiban keuangan dan pengurus Masjid Agung Medan, 2. Keuangan Kenaziran kurang transparant, karena setiap pengumuman sebelum shalat Jumat tidak diumumkan berapa saldo kas, hanya diumumkan uang diterima dan uang keluar minggu lalu saja. Sehingga masyarakat tidak mengetahui jumlah kas Masjid Agung yang sebenarnya. 3. Masjid Istiqlal Jakarta juga memberikan pelayanan parkir bagi bukan jamaah, bahkan bagi yang akan ke gereja di seberangnya. Namun keuangannya dikelola dengan tertib dan untuk kemashlahatan masjid tersebut. Sekian semoga maklum, Wassalam Chairuddin


Dedi Sahputra

Kontradiksi Di hari Minggu ini saya sering merasa kontradiksi.Tapiorang-orangtelahterlanjurmempersepsikan hari ini sebagai hari libur. Begitu juga anak-anak di rumah. Setelah enam hari penuh mereka harus sekolah, kini saatnya mereka liburan. Pergi berenang, pergi beli buku, pergi ke tempat ini, pergi ke tempat itu—sering menjadi rencana-rencanayangmemenuhihariMinggu.Saya sendiri biasanya punya banyak sekali kewajiban memenuhi undangan, di samping membuat tulisandantugasmenyiapkanhalaman.Walhasil, pagi-pagi sekali saya sudah harus bekerja mengetik dengan kecepatan penuh. Seringkali tidak matching antara waktu saya mengetikdenganjadwalberpergian.Tulisansaya belum rampung, tapi deadline dari anak-anak telah tiba, bahkan lewat waktu. Maka tidak jarang sayaharusbekerjadibawahtekanan,mendengar pertanyaan si sulung yang berulang-ulang, melihat wajah cemberut si gadis kecil, dan mendengar rengekan si kecil. Letih sudah pasti. Pada saat berpergian pun tak jarang diisi dengan kegaduhan. Pertengkaran di antara anak-anak itu, rebutan ketika akan memarkirkan kendaraan atau rebutan kursi di rumah makan sampai senewen karena kelamaan pesanan datang. Inilahkontradiksidihari Minggu itu. Hari libur yang justru jadi hari palingsibuk. *** Bahkanketikaharilibur itumenyajikanketenangan sekalipun, tak berarti engkau luput dari kontradiksi itu. Suatu ketika, aku pernah merasakan hari libur itu benar-benar bermakna libur. Perilaku anak-anak hari itu cukup baik budi, pekerjaanku pun telah kurampungkan sebelumnya, undangan hari ini cuma satu dan telah kutuntaskan dengan bahagia. Acara TV hari itu cukup bagusbagus, memutar film yang kusukai, waktuku membaca pun jadi lebih nikmat. Hari itu aku telah menunaikan separuh dari momen istirahatku, sembari melakukan halhal yang kusukai. Hari itupun udara cerah tanpa panas menyengat dan tanpa hujan yang menghalangi langkahku. Agak aneh, semuanya seperti serba dimudahkan. Sampai menjelang sore. Aku merebahkan tubuhku menikmati istirahat yang kian langka itu. Baru sajatelayang dalam pejam mataku, tibatiba aku disentakkan suara istriku yang panik. “Bang.., bang.., Nabil bang..,” katanya histeris. Akulangsungmelompatmendatangitempat yang ditunjuk istriku. Di sana, di dekat pagar rumah kami anak sulungku dikerumuni orang ramai.Tangannya tersangkut di besi pagar.Tidak, bukan tersangkut, tapi tertusuk jeruji tajam ujung pagar,tembusdaripergelangantanganketelapak tangan.

Aku menenangkan diri. Seorang anak muda yang baru datang tiba-tiba muntah-muntah hampir pingsann ketika melihat kondisi anakku. Kukebutsepedamotormemanggildokterdiklinik tak jauh dari rumah.“Baiklah kami ke sana,” kata dokter perempuan itu. Kembali ke rumah saya bongkar semua peralatan mencari gergaji besi. Ada tapi sudah tumpul. Dengan perlahan kugergaji, sambil menyaksikanwajahanakkuyangditerpahororitu.Cukup lama, dokter tadi baru datang, berboncengan sepedamotor, gerakannya lambat tak memuaskanku.“Aiihhh..,’’ katanya sambil memalingkan wajahketikamelihatkondisianakku.Inimemang tipikal dokter jaman sekarang; lambat, tak berkualitas. Dia kemudian menguatkan hatinya sambil menyuntikkan bius ke tangan anakku, seperti memagang anak tikus yang ditakuti. Lebih setengah jam kemudian besi itu baru bisa diputus. Kini harus membawa anakku itu dengan besi menancap di tanganya. Seorang tetangga yang baik hati menolong kami dengan tulus. Mereka ngebut di tengah kemacatan membawa ke rumah sakit terdekat.“Gak bisa, dokter bedahnya baru malam datang,” kata perempuan gendut penunggu ruang IGD itu. Ini jenis kualitas pelayanan medis lainnya. Ada klinik terdekat. “Telefon dulu,” istri saya mengingatkan. “Bisa katanya.’’ Mobil kamipun meluncur deras. Saya masih menggendong anak kami yang terus meringis semakinlemah.Darahterusmengucurdaritangannya. “Tak bisa pak,’’ kata dokter muda di klinik itu. Hampir saja saya mendampratnya, kalau tak ingat kondisi anak kami yang semakin lemah itu. Maka pilihan kami ke rumah sakit umum. Di rontgen dulu, kata resepsionis. Kami naik ke lantai atas yang seperti tak berpenghuni itu. Saya terus menahan diri. Sampai akhirnya anak kami ditangani, dibedah tangannya untuk mencabut besi tajam yang menancap itu. Saya menyaksikan bagaimana bius jarum itu berkali-kali menusuk tangan anak saya, ditengaraisuarajeritannyayangmenusuk-nusuk jantungku. Saya juga melihat pisau bedah itu membelah membelah kulit tangannya, sebelum kemudian mereka mencabut dan membersihkan bekas bedahan itu seperti mencuci kain jemuran. *** Kontradiksi yang kualami itu begitu kentara. Sesuatu yang terlihat di permukaan itu sejatinya menyimpansesuatudidalamnya.Diamengajariku, kalau engkau sedang amat sangat gembira atau sedang amat sangat sedih, engkau tidak benar-benar seperti itu.(Vol.293, 27/2/2012)

