Issuu on Google+

Medan 25-32 C

Berastagi 20-30 C

R. Prapat 26-330C

Parapat 20-30 0C

P. Siantar 18-27 C

Sibolga 22-31 C





Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Selasa

BMKG Polonia

SELASA, Pon, 25 Januari 2011/20 Safar 1432 H

No: 23397 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Waspada/Surya Efendi

TERSANGKA teroris dan perampokan CIMB Niaga Medan yang berjumlah sembilan orang tiba di Kejaksaan Tinggi Sumatera Utara, Senin (24/1) dari Jakarta.

Sembilan Tersangka Perampok Bank Diserahkan Ke Kejatisu MEDAN (Waspada): Sembilan tersangka kasus dugaan teroris dan perampokan Bank CIMB Niaga di Jl. Aksara Medan yang ditangkap Tim Detasemen Khusus 88 Mabes Polri, diserahkan ke Kejaksaan Tinggi Sumut (Kejatisu), Senin (24/1). “Ada sembilan orang tersangka yang dilimpahkan penyidik Mabes Polri kepada Kejatisu,” kata Kasi Penerangan Hukum/Humas Kejatisu Edi Irsan Kurniawan

Tarigan menjawab sejumlah wartawan, kemarin. Kesembilan tersangka itu, yakni Zumirin alias Sobirin alias Ari, Jaja Miharja alias Hasyim alias Syafrizal, Nibras alias Arab alias Amir alias Wawan, Pamriyanto alias Suryo Saputro alias Pian alias Empi, Beben Khairul alias Banin alias Beben alias Abu Ziyad, Agus Sunyoto alias Syaifuddin alias Gaplek, Marwan alias Nano alias Wak Geng, Anton Sujarwo alias Iqbal alias Supriyadi alias Supri dan Khairul Gazali alias Abu Yasin.

Pantauan Waspada, mereka tiba di Bandara Polonia sekitar pukul 12:20 dengan pesawat Lion Air JT-200. Para tersangka ratarata memakai baju koko warna putih dan kaos lengan panjang. Bahkan dua di antaranya menggunakan kursi roda mulai turun dari pesawat hingga masuk ke mobil yang membawa mereka ke Kejatisu untuk penyelesaian administratif. Kedatangan tersangka menimbulkan kesibukan di Bandara Polonia, khusus petugas keamanan. Proses pelimpahan tersangka ke

Medan di bawah pengawalan Tim Kepolisian Daerah Sumatera Utara, Tim Densus 88 Mabes Polri dan Kejaksaan Agung. “Para tersangka ini hasil penyidik Densus 88 Mabes Polri dan dibawa ke Medan untuk kebutuhan proses persidangan,” kata Direskrim Polda Sumut Kombes Pol Agus Andrianto. Lanjut ke hal A2 kol. 6

Polisi Ringkus Pengedar Buku Penistaan Agama Islam Nyaris Beredar Di L. Batu RANTAUPRAPAT (Waspada): Aparat Polres Labuhanbatu menangkap seorang warga Batam kelahiran Parapat saat hendak menyebarkan buku-buku berisi penistaan terhadap agama Islam di Aek Nabara, Kec. Bilah Hulu, Labuhanbatu, Minggu (23/1).

Waspada/Surya Efendi

WARGA menyaksikan jenazah mahasiswa ITM saat dibawa ke rumah sakit. Inzet: Nenek Asmawati (jilbab hitam) menangis ketika berjalan menuju kost korban di Jl. Air Bersih Medan, Senin (24/1).