Kolom foliopini dapat juga diakses melalui


Oleh Faisal Riza Politik itu bukan najis,tetapi ia dapat menjadi mutanajjis (terkena najis) karena orang-orang bejat sengaja meletakkan kotoran padanya.


pa yang terpikirkan ketika melihat suatu masa perjalanan hidup seorang manusia mencapai titik puncak kegemilangan? Tentulah kejadian itu membuat suasana pikiran dan batin mengharu-biru. Sebab, dalam kehidupan berliku tidak banyak orang dapat berjalan mulus sampai dengan apa yang menjadi cita-cita tercapai. Banyak orang salut, memuji, mau berteman. Lalu apa pula yang terpikirkan ketika melihat kehidupan begitu menyakitkan, petaka, kejatuhan, terhina dan kehilangan martabat kemanusiaan datang silih berganti. Apa ada yang mau berteman, memuji dan menghargai? Angelina bak bunga Siapapulayangtidakcemburumelihat kehidupan sosok Angelina Sondakh yang aduhai. Lahir dari keluarga terhormat dan disegani, di usianya yang muda-mapan karirnya cemerlang, harta melimpah, jabatan yang meninggikan marwah, dikelilingi para pemuja, lengkaplah sudah. Ibarat musim bunga tiba, Angelina indah berseri-seri, mempesona pemujanya tak terperi.Tak banyak anak muda Indonesia yang bernasib mujur seperti ini. Banyak kalangan muda masih dalam tahap bermimpi untuk menjadi kaya dan sukses, sebagia besar lagi merasa perlu mengikuti training motivasi jadi pemuda kaya, mengikuti seminar-seminar yang memberikan pengetahuan bagaimana memburu harta sebanyak-banyaknya di dunia ini. Sampai ada jargon“muda kaya, tua bahagia, mati masuk surga”. Angelina tidak sesulit itu mendapatkan apa yang diimpikan banyak pemuda Indonesia, ia melesat tinggi melangit dalam pusaran sosialita kekuasaan. Namun, seperti rumus alam tentang bunga, musim bunga tak pernah lama, masa itu cuma sebentar. Musim semi segera menjadi musim gugur. Angelina bak bunga, ia cantik dan kaya, mantan puteri Indonesia, anggota DPR, pejabat teras partai Demokrat, partai berkuasa. Tetapi dalam kurun waktu yang singkat pula, ia menyusul teman tampannya Nazaruddin menjadi tersangka oleh KPK dalam kasus WismaAtlet.Sejakpertengahan2011nama Angelinadisebut-sebutmediadanmenjadi bulan-bulanan media dan public. Bahkan beberapa media menyebutnya sebagai wanita paling tenar Indonesia tahun 2011. Perbincangan mengenainya bergerak liar, hingar bingar tak berkesudahan. Keelokan puteri Indonesia ini segera terkena polusi oleh limbah politik yang membaluti hidupnya. Petaka demi petaka seperti tak henti menyertainya, sejak meninggalnya Adji Massaid (Anggota DPR-RI) suami

tercinta, Angie panggilan akrabnya melewati hari-hari tak pasti yang tak seorangpun mengerti kapan semua itu berakhir. Racunopiumpolitikmembuatnyalinglung dan sesat di jalan yang benar. Politik sebenarnya merupakan jalan benar yang mulia, jalannya para Nabi dan filosof demi tujuan mulia mashlahat arraiyah, kemashlahatan rakyat. Berpolitik sesungguhnya mengimplementasikan nubuat Nabi Muhammad, sebaik-baik manusia adalah yang memberikan manfaat sebanyak-banyaknya kepada orang lain. Politik itu bukan najis, tetapi ia dapat menjadi mutanajjis (terkena najis) karena orang-orang bejat sengaja meletakkan kotoran padanya. Gumpalan limbah kekuasaan bisa saja melumeri, membaluri para pelakunya dan sering tak terhindarkan. Orangsusahmencarititiksucidalampolitik kekinian, para agamawan atau kalangan santri dan ulama yang terjun ke dunia politik praktis belakangan ini seperti tidak dapat berbuat apa-apa, tak lebih hanya ibarat air musta’mal, air yang digunakan karena kesuciannya, tapi tak dapat mensucikan. Demikianlah yang terjadi pada Angelina Sondakh, ia tidak dapat menghindar dari hukum “silau” politik kekuasaan, korupsi yang meraja di sekujur tubuh negeri yang dahulu dikenal beradab ini. Narasi kehidupan Angelina ini adalah satu dari sekian banyak pengalaman orang lain. Peristiwa ini mengingatkan saya pada tembang Melayu lawas“Nasib Bunga”. Kurang lebih syairnya begini, “Bila musim bunga tiba, halamanku indah berseri, tumbuh bunga indah mempesona hati riang tak terperi.Bila musim gugur tiba bunga jatuh di bumi juga, hatikupun iba melihatnya, nasib bunga tiada lama.” Senada dengan syair tembang di atas, seorangPujanggamasyhursekaligusfilosof beraliran Realisme Sutan Takdir Alisyahbana, mengatakan bahwa kehidupan manusia di dunia ini seperti sekuntum bunga. Dalam waktu yang singkat bunga ditanam, tumbuh, berkembang-berbunga, semerbaknya harum menyeruak ke alam sekitarnya, kemudian segera layu jatuh ke bumi. Semuaprosesituberlangsungcepat,saking singkatnya petuah Jawa kuno mengatakan “Urip Mung Mampir Ngombe”. Hidup manusia ini hanya mampir minum saja. Kemewahan dunia ini hanya sementara, seperti musafir yang kehausan tiba-tiba berhenti di padang pasir karena menemukan mata air. Kehausannya mereda sebentar tak menghilangkan hakikat dahaga. Boleh saja Tak bolehkah kita menikmati hidup yang singkat ini? Mumpung sebentar apa

salahnyakitabuatkesenangan,mumpung kaya, mumpung berkuasa. Kata bang Haji Rhoma Irama semua boleh saja. Ini tersurat dalam dalam syair lagunya berjudul “Boleh saja”. Lagu itu memuat narasi kehidupan manusia di dunia yang melenakan. Kemilau dunia boleh saja dinikmati tetapi harus ingat bahwa suatu saat manusia akan meninggalkannya. Berbuatlah apa yang Anda suka tapi ingatsuatusaatsemuaitukanadabalasannya.Baikataujahat,lurusatausesatsemua terserah manusia. Kemewahan dunia ini memang sangat menyenangkan hati, tapi kesenangan dunia penuh dengan tipuan belaka.Dariituwaspadalahjangansampai dipedaya olehnya. Demikian senandung Rhoma. Keterpedayaan manusia terhadap kesenangan dunia, cara manusia menyikapi hidup di dunia ini memang susah ditertibkan. Manusia sering mengingkari fitrahnya sebagai makhluk suci pilihan Allah SWT yang diberikan fasilitas memelihara dan memanfaatkan isi dunia ini untuk kebaikannya. Nabi Muhammad SAW dengan nada “menyerah” pernah berkata:“‘Isymaasyi’tafainnakamayyitun, wahbib maasyi’ta fainnakamufaariquhu, wa’mal maa syi’ta, fainnaka majziyyun bihi, wa I’lam anna syarfa al-mu’min qiyamuhu bi al-lail, waizzuhu istighnaa’uhuanian-naas”.Hiduplahsesukamu maka sesungguhnya kamu akan mati, sukailah sesuatu sesukamu maka sesungguhnya kau akan terpisah darinya, dan berbuatlah sesukamu maka sesungguhnyakamuakanmendapatkanbalasan dari perbuatanmu.

Kehidupan kemuliaan seorang Mukmin itu mendirikan malamnya dengan bersimpuh,menyungkurdihadapanAllah SWT sang Penguasa Semesta. Dan kemuliaanmanusiaadalahketikadilebihkan dari manusia lainnya baik dari segi harta dan jabatan ia tetap sederhana dan menganggap semua hanya amanah dari Allah yangharusdipertanggungjawabkansuatu hari nanti. Penutup Rumuskehidupanitumudahditebak. Kehidupan hanya memiliki dua nilai yang saling bertentangan; positif-negatif, bahagia-derita, kaya-miskin, atas-bawah, dan seterusnya. Persoalannyahanyaterletak pada seberapa besar munculnya kesadaran kemanusiaan dari semua peristiwa yang terjadi. Ketika manusia dalam keadaan bahagia atau dalam derita. Ketikamanusialebihkayadarilainnya, ketika manusia lebih kuat dari lainnya. Seberapa besarkah manusia menyadari semuaitusebagaiujiankemanusiaannya? Untuk memunculkan kesadaran itu kita tak perlu menunggu Tuhan turun dari langit, cukuplah peristiwa dan narasi kehidupanmenjadiI’tibaruntukmenghadirkan rasa bertauhid,motivasiber-Tuhan di dalam kemanusiaan kita. Sehingga kita tak gelap mata. “Kini sadarlah kau bunga, kau mekar banyak yang memuja, bila layu engkau tak berharga. Nasib bunga tiada lama.” Penulis adalah Pengajar Teologi Transformatif Fakultas Ushuluddin IAIN-SU

Mempertahankan Eksistensi Qori Berkualitas Oleh H.Irham Taufik Umri, SH, MAP Bak kata pepatah:“sapi punya susu,lembu punya nama”. Pepatah tersebut sangat tepat diberikan kepada Sumatera Utara.


restasi spektakuler telah diukir qori Provinsi Sumatera Utara Ja’far Hasibuan. Sebagai utusan negara Indonesia, Ja’far Hasibuan telah berhasil mengukir prestasi gemilang menjadi juara I Musabaqah Tilawatil Quran tingkat Internasional di Teheran Iran yang diikuti berbagai negara di belahan bumi ini. Hasil yang diraih Ja’far menjawab permintaan Plt.Gubsu H. Gatot Pujo Nugroho, ketika menerima qori tersebut sebelum berangkat menuju Teheran. Ketika itu Plt.Gubsu berpesan kepada Ja’far agar dapat berprestasi dalam kompetisi MTQ internasional di negara penghasil nuklir yang lagi menghebohkan dunia itu. Ja’far Hasibuan membuktikannya, prestasi qori Sumatera Utara itu cukup membanggakan serta mengharumkan Provinsi Sumatera Utara di seantero tanah air. Gudang Tidak dapat dipungkiri Provinsi Sumatera Utara merupakan gudang qori dan qoriah, hafiz dan hafizah di negeri ini. Qori dan qoriah Sumatera Utara berkualitas silih berganti merajai Musabaqah Tilawatil Quran, arena kompetisi menguji kemampuan dan keahlian para qori dan/qoriah yang digelar setiap dua tahun sekali di negeri ini. Sejak Tilawatil Quran tingkat nasional dipertandingkan pada awal tujuh puluhan qori H. Hasan Basri telah berjaya menjadi juara I MTQ Nasional golongan dewasa putra yang diselenggarakan di stadion Teladan Medan. Sedangkan golongan dewasa putri direbut qoriah kenamaan kita Hj.Nurasiah Jamil. Sebagai Juara I MTQ Nasional mereka dikirim sebagai utusan negara Indonesia ke MTQ antar bangsa di Kuala Lumpur Malaysia. Keduanya berhasil keluar sebagai johan (istilah Malaysia Juara I) MTQ yang sangat bergengsi di dunia internasional. Setelah era H. Hasan Basri dan Hj. Nurasiah Jamil, muncul qori/qoriah yang mengikuti jejak senior mereka. Qori tersebut adalah H.Rahmat Lubis serta si puteri bungsu Hj.Nurainun. Beberapa lama mereka berdua tetap menjadi kampiun baik di tingkat nasional maupun internasional (MTQ antar bangsa). Generasi berikutnya menyusul Dr H.Yusnar