Kapolres L. Batu AKBP Roberts Kennedy, SIK. SH.M.Hum didampingi Kasubag Humas AKP MT Aritonang, Pabung AKP Mijer dan Kanit Resum Ipda Donny Nainggolan kepada Waspada, Senin (24/1 ) di Mapolres mengatakan, pelaku RANMS, 32, tidak memiliki pekerjaan tetap ditangkap saat hendak menye-barkan buku berisi menghina agama. “Pelaku ditangkap sebelum sempat menyebarkan buku-buku itu ke masjid-masjid atau rumah ibadah lainnya, “paparnya.Motifnya ingin

membuat keributan agar Labuhanbatu tidak kondusif, papar Kapolres. Saat ini, ungkap Kapolres, pelaku diambil keterangannya dan sudah ditahan tapi tidak digabungkan dengan tahanan lain. “Kita isolir pelaku agar tidak mempengaruhi tahanan lain,“ papar Kapolres sembari mengatakan polisi terus melakukan penyidikan lebih dalam dan intensif sebab kita khawatir ini merupakan jaringan luas dan besar. Lanjut ke hal A2 kol. 6


DIDUGA JEJAK UFO: Sebuah pola terbentuk sangat rapi menyerupai jejak UFO di tengah sawah di Desa Rejosari, Jogotirto, Berbah, Kab. Sleman,Yogyakarta, Senin (24/1). Seorang warga setempat pada Sabtu (22/1) malam, mendengar suara gemuruh seperti Helikopter mendarat.

Mahasiswa Asal Kisaran Dibunuh Di Kamar Kos

Heboh Lingkaran Diduga Bekas Pendaratan Piring Terbang Di Sleman

MEDAN (Waspada): Mahasiswa asal Kota Kisaran, Asahan, M Agus Widiyah Lubis, 20, ditemukan tewas bersimbah darah di dalam kamar kosnya di Jl. Air Bersih, Gang Kasih No 34-B, Kel. Sudirejo, Kec. Medan Kota, Senin (24/1) sekira pukul 08:00. Mayat Agus pertama kali ditemukan oleh teman wanitanya Dita Ningsih, mahasiswi Fakultas Kedokteran. Sekira pukul 08:00. Dita datang menemui korban untuk sesuatu keperluan. Karena pintu terkunci dari dalam, dia mengetuknya berkalikali, namun tak ada jawaban. Dita yang membawa kunci serap kamar kos kekasihnya itu dan membuka pintu. Begitu masuk, dia terperanjat melihat Agus terbujur kaku di atas ranjangnya dalam posisi telungkup dan bersimbah darah. Lanjut ke hal A2 kol. 1

LAPAN: Secara Sains UFO Tidak Ada

SMS Terakhir Agus Untuk Sang Nenek PESAN singkat (SMS) yang dikirim M. Agus Widia Lubis, Sabtu (23/1) malam, kepada neneknya menjadi pesan yang terakhir bagi sang nenek, Asmawati, 56, dan atoknya (kakek,red) berdomisili di kompleks Johor Indah Permai Medan. Isi SMSnya, dia menanyakan kabar sang nenek dan kakek mengenai kesehatan keduanya. “Sekitar jam setengah sepuluh malam, dia sempat nanya kabar saya dan atoknya, dia juga menyuruh kami banyak istirahat dan jangan terlalu capek,” kata Neneknya Asmawati sembari terisak-isak di ruang instalasi jenazah RSU dr. Pirngadi Medan. Lanjut ke hal A2 kol. 1

SLEMAN, Yogyakarta (Waspada): Ratusan orang berbondong ke lokasi persawahan di sebuah desa di Sleman, Yogyakarta, menyusul kabar menghebohkan tentang terjadinya lingkaran, yang kemudian dikaitkan dengan pendaratan UFO (Unidentified Flying Object) alias piring terbang. Jejak geometris aneh terWaspada/Surya Efendi

KERAMBA di perairan Danau Toba, Kamis (20/1). Sayangnya, Danau Toba yang indah dan salah satu keajaiban di dunia ini kurang mampu menyedot wisatawan.

Danau Toba Tidak Maksimal Sebagai sebuah potensi alam, Danau Toba sungguh luar biasa. Kita sepakat bahwa danau ini adalah salah satu keajaiban dunia. Tapi potensi itu selalu tidak sebanding dengan tingkat kunjungan wisata ke Danau Toba, atau ke Sumut pada umumnya. DANAU Toba belum menjadi industri andalan utama bagi Pendapat Asli Daerah (PAD) di daerah yang dialiri kawasan danau. Wisatawan lokal maupun dari mancanegara belum bisa dijaring secara maksimal. Sumut masih gagal diidentikkan dengan daerah kunjungan wisata seperti halnya Bali.

Kebahagiaan Oleh H. Ameer Hamzah Empat hal yang membawa kebahagiaan, yaitu perempuan shalehah, rumah yang luas, tetangga yang baik, dan kendaraan yang enak! (HR:Ibnu Hibban)

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 3

Unimed Tutup Jalur Mandiri Pada SNMPTN 2011 MEDAN (Waspada): Unimed tidak akan membuka jalur mandiri dalam Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) tahun 2011. Selama ini, menurut pejabat di Unimed, pihaknya tidak mengenal adanya jalur mandiri. “Di Unimed tidak mengenal adanya jalur mandiri karena memang tidak ada. Jadi, pasca Permendiknas yang

Ledakan Di Bandara Moskow, 31 Tewas


ADA sepotong doa dari al-Quran yang sering kita baca. Rabbana Aatina fid Dunya hasanah, wa fil aakhirati hasanah. Waqina azaban naar. Ya Tuhan kami berilah kebahagiaan kepada kami di dunia, dan kebahagiaan di akhirat. Dan lindungilah kami dari azab neraka.

Ada apa dengan penanganan Danau Toba? Tim Waspada menempuh jarak sekitar 600 km dari Medan untuk mengelilingi danau tersebut. Laporan kali ini membahas tentang kondisi infrastruktur jalan.


Pengurus MUI Sumbar Dipecat Jika Merokok PADANG(Antara): Personel Majelis Ulama Indonesia (MUI) Sumatera Barat yang masih ingin duduk di struktur kepengurusan organisasi masa khidmah 2010-2015, tidak boleh merokok atau akan diberhentikan jika melanggar rekomendasi dan hasil ijtimak di Kota Padangpanjang. Ketegasan ini disampaikan Ketua Bidang Ukhwah dan KUB MUI Rusdi di Padang, Senin(24/1), karena masih ada pengurus MUI Sumbar yang merokok. Lanjut ke hal A2 kol. 1

MOSKOW, Rusia (AP): Satu ledakan merobek aula terminal kedatangan bandara internasional tersibuk Moskow, Rusia, Senin (24/1), yang menyebabkan 31 orang tewas dan mencederai kira-kira 130 lainnya, demikian menurut kalangan pejabat. Presiden Rusia Dmitr y Medvedev menyebut ledakan itu sebagai satu serangan teror. Kantor berita pemerintah RIA Novosti , mengacu pada keterangan para sumber penegak hukum, mengatakan ledakan tengah hari di Bandara Domodedovo boleh jadi disebabkan oleh serangan bunuhdiri. Pada saat itu bandara Lanjut ke hal A2 kol. 6

sebut terjadi di Dusun Jogomangsan, Jogotirto, Berbah pada Sabtu malam dan menjadi perhatian warga sejak Minggu dan Senin (24/1). Warga mendaki bukit untuk melihat crop circle atau pola simetris berbentuk lingkaran yang diduga lokasi pendaratan UFO dari atas. Lanjut ke hal A2 kol. 6

Waspada/Nurkarim Nehe

TERSANGKA pengedar memegang barang bukti upal pecahan Rp100.000, 21 lembar, Senin (23/1) sore.