Yusuf serta H.Fadlan Zainuddin. Keduanya mengawali karirnya dari bawah, mulai kanak-kanak, remaja dan dewasa. Keduanya cukup hebat karena di setiap tingkatan yang mereka ikuti, seluruhnya berhasil menyabet juara nasional. Bahkan H.YusnarYusuf bukan hanya sukses sebagai qori internasional, tetapi ia juga berhasil mengembangkan karir di bidang pendidikan (S3) dan karir di birokrasi dipercaya sebagai pejabat eselon II di Kementerian Agama dan Kementerian Sosial. Beberapa lama Provinsi Sumatera Utara nyaris tidak ada melahirkan juara nasional pasca Yusnar dan Fadlan. Baru pada 2005 sampai saat ini kembali qori Sumatera Utara berkiprah dan mendominasi arena MTQ baik nasional maupun internasional seperti Fachruddin Sarumpaet, Darwin Hasibuan dan terakhir tahun 2012 diukir pula oleh Ja’farHasibuan.Ketiganyamengukirsejarah sebagai juara internasional di Iran. Reputasi yang diraih qori-qori asal Provinsi Sumatera Utara itu tidak terlepas dari peranan Guru Besar Al Mukarram Al Hafiz Tuan Syekh H. Azrai Abdurrauf dan juga Al Hafiz yang bersuara lembut H.Chuwailid Daulay. Kedua guru besar tersebut sangat berjasa mendidik, melatih, membina serta mengembangkan para qori dan qoriah di Sumatera Utara sehingga hasilnya gilang gemilang dengan lahirnya qori/qoriah berkualitas bertaraf internasional. Semua qori dan qoriah yang berkualitas itu merupakan anak didik kedua guru besar tersebut. Jika Al Hafiz Syekh H.Abdurrauf membina Majelis Tahsin Tilawatil Quran, maka Al Hafiz Chuwailid Daulay mendirikan Majelis Qurra’Wal Hufaz. Banyaknya qori dan qoriah berkualitas bertaraf nasional dan internasional, menjadikan Sumut menjadi gudang seniman tilawatil Quran di tanah air. Hijrah Seiring perjalanan waktu beberapa tahun terakhir ini ada fenomena yang terjadi pada qori/qoriah terbaik di Sumut ini. Banyak di antara mereka yang hijrah (pindah) ke provinsi lain. Ada yang pindah ke DKI Jakarta, ke Provinsi Banten, Provinsi Riau, Provinsi Aceh dan lainlain. Dengan hijrahnya mereka keluar Sumatera Utara, otomatis qori tersebut

menjadi utusan provinsi tempat ia pindah untuk mengikuti MTQ tingkat nasional. Ironisnya pada MTQN di Provinsi Banten, terjadi persaingan ketat pada golongan dewasa putera sesama qori asal Sumut tapi ketiganya mewakili provinsi lain. Hasilnya sangat fantastik karena ketiganya berhasil menjadi juara. Sebagai juara I Darwin Hasibuan mewakili Provinsi Riau, Juara II Fachruddin Sarumpaet atas nama Daerah Khusus Ibu Kota Jakarta. Sedangkan juara III Yasser Arafat utusan tuan rumah (Provinsi Banten). Peristiwa itu cukup memprihatinkan, karena yang dirugikan adalah Provinsi Sumatera Utara. Bak kata pepatah klasik: “sapi punya susu, lembu punya nama”. Pepatah tersebut sangat tepat diberikan kepada Sumatera Utara, karena qori berkualitas dilahirkan dari provinsi ini tapi provinsi lain yang menikmatinya. Hijrahnya qori/qoriah ke provinsi lain sungguh merugikan dan merupakan pukulan telak bagi pemerintahpProvinsi, kabupaten/kota maupun masyarakat Sumatera Utara. Kesejahteraan Timbul pertanyaan mengapa fenomena hijrahnya qori berkualitas terus terjadi? Jawabnya sangat sederhana yaitu kurangnya perhatian serta penghargaan (reward) kepada mereka. Ketika mereka berhasil meraih prestasi menjadi juara nasional dan internasional, sanjungan dan pujian kepada mereka luar biasa meriahnya. Akan tetapi seiring dengan perjalanan waktu, perhatian kepada mereka seakan tenggelam sirna ditelan bumi. Tak ada lagi yang peduli dan memperhatikan eksistensi qori/ qoriah berkualitas tersebut. Ibarat pepatah: “habis manis sepah dibuang”, begitulah nasib yang menimpa mereka. Padahal mereka telah belajar, berlatih dengan serius dan sungguh-sungguh. Tak kenal waktu, terkadang mengabaikan profesinya selama ini seperti mengajar, berniaga dan lain-lain. Obsesinya tetap bagaimana mencapai prestasi dengan mengerahkan potensi yang dimilikinya untuk mencapai hasil yang optimal. Sebenarnya kalau ditanya hati nurani mereka yang paling dalam, dapat dipastikan mereka sebenarnya sangat mencintai daerah asal (Sumatera Utara). Akan tetapi demi kelanjutan kehidupan dan peningkatan kesejahteraan, dengan berat hati mereka terpaksa menerima tawaran pindah dari provinsi lain. Tidak mengherankan provinsi lain “menangkap peluang” yang terbuka lebar, sehingga qori/qoriah berkualitas

tersebut berduyun-duyun meninggalkan daerah asalnya menuju provinsi yang menerima mereka dengan imbalan kesejahteraan yang cukup memadai. Qori/qoriah tersebut mendapat tawaran bea siswa dari mulai strata 1 hingga strata 3. Ada yang mendapat pekerjaan tetap sebagai pegawai negeri sipil (PNS) atau karyawan perusahaan daerah. Kemudian tawaran lainnya mendapat fasilitas rumah, kenderaan roda empat serta fasilitas lainnya. Provinsi yang merekrut qori berkualitas tersebut menempatkan mereka sejajar dengan atlit olah raga yang mengukir prestasi di ajang Pekan Olah Raga Nasional maupun Sea Games dan Asian Games. Adalah lumrah kalau tawaran yang cukup menggiurkan itu diterima oleh para qori tersebut. Perhatian serius Untuk mengantisipasi hijrahnya qori berkualitas ke provinsi lain, saatnya pemerintah provinsi dan kabupaten/ kota di Sumatera Utara melakukan upaya preventif dan persuasif. Sudah saatnya kita peduli dan serius memperhatikan eksistensi qori/qoriah, hafiz/hafizah berkualitas. Terutama yang sudah mengharumkan nama Sumatera Utara di kancah nasional maupun internasional. Penghargaan dari aspek kesejahteraan harus benar-benar menjadi prioritas yang patut diberikan kepada mereka. Bagi qori/qoriah yang statusnya mahasiswa sebagai penghargaan kepada mereka diberikan bea siswa sampai ke jenjang yang dicita-citakannya. Bagi yang belum mempunyai pekerjaan tetap, tentu dapat dipekerjakan sebagai PNS ataupun karyawan perusahaan serta diberikan perumahan yang layak, sehingga mereka dapat fokus memusatkan perhatian dalam mengembangkan keahlian yang dimilikinya tanpa memikirkan periuk nasibnya lagi. Di sisi lain mereka diberikan pula tanggung jawab untuk mendidik dan melatih bibit-bibit baru yang kelak dapat mengikuti jejak mereka. Selain itu Lembaga Pengembangan Tilawatil Qur’an (LPTQ) dari mulai tingkat provinsi, kabupaten/kota sampai ke kecamatan— mempunyai kewajiban dan tanggung jawab yang besar serta pro aktif membentuk, membina serta mengembangkan majelis pengajian tilawatil Quran di wilayahnya masing-masing secara berkesinambungan. Semoga! Penulis adalah Dosen Sekolah Tinggi Ilmu Tarbiah Al Hikmah Kota Tebingtinggi.