Polsek Airbatu Sikat Upal AIRBATU, Asahan (Waspada): Polsek Air Batu Kabupaten Asahan berhasil menyikat tersangka pengedar uang palsu (upal) saat akan transaksi di kawasan Kedai Ledang Kisaran Timur, Senin (24/1) sekira pukul 13:00. Polsek Air Batu sudah mendeteksi dugaan upal menurunkan tim Briptu Dicky Siringoringo dan Briptu Lanjut ke hal A2 kol. 3

baru, kita tetap saja seperti ini dan tidak ada perubahan karena dari dulu jalur kita cuma itu, jalur PMP yang sekarang disebut jalur undangan dan SNMPTN, sedangkan ujian lokal untuk Diploma III,” kata Rektor Universitas Negeri Medan (Unimed) Syawal Gultom di kampus Unimed, Senin (24/1). Gultom menyebutkan, Unimed tidak menggunakan jalur mandiri dalam penerimaan mahasiswa baru bukan karena adanya Permendiknas yang baru,sehingga Unimed berubah, tetapi memang sejak dari dulu porsi terbesar penerimaan mahasiswa baru Unimed melalui jalur SNMPTN. Mengenai jumlah kuota yang akan diterima Unimed dalam SNMPTN 2011, Gultom menyebutkan, sama seperti tahun sebelumnya, sekira 2.492 orang, baik melalui jalur undangan maupun ujian tulis. Lanjut ke hal A2 kol. 3

Seramp ang erampang - Piring terbang emang gak ada, kecuali beras di dapur habis... - He...he...he...

Medan 25-32 C

P.Sidimpuan 20-30 C

R.Prapat 26-33 0C

Penyabungan 20-30 0C

Berastagi 18-270C


Sibolga 22-310C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SELASA, Pon, 25 Januari 2011/20 Safar 1432 H z No: 23397 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada/Surya Efendi

TERSANGKA TERORISME: Enam dari sembilan orang tersangka terorisme dikawal pihak kejaksaan dan kepolisian setibanya di halaman Kejaksaan Tinggi Sumut di Medan, Senin (24/1), guna penyerahan berkas dan barang bukti.Sembilan tersangka terorisme tersebut di antaranya terlibat kasus perampokan bank CIMB Niaga Medan pada 18 Agustus lalu.

9 Tersangka Perampokan CIMB Ke Kejatisu Komplotan Bersenpi Gagal Rampok Toko Emas Karena Ada Polisi LHOKSUKON, Aceh Utara (Waspada): Komplotan perampok bersenjata api beraksi di kota Lhoksukon, ibukota Kab. Aceh Utara, Senin (24/1) sekitar pukul 16:30. Mareka berencana merampok toko emas Subur Baru. Namun gagal karena kebetulan di dalam toko ada seorang polisi dari jajaran Polres Aceh Utara. Informasi dihimpun Waspada, kemarin petang, kawanan pelaku berjumlah empat orang. Semuanya memakai helm berkaca gelap. Mereka datang menggunakan dua sepeda motor, yakni Vario dan Revo. Pelaku dilaporkan membawa empat pucuk senjata api laras panjang yang diduga jenis AK-47. “Senjata itu awalnya disembunyikan di balik jaket. Begitu sampai di depan toko emas Subur Baru, pelaku langsung turun sembari mengeluarkan senjata mereka. Tapi sebelum sempat masuk ke toko, mareka buru-buru balik arah untuk kabur karena di dalam toko ada seorang polisi berpakaian dinas. Sebelum lari, pelaku juga sempat menembak sekitar dua kali ke arah toko. Beruntung tidak ada korban. Tembakan itu hanya mengenai sebuah cermin,” kata Zulkifli, 28, warga Lhoksukon. Selanjutnya, sambung Zulkifli, warga yang mendengar suara letusan senjata segera menuju lokasi kejadian. Sementara para pelaku langsung kabur ke arah jalan Lapang. Ketika melintas di depan pusat pasar Lhoksukon, pelaku juga sempat melepaskan tembakan ke udara

MEDAN (Waspada): Sembilan tersangka kasus perampokan Bank CIMB Niaga di Jalan Aksara Medan dan aksi terorisme di Sumut yang ditangkap Tim Detasemen Khusus 88 Mabes Polri diserahkan ke Kejaksaan Tinggi Sumut, Senin (24/1).

“Ada sembilan tersangka yang dilimpahkan penyidik Mabes Polri ke Kejatisu,” kata Kasi Penerangan Hukum/ Humas Kejatisu Edi Irsan Kurniawan Tarigan kepada wartawan, kemarin.

itu tidak aktif lagi dalam jabatannya. “Dan sekarang nonjob. Selanjutnya, akan ada proses pidana maupun etika profesi,” kata Timur. Bila nanti ditemukan masalah pidana, maka para anggota Polri yang

Kesembilan tersangka itu yakni Zumirin alias Sobirin alias Ari, Jaja Miharja alias Hasyim alias Syafrizal, Nibras alias Arab alias Amir alias Wawan, Pamriyanto alias Suryo Saputro alias Pian alias Empi, Beben Khairul alias Banin alias Beben alias Abu Ziyad, Agus Sunyoto alias Syaifuddin alias Gaplek, Marwan alias Nano alias Wak Geng, Anton Sujarwo alias Iqbal alias Supriyadi alias Supri dan Khairul Gazali alias Abu Yasin. Pantauan Waspada, para tersangka ini tiba di Bandara Polonia sekitar pukul 12:20 dengan menumpang pesawat Lion Air JT-200. Tersangka ratarata mengenakan baju koko warna putih dan kaos lengan panjang.

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 ko 6l

Terseret Kasus Gayus

17 Anggota Polri Dan 35 Pegawai Imigrasi Dinonaktifkan JAKARTA (Waspada): 17 anggota Polri yang terseret kasus terdakwa mafia pajak Gayus Tambunan saat ini nonaktif dari berbagai tugas. Saat ini Mabes Polri mengusut dugaan keterlibatan 17 anggotanya itu. “Hasil Propam, ada 17 anggota Polri. Semuanya masih

dalam proses,” kata Kapolri Jenderal Polisi Timur Pradopo usai rapat penanganan kasus Gayus Tambunan di Istana Wapres, Jakarta, Senin (24/1). Menurut Timur, semua yang terlibat itu terkait dugaan pelanggaran penyidikan perkara Gayus Tambunan. Secara administrasi 17 anggota Polri

Ribuan Warga Kluet Raya Demo Ke Kantor Bupati

Lanjut ke hal A2 kol 6

Hasil Pemilukada Bisa Dianulir MK BANDA ACEH (Waspada): Hasil Pemilukada di Aceh dapat dianulir oleh Mahkamah Konstitusi (MK) bila pelaksana Pemilukada tidak mengakomodir Calon Independen. Hal tersebut disampaikan mantan Ketua KIP Aceh, M. Jakfar, SH, M.Hum kapada Waspada, Senin (24/1). Melalui pesan singkatnya Jakfar meyakini semua pihak akan menerima putusan MK tersebut. “Bila tidak ada qanun

baru maka bisa dipakai qanun yang lama,” ungkap Jakfar. Secara terpisah, pakar hukum Unsyiah Mawardi Ismail, SH, M.Hum menyebut tidak ada alasan PA dan wakilnya di DPRA untuk menolak hasil putusan MK tentang calon independen, “Presiden saja harus melaksanakan putusan MK,” kata Mawardi. Terlebih, kata Mahardi, MK

Lanjut ke hal A2 kol 1

Waspada/Surya Efendi

TAK MAMPU SEDOT BANYAK PENGUNJUNG: Kapal penumpang mengarungi perairan Danau Toba, Kamis (20/ 1). Sayangnya, Danau Toba yang indah dan salah satu keajaiban di dunia ini kurang mampu menyedot banyak pengunjung dikarenakan beberapa faktor.

Danau Toba Tidak Maksimal SEBAGAI sebuah potensi alam, Danau Toba sungguh luar biasa. Kita sepakat bahwa danau ini adalah salah satu keajaiban dunia. Tapi potensi itu selalu tidak sebanding dengan tingkat kunjungan wisata ke Danau Toba, atau ke Sumut pada umumnya. Danau Toba belum menjadi industri andalan utama bagi Pendapat Asli Daerah (PAD) di daerah yang dialiri kawasan danau. Wisatawan lokal maupun dari mancanegara belum bisa dijaring secara maksimal. Sumut masih gagal diidentikkan dengan daerah kunjungan wisata seperti halnya Bali. Ada apa dengan penanganan Danau Toba? Tim Waspada menempuh jarak sekitar 600 km dari Medan untuk mengelilingi danau tersebut. Laporan kali ini membahas tentang kondisi infrastruktur jalan.