Ekonomi & Bisnis

C8 Tinjauan Ekonomi

WASPADA Senin 27 Februari 2012

Jhon Tafbu Ritonga Pengamat Ekonomi

Mencari Calon Gubsu 2013-2018 SETELAH cukup lama absen, kolom saya akan hadir lagi dengan tema khusus “Mencari Calon Gubernur Sumatera Utara (Gubsu) 2013-2018” dalam episode perspektif seorang ekonom. Tema ini dipilih karena melihat pengalaman bangsa Indonesia memilih langsung Presiden, Gubernur, Bupati dan Walikota. Kolom ini akan mencoba menyajikan pandangan dengan menggunakan bahasa awam guna mendapatkan pencerahan. Ulasan dalam kolom ini dimaksudkan sebagai upaya edukasi mengenai aspek yang perlu diketahui publik sebelum mencari dan mengajukan seseorang menjadi calon Gubsu 2013-2018. Kemenangan seseorang dengan mutlak dalam Pemilu atau Pilkada (Pemilihan Kepala Daerah) terbukti tidak mencerminkan keberhasilan melaksanakan kepemimpinan. Popularitas yang menjadi modal utama elektabilitas yang tinggi belum menjadi indikasi pemahaman masyarakat mengenai kapasitas kepemimpinan seseorang dalam meningkatkan kesejahteraan rakyat. Mereka yang mahir berpidato layaknya Bung Karno, bahkan dipenuhi kalimat-kalimat “langit”, bukanlah tanda-tanda apalagi bukti keberhasilan kepemimpinan. Faktanya sudah banyak, di seluruh Indonesia, termasuk di Sumatera Utara (Sumut). Siapa kelak menjadi Gubsu sangat penting bagi daerah ini. Karena figur itulah nantinya yang paling menentukan kemajuan ekonomi dan posisi Sumut dalam peta ekonomi nasional. Sebagaimana akan dibahas dalam edisi-edisi mendatang, tidak banyak yang tahu, apalagi sadar, bahwa posisi Sumut makin ditinggal provinsi lain. Selama 1998-2011 pertumbuhan ekonomi Sumut terus lebih baik dari nasional, posisi nasionalnya sudah menurun signifikan. Sementara dalam peta dunia posisi Indonesia dibanding Singapura, Malaysia, dan Thailand juga “setali tiga uang”. Media massa diharap dan dianggap berperan mencerdaskan masyarakat untuk menggunakan hak pilihnya. Tapi pola ini juga bagian dari Indonesia yang kaget lama menjadi negara demokrasi. Kebanyakan analisis dan edukasi yang disampaikan cenderung pada dimensi elektabilitas. Sangat sedikit yang mencerahkan dan menginspirasi masyarakat untuk memilih kapasitas seseorang dalam memimpin mewujudkan kemajuan ekonomi bangsa. Sebagai contoh sederhana, pada Pemilu 2009 banyak teman-teman dekat kaum terpelajar tega mengatakan: “Kalau pengusaha yang dipilih, nanti dijualnya negara ini.” Saya cuma bisa tertegun mendengar mulutnya yang fasih bicara. Seketika saya pun teringat emak di kampung yang pada 1960-an mengatakan, Amang, jualan kita ini akan makin laku kalau makin banyak orang kaya tinggal dan datang ke kampung ini. Tahun 2009 saya sering mengulangi kalimat tersebut dalam ngobrol bercanda. Ada dua kategori manusia yang menyukai orang lain lebih maju dari dirinya sendiri. Kategori mubaligh atau ulama, menyukai orang yang ditablighnya lebih rajin beribadah karena dengan begitu pahalanya makin banyak

untuk dinikmati kelak di syurga. Kategori sau-dagar, ingin orang lebih kaya karena dengan kayanya orang lain dirinya pun akan men-dapatkan manfaat yang lebih banyak. Ketika memberi ceramah kepada dekan FE PTN se-Indonesia, tahun lalu, di Auditorium Unhas, konglomerat ekonom dan Wapres 2004-2009 Jusuf Kalla lebih kurang menguraikan begini. Kalau petani di Makasar makin banyak yang kaya, maka penjualan mobil di Makasar akan meningkat. Para dekan tertawa riuh karena sadar bahwa JK ialah penguasa pasar otomotif di sana. Poinnya ialah sebagaimana pernah saya urai dalam satu artikel di Bisnis Indonesia sebelum Pilpres 2009. Intinya; secara rasional rakyat seharusnya memilih JK yang menjanjikan pembinaan pasar Tanah Abang. Tetapi, bahwa berdasarkan elektabilitas waktu itu, yang akan menang ialah SBY, dan memang demikian endingnya. Namun sekarang, JK sering dikenang karena semboyan “lebih cepat lebik”nya. Pada Pilgubsu mendatang, saya berharap masyarakat Sumut semakin cerdas dan dewasa mulai pencalonan hingga pencoblosan di tempat pemungutan suara. Semua pihak menyadari dan bertindak rasional bahwa memilih Gubsu itu menentukan level kehidupan rakyat dan posisi Sumut dalam peta ekonomi Indonesia 2020 yang akan menjadi ekonomi terbesar kelima dunia. Suatu masa Indonesia melampaui ekonomi rakyat Malaysia dan Singapura. Sebelum mengupasnya di edisi-edisi mendatang, perlu diintroduksi sekarang Sumut sangat ketinggalan dibanding Riau. Bahkan dengan beberapa provinsi lain di Sumatera, Sulawesi dan Kalimantan. Apalagi dibanding dengan Malaysia di Semenanjung. Mahasiswa FE USU peserta Entrepreneurs Development Progam (EDP) 2011 ke Malaysia, Singapura dan Batam, liburan lalu berdecak kagum. Pasalnya, ketika di Malaysia mereka sudah kagum melihat highway Penang-Kuala Lumpur dan Kampus UKM. Setiba di NUS dan NTU Singapura lebih dahsyat lagi. “Wow, very impressive,” tulis dosen muda pembimbing EDP dalam BB-nya. Kantin fakultasnya sebesar biro rektor. Begitulah kemajuan tetangga. Sementara kita di Sumut masih berkutat dengan highway Balmera dan Bandara Kualanamu yang tak siap-siap. Tapi ada menteri masih berteriak akan siap tahun depan, tahun depan dst. Kolom ini akan mengupas secara berseri latar belakang (kekuatan, kelemahan, peluang dan tatangan atau SWOT) dan isu strategis ekonomi Sumut. Demikian juga karakter kepemimpinan yang dibutuhkan daerah ini dan nominasi yang patut dikaji kapasitas kepemimpinannya sebagai calon Gubsu 2013-2018. Dengan demikian keputusan memilih seseorang calon didasarkan pada pengetahuan. Bukan karena keberhasilan pencitraan atau popularitas. Bagi para sahabat rekan serta pembaca lama dan baru yang ingin sharing silakan mengirim saran ke Selamat berjumpa kembali, dan selamat mengikuti kolom ini pada awal pekan mendatang.

Waspada/Muhammad Riza

PETANI di Desa Raya Paya, Kemukiman Bungie, Kecamatan Simpang Tiga, Pidie sedang beraktivitas di sawah memotong padi. Harga gabah dinilai petani masih dibeli murah oleh para tengkulak dan agen penampung berkisar Rp3.800 per kg sampai Rp3.900 per kg, Jumat (24/2).

Soal BBM, RI Bisa Belajar Dari Malaysia JAKARTA (Waspada): Mantan Ketua Kamar Dagang dan Industri (Kadin) Indonesia Adi Putra Darmawan Taher mengingatkan bahaya yang mungkin timbul jika bahan bakar minyak (BBM) tidak dinaikkan. Kendati demikian, dia meminta kepada Badan Urusan logistik (Bulog) untuk membuat pengaman stabilitas harga bahan pokok. “Harga minyak sekarang sudah di atas 100 dolar AS per barel, sedangkan APBN-P kita mematok harga 90 dolar AS per barel sehingga keseimbangan budget terganggu,” tutur Adi di sela Rapat Kerja Daerah (Rakerda) DPD Partai Golkar Bali, di Sanur, Denpasar, Bali, Minggu (26/2). Anggota DPR dari Partai Golkar itu mengakui, kenaikan harga BBM tak bisa dihindari. Hanya saja, jalan keluar yang harus diambil pemerintah yakni mengeluarkan kebijakan untuk memberi kompensasi kepada mereka yang terkena dampak langsung atas kenaikan harga BBM tersebut. Menurutnya, rencana kenaikan BBM mesti diiringi dengan skenario memberlaku-

kan kembali pemberian Bantuan Tunai Lansung (BLT). Namun, untuk jangka panjang BLT bukan solusi tepat. “Kalau mau kirim langsung kepada yang berhak melalui penyaluran rekening, tidak lewat birokrasi,” kata Korwil Pemenangan pemilu Bali, NTB dan NTT Partai GOlkar itu. Selama ada disparitas harga di pasaran, urai dia, pasti akan ada penyelewengan. Selain itu, jelas dia, Partai Golkar melihat skema kenaikan BBM yang dilakukan Malaysia bisa dijadikan contoh oleh Indonesia. Meski menaikkan harga BBM, Malaysia memberi proteksi kepada 17 kebutuhan bahan pokok. “Malaysia bisa menjadi salah satu model skema kenaikan harga BBM. Jadi, diberi buffer oleh Bulog. Kita lebih menganut keseimbangan pasar,” ungkap Adi.

Selain itu, Adi melanjutkan, hal utama yang mesti dilakukan pemerintah adalah pembangunan insfrastruktur. Dengan begitu, akan membuka lapangan pekerjaan yang lebih banyak. “Jadi tak perlu banyak orang yang diberi subsidi,” ujarya. “Bappenas sudah merencanakan itu. Sudah dialokasikan dana Rp21 triliun untuk infrastruktur,” tambah Adi. Pusing Sementara itu emerintah terus mencari solusi agar rencana kenaikan harga BBM tidak berpengaruh terhadap lonjakan jumlah masyarakat miskin. Pasalnya, setiap kebijakan kenaikan harga BBM muncul selalu diikuti kenaikan jumlah masyarakat miskin. “Untuk menaikkan harga BBM cukup berat. Rencana ini telah dipikirkan selama dua tahun,” kata Menteri BUMN, Dahlan Iskan di Auditorium Universitas Sebelas Maret Surakarta (UNS), Sabtu, (25/2). Memang dalam nyatanya, subsidi BBM sebesar Rp200 triliun lebih banyak dinikmati kalangan mampu yang memi-

Pidie Mulai Panen


MUHARRAM, 50, pedagang durian di Jalan Teungku Chik Di Tiro Pantonlabu, Aceh Utara, berjualan sambil menimang cucu, Jumat (24/2) pagi. Menurut Muharram durian dagangannya ini didatangkan dari Tangse, Pidie. Ukuran terkecil dijual Rp15.000 per buah. Sedangkan ukuran sedang dan besar berkisar antara Rp20.000-Rp40.000 per buah.