Kebahagiaan Oleh: H. Ameer Hamzah Empat hal yang membawa kebahagiaan, yaitu perempuan shalehah, rumah yang luas, tetangga yang baik, dan kendaraan yang enak! (HR:Ibnu Hibban)

Lanjut ke hal A2 kol 2

Pemandangan dari Tele, salah satu puncak tertinggi di Danau Toba, sungguh sangat memukau. Dari bebukitan biru itu memuncrat buih-buih putih berbentuk tali temali. Tali putih itu mengalir ke permukaan danau seperti semburan busa. Sungguh estetis. Perjalanan sekitar lima jam dari Medan serasa terbalas dalam sekejab. Tapi wisata ternyata bukan cuma soal memandang keindahan saja. Ada banyak faktor yang mempengaruhinya seperti kebersihan, budaya lokal, kenyamanan dan infrastruktur pendukung seperti hotel dan akses jalan penghubung. Persoalan utama infrastruktur jalan ke objek wisata Danau Toba ini masih “tradisional”. Untuk sampai ke

Lanjut ke hal A2 kol 3

MEDAN (Waspada): Agama apapun pasti tidak rela jika ajarannya dihina. Begitu juga dengan Islam, umatnya pasti tidak rela jika ajaranya dihina, apalagi menghina Nabi Muhammad SAW. Islam tidak pernah mencaci agama lain. “Maka jangan lahirkan kebiadaban gaya baru untuk memojokkan atau menyudutkan Islam dengan cara mengirimkan buku dan VCD ke masjid-masjid,” ungkap Ketua PB Al Jam’iyatul Washliyah Yusuf Pardamean kepada Waspada, Senin (24/1), menanggapi buku dan VCD yang menyudutkan Islam yang dikirim ke sejumlah masjid tanpa ada alamat pengirimnya. Menurut Pardamean, agama Islam adalah agama yang paling mengajarkan toleransi. Islam menghendaki

Lanjut ke hal A2 kol 1

Ratusan Pengemudi Betor Datangi DPRD Sibolga

SIBOLGA (Waspada): Ratusan pengemudi becak bermotor (Betor) di Kota Sibolga mendatangi kantor DPRD setempat, Senin (24/1) untuk menyampaikan ‘unek – unek’ terkait berkeliarannya becak mesin super cap yang berasal dari Tapanuli Tengah. Sofian Aswad selaku koordinator aksi dalam orasinya mendesak Kepala Dinas (Kadis) Perhubungan, Komunikasi dan Informasi untuk me-

Joy TTobing obing Mohon Keadilan Dari Presiden

Al Bayan

ADA sepotong doa dari al-Quran yang sering kita baca. Rabbana Aatina fid Dunya hasanah, wa fil aakhirati hasanah. Waqina azaban naar. Ya Tuhan kami berilah kebahagiaan kepada kami di dunia, dan kebahagiaan di akhirat. Dan lindungilah kami dari azab neraka.

RANTAUPRAPAT (Waspada): Polres Labuhanbatu menangkap seorang warga Batam kelahiran Parapat saat hendak menyebarkan buku-buku berisi penghinaan terhadap agama tertentu di Aek Nabara, Kec. Bilah Hulu, Labuhanbatu, Minggu (23/1). Kapolres Labuhanbatu AKBP Roberts Kennedy didampingi Kasubag Humas AKP MT Aritonang, Pabung AKP Mijer dan Kanit Resum Ipda Donny Nainggolan kepada Waspada, Senin (24/1 ) mengatakan, pelaku RANMS ,32, yang diketahui tidak memiliki pekerjaan tetap ditangkap saat hendak menyebarkan buku yang intinya berisi menghina suatu agama tertentu. “Pelaku ditangkap sebelum sempat menyebarkan buku-buku itu ke sejumlah masjid atau rumah ibadah lainnya,” paparnya seraya menambahkan motifnya ingin membuat keributan agar Labuhannbatu tidak kondusif. Saat ini, ungkap Kapolres, pelaku diambil keterangannya dan sudah ditahan. “Kita isolir pelaku agar tidak mempengaruhi tahanan lain,” papar Kapolres sembari mengatakan polisi terus melakukan penyidikan lebih dalam dan intesif sebab khawatir ini merupakan jaringan luas dan besar. Kapolres mengimbau khususnya kepada Forum Lintas Agama agar dalam menyampaikan informasi lebih bijak dan dewasa. “Kita menginginkan Labuhanbatu kondusif dan masyarakat tidak terpecah belah. (a26)

Islam Tidak Rela Dihina

Lanjut ke hal A2 kol 2

TAPAKTUAN (Waspada): Ribuan warga yang menamakan diri Aliansi Masyarakat Kluet Raya (Amakar), Senin (24/1) melakukan aksi unjuk rasa di kantor Bupati Aceh Selatan di Tapaktuan. Mereka menuntut perbaikan jalan kabupaten yang rusak akibatkan keberadaan dan aktivitas mobil angkutan hasil pertambangan bijih besi milik PT Pinang Sejati Utama(PSU) yang beroperasi dari Kecamatan Kluet Tengah-Kotafajar, Kecamatan Kluet Utara.

Warga Batam Ditangkap Saat Akan Sebarkan Buku Hina Agama


DIDUGA JEJAK UFO. Sebuah pola terbentuk sangat rapi menyerupai jejak UFO di tengah sawah di Desa Rejosari,Jogotirto, Berbah, Kabupaten Sleman, Yogyakarta, Senin (24/1).

Foto Sawah ‘UFO’ Hasilkan Pundi Rupiah

JAKARTA (Waspada): Penyanyi Joy Tobing menganggap penahanan suaminya, Daniel Sinambela, tidak adil karena asal tangkap. Joy pun memohon keadilan dari Presiden Susilo Bambang Yudhoyono. “Saya memohon dengan kerendahan hati, saya sedang mengandung delapan bulan. Saya memohon kepada bapak

Lanjut ke hal A2 kol 6

SLEMAN (Waspada): Roda ekonomi ikut berputar seiring meluasnya kabar lambang misterius yang menurut penuturan sejumlah warga menyerupai bekas pendaratan Unidentified Flying Object (UFO) di Sleman, Yogyakarta, Minggu (23/1) sore. Foto sawah ini pun laris terjual. Salah seorang pemuda Jogotirto Berbah, Dalis, mengambil gambar sawah tersebut lalu menjual kepada

Lanjut ke hal A2 kol 2

Waspada/Surya Efendi

MENANGIS HISTERIS: Nenek dan salah seorang keluarga korban menangis histeris ketika berjalan memasuki tempat kost korban di Jl. Air Bersih Medan, Senin (24/1).

Mahasiswa Asal Kisaran Dibunuh Di Medan MEDAN (Waspada): Mahasiswa asal Kota Kisaran, Asahan, M Agus Widiyah Lubis, 20, ditemukan tewas bersimbah darah di dalam kamar kosnya di Jalan Air Bersih Gang Kasih No 34-B, Kelurahan Sudirejo, Kecamatan Medan Kota, Senin (24/1) sekira pukul 08:00. Mayat Agus pertama kali ditemukan oleh kekasihnya

Joy Tobing dan suami.