Maret, Pasar Sayur Langsa Siap Pakai LANGSA (Waspada): Kepala Dinas Perindustrian Koperasi dan Perdagangan serta UKM (Perindagkop dan UKM) Syahril Hasballah memastikan pasar sayur Kota Langsa yang berada di bekas terminal lama tersebut akan siap dipergunakan pada Maret mendatang, katanya, Jumat (24/2). “Pada Maret mendatang pasar sayur tersebut akan siap ditempati,” ujar Syahril. Dia mengatakan saat ini proses pembanguan proyek yang dibiayai dari Anggaran Pendapatan Belanja Negara (APBN) tahun 2011 telah memasuki tahap akhir.

“Nantinya setelah pasar tersebut selesai semua pedagang sayur yang saat ini berdagang di sepanjang jalan pasar baru Langsa akan dipindahkan ke tempat tersebut,” ucapnya. Sementara soal pembanguan Pasar blok A, Syahril memastikan pembangunan kawasan pertokoan tersebut akan dimulai kembali awal Maret mendatang . “Ada sedikit persoalan di dalam konsorsium pembangunan blok A, namun persoalan internal tersebut telah selesai. Pengembang telah berkomitmen akan melanjutkan tahap pembangunan pertokoan tersebut pada maret mendatang,” ujarnya.(b22)

Kebutuhan Raskin Di Samosir 219 Ton Per Bulan SAMOSIR (Waspada): Kebutuhan beras miskin (Raskin) yang didistribusikan Bulog Pematangsiantar untuk masyarakat Samosir sebanyak 219 ton per bulan. Dari jumlah tersebut per KK menerima 15 kg bagi Rumah Tangga Sasaran Penerima Manfaat (RTS-PM), sedangkan jenis beras yang diterima adalah setara dengan IR 64 medium. Bulog Pematangsiantar menggunakan data dari Badan Pusat Statistik Kab. Samosir untuk daftar RTS PM agar tidak salah sasaran. Untuk harga beras Raskin yang ditentukan sebesar Rp1.600 per kg, di mana harga tersebut adalah harga dari gudang Bulog sebagai titik distribusi

ke kantor kecamatan. Untuk 2012, Bulog belum mendistribusikan beras Raskin ke Samosir karena SK dari Bupati Samosir tentang permintaan alokasi belum diterima Bulog Siantar. Saat ditemui di kantornya Pimpinan Bulog Pematangsiantar tidak bersedia, selanjutnya Ketua Raskin Bulog Pematangsiantar Haris Fadillah menjawab Waspada, di kantornya pekan lalu. Haris menambahkan wilayah kerja bulog Pematangsiantar meliputi Kab. Samosir, Siantar, Simalungun, Humbang, Tobasa dan Taput. (c11)

SIGLI (Waspada): Sebagian kecamatan di Kabupaten Pidie mulai panen padi, ditandai dengan melakukan kenduri blang dan doa bersama (syukuran panen-red). Demikian pantauan Waspada, Jumat (24/2). Daerah yang sudah mulai melakukan panen, antara lain Desa Raya Paya, Kecamatan Simpang Tiga, dan sebagian Kemukiman Laweung, Kecamatan Muara Tiga, Kabupaten Pidie. Meski hasil panen kali ini dinilai sangat bagus. Namun, seperti biasa, para petani masih mengeluhkan nilai beli gabah sangat rendah, berkisar Rp. 3.800 per kg sampai Rp3.900 per kg. Harga tersebut sangat tidak berpihak dan cenderung merugikan para petani. Sofyan, 37, salah seorang petani di Kecamatan Simpang Tiga, menuturkan untuk sementara waktu dia tidak akan menjual padi yang baru dipanennya itu, karena harga

ditawarkan agen penampung padi dan para tengkulak sangat rendah. Bila dibandingkan dengan modal yang telah dikeluarkannya, mulai dari proses pengolahan lahan sawah, penanaman bibit, pupuk sampai biaya pemotongan dan pengangkutan hasil panen telah dikeluarkannya sangat besar. “Jadi untuk sementara saya simpan dulu padinya sambil menunggu harga jualnya naik. Apabila semua petani tidak menjual hasil gabahnya, pasti nilai jualnya akan meningkat. Jadi saya memilih menyimpannya sambil menunggu harga naik,” katanya Sofyan. Menurut Sofyan, untuk sementara agen penampung dan para tengkulak mematok harga beli gabah senilai itu, karena agen penampung dari luar daerah belum turun ke Pidie. “Sekarang agen penampung berani menawarkan harga Rp3.800 per kg sampai Rp3.900 per kg karena agen

penampung dari Medan dan Sumatera Utara belum datang ke sini. Tetapi nanti kalau agen dari Medan sudah datang, biasanya agen-agen penampung dari lokal baru sibuk,” ujar Sofyan. Pimpinan Kilang Padi SGB Bungie, Kecamatan Simpang Tiga, Kabupaten Pidie T. Bustami, kepada Waspada, Jumat (24/2), menjelaskan pihaknya menerima harga beli gabah dari tingkat petani berkisar Rp3.800per kg sampai Rp9.900 per kg. Harga itu menjadi patokan pihaknya sementara ini, karena nilai beli beras yang diterima Dolog saat ini senilai Rp6.600 per kg. “Saat ini kami berani membeli gabah dari para petani baru bisa senilai itu, karena harga beli beras oleh Perum Dolog senilai Rp6.600 per kg. Tetapi kalau nanti sudah kesimpilan baru dari Dolog, mungkin akan ada perubahan,” demikian T Bustami. (b10)

Dinas Perindagkop Dan Usaha Kecil Menengah Langsa Salurkan Bantuan LANGSA (Waspada): Guna meningkatkan daya saing bagi para pelaku Usaha Kecil dan Menengah (UKM) di Kota Langsa, Dinas Perindustrian Koperasi dan Perdagangan serta UKM (Perindagkop dan UKM) setempat menyerahkan beberapa jenis bantuan dalam bentuk peralatan kerja. Kepala Dinas Perindagkop dan UKM Syahril Hasballah di sela-sela acara penyerahan bantuan di halaman kantor dinas tersebut beberapa hari lalu menyebutkan adapun kelompok penerima bantuan peralatan produksi UKM kepada koperasi dan kelompok ma-