Lanjut ke hal A2 kol 7

nertibkan becak mesin itu sehingga tidak berkeliaran di Kota Sibolga lagi mencari penumpang. “Selama becak mesin super cup masih beroperasi mencari penumpang di wilayah Kota Sibolga, pendapatan mereka sehari-hari semakin berkurang,” pintanya. Anggota DPRD Kota Sibolga yang menerima utusan dari pengemudi Betor yakni dari Komisi II, Jansul Perdana Pasaribu (Ketua) dan anggota Megawati Hutagalung, Rajali Silalahi, Herion Marbun dan Pantas Lumbantobing didampingi wakil Ketua Imran Sebastian Simorangkir. Dalam pertemuan tersebut utusan pengemudi Betor melalui koordinatornya Sofian Aswad mengaku akhir-akhir ini Becak Mesin Super Cup dari Tapanuli Tengah beroperasi di wilayah Kota Sibolga mencari penumpang. “Masuknya becak mesin dari Tapteng ke Sibolga membuat pendapatan kami berkurang dan tidak mencukupi untuk kebutuhan keluarga sehari-hari,” ujar Aswad.

Lanjut ke hal A2 kol 3

Serampang - Bila tak dikelola, Danau Toba tinggal nama ... - He.... he....he....

Berita Utama


WASPADA Selasa 25 Januari 2011

Penerimaan Pajak Aceh Merosot Ke Peringkat 31

Gubernur: Saya Memahami Batiniah Rakyat Aceh

BANDA ACEH (Waspada): Penerimaan pajak di Kantor Wilayah Direktorat Jenderal Pajak (DJP) Aceh merosot drastis, Aceh pernah menduduki peringkat satu nasional penerimaan pajak, dan sekarang menjadi peringkat 31 nasional. Pada 2009 rencana penerimaan pajak sebesar Rp2,746 triliun, pencapaian Rp3,2 triliun, dibanding 2010 rencana Rp3,477 triliun pencapaian Rp3,124 triliun. “Intinya penerimaan pajak kita jatuh secara pertumbuhan minus, seharusnya ini tidak boleh terjadi,” ungkap Ka. Kanwil DJP Aceh, Drs Muhammad Haniv Ak, MST di ruang kerjanya, Senin (24/1). Artinya, kata Muhammad Haniv, tahun 2010 kinerja DJP Aceh minus, berarti ada kesalahan dalam pengelolaan pengawasan target dalam realisasi penerimaan pajak di Kanwil Aceh. Tentu DJP Aceh sedang mempelajari sebab menurunnya pajak tahun ke-

marin, kelihatannya pengawasan terhadap bendaharawan masih lemah karena untuk saat ini persoalan bendaharawan merupakan persoalan klasik di daerah. Menurut Haniv, alasan menurunnya penerimaan pajak kemungkinan ada persoalan yang sifatnya sistemik menyebabkan tertundanya pembayaran pajak masuk ke kas daerah. Ada beberapa masalah, salah satunya ada bank yang ternyata menugaskan satu orang saja untuk merekam Surat Setoran Pajak (SSP), padahal dalam satu hari bisa ribuan SSP yang masuk. Karena bank bukan sebuah tugas pokok dan sifatnya hanya membantu Direktorat Jenderal Pajak, maka bank menugaskan satu orang saja, sehingga hanya mampu merekam 30-50 SSP per hari. Akhirnya uang tertanam di bank dan tidak ditransfer ke rekening kas negara. Sebab itu menurunnya penerimaan pajak pada 2010. “Pada tahun 2011 ini kami akan membenahi sistem ini jika ini dibiarkan, maka akan terus terusan begini,” kata Ka. Kanwil DJP Aceh.

BANDA ACEH (Waspada): Gubernur Aceh Irwandi Yusuf minta semua pihak untuk tidak khawatir akan kelanjutan Pro g ra m J K A . Gu b e r n u r mengaku sangat memahami suasana batiniah rakyat Aceh yang sangat terbantu dengan Program JKA, dan karenannya menjadi keniscayaan bagi eksekutif dan legislatif Aceh melanjutkan program populis tersebut. “Program JKA harus tetap dilanjutkan dengan pelayanan yang terus ditingkatkan, tanpa ada atau tidak ada lagi saya,”

tegas Irwandi di hadapan Kepala SKPA