syarakat meliputi, bantuan timbangan bagi pedagang kaki lima di pasar langsa, mesin pengolahan pupuk, bantuan sarana jahit sepatu bagi penjahit sepatu Langsa. Kemudian bantuan mesin bordir semi komputer dan penyerahan bantuan peralatan usaha kepada kelompok perempuan nelayan serta bantuan perlatan pemurnian dan ionisasi garam. “Selain bantuan tersebut Diskoperindagkop Langsa mendapat bantuan satu unit mobil lapangan metrologi,” sebut Syahril Hasballah lagi sembari menambahkan ban-

tuan tersebut berasal dari dana APBN, APBA dan APBK tahun lalu. Dia mengaharapkan para pelaku UKM jangan hanya terpaku dengan bantuan tersebut, mereka diharapkan dapat bekerja lebih optimal lagi sehingga diperoleh peningkatan pendapatan yang signifikan. “Kita harapkan bantuan yang diberikan akan menjadi stimulus bagi peningkatan kinerja dimasing-masing UKM, kalau hanya berharap pada bantuan yang kita berikan maka tidak akan terjadi peningkatan pendapatan,” ujarnya (b22)

liki mobil atau sepeda motor. “Kan kasihan orang yang tidak mempunyai mobil dan motor. Mereka tidak bisa menikmati uang subsidi BBM tersebut,” ujarnya. Meski demikian, tekanan untuk menaikkan harga BBM sangat luar biasa. Bahkan, setiap kali menyampaikan persoalan tersebut ke presiden selalu dijawab bahwa secara teori ekonomi memang selalu begitu harus dinaikkan. “Jika nanti terpaksa dinaikkan karena tidak mungkin lagi.

Yang dipikirkan adalah, bagaimana supaya tidak terulang lagi, yakni agar apabila harga BBM naik tetapi orang miskinnya tidak bertambah,” ujarnya. Fomulasi itulah yang sedang dipikirkan pemerintah. Butuh diskusi panjang supaya kenaikan harga BBM tidak berdampak terhadap kenaikan jumlah orang miskin. “Formula ini belum ditemukan sekarang. Padahal, kita siang dan malam memikirkan terus,” ujar Dahlan. (okz)

JK : Harga BBM Idealnya Naik Rp2.000 Per Liter MAKASSAR (Waspada): Rencana pemerintah yang akan menaikkan harga BBM subsidi pada April 2011 mendatang, mendapat dukungan dari Mantan Wakil Presiden Jusuf Kalla (JK). Menurut JK, pemerintah harus segera menaikkan BBM dengan angka idealnya Rp2.000 per liter. Hal ini disampaikan JK usai menghadiri HUT PT Bosowa Grup di Hotel Sahid Jaya Makassar, Sabtu (25/2) malam. “Hanya dengan cara menaikkan harga BBM kita bisa memperbaiki perekonomian bangsa dan bisa mengurangi beban pemerintah. Kenaikan harga BBM yang ideal adalah Rp2.000 karena masih bisa dijangkau oleh masyarakat,” jelas JK. JK menambahkan, meskipun kebijakan kenaikan harga BBM dianggap tidak populis, pemerintah harus segera mengambil kebijakan tersebut untuk mengalihkan anggaran subsidi BBM pada pembangunan infrastruktur nasional. Diberitakan sebelumnya, pemerintah berencana membatalkan pembatasan dan mengalihkan kebijakan tersebut menjadi kenaikan harga BBM. Perubahan tersebut, rencananya dimasukkan dalam rancangan perubahan APBN 2012 yang akan diajukan bulan ini ke DPR. Hal itu sejalan dengan terbitnya Peraturan Presiden No.15/ 2012 tentang Penetapan Harga Jual Eceran BBM bersubsidi. Kenaikan BBM ini tidak bisa dihindari karena minyak dunia mengalami kenaikan dan itu mempengaruhi terhadap harga BBM di Indonesia. Solusinya, dapat diatasi dengan mengurangi subsidi dan menaikkan BBM. Namun, pemerintah juga akan memberikan kompensasi terhadap rakyat dengan bantuan yang masih dibahas bentuknya untuk meringankan beban rakyat.(okz)

Isteri Dirjen Otda Kemendagri Kagumi Kerajinan DS LUBUKPAKAM (Waspada): Ny Hj Yani Djoehermansyah Djohan mengakui hasil tenunan ulos dan songket Deliserdang memiliki kualitas luar biasa karena hasilnya begitu halus dengan corak berbagai etnik yang ada di Deliserdang. Begitu juga kerajinan lainnya yang memiliki keunikan dan daya tarik tersendiri. “Saya kagum dengan tenunan khas Deliserdang, selain hasilnya begitu halus dan rapi, juga memiliki banyak pilihan.” Selama ini saya hanya mendengar tentang tenunan khas Deliserdang yang katanya begitu indah. Tapi kini saya sudah bisa melihat sendiri, jelas Yani Djoehermansyah ketika mengujungi gedung Dewan Kerajinan Nasional Daerah (Dekranasda) Deliserdang berlokasi di Jalan Negara MedanLubukpakam usai mendampingi kunjungan kerja suaminya Prof Djoehermansyah Djohan di Deliserdang, Sabtu (25/2). Kunjungannya ke Dekranasda Deliserdang disambut Ketua Dekranasda Ny Hj Anita Amri Tambunan didampingi Ny Hj Asdiana Zainuddin Mars dan beberapa unsur pengurus lainnya. Menurut isteri Dirjen Otda Kemendagri ini, untuk menggerakkan sentra industri kerajinan di setiap daerah tidak semudah membalikkan telapak tangan. Karena diperlukan kemauan dan kejelian menggali potensi yang ada serta kesabaran. Terlebih lagi sentra industri kerajinan tersebut berada di masing-masing kecamatan. Di sinilah diperlukan peranan Dekranasda sebagai penggeraknya. Sehingga potensi kerajinan di masing-masing kecamatan bisa terangkat yang muaranya dapat menambah income keluarga. Nah, melihat hasil kerajinan di sini, membuktikan Dekranasda telah menunjukkan kepeduliannya menggerakkan sentra kerajinan di daerah ini, katanya. Sementara Ketua Dekranasda Deliserdang Anita Amri Tambunan menjelaskan berbagai bentuk kerajinan dan bahan pembuatannya. Seperti ulos batak khas Deliserdang, kain tenun, mukena berbahan halus, payet, bordir, batik Deliserdang, batik gorga, sepatu, sirup dan kerajinan lainnya.(a06)

Waspada, Senin 27 Februari 2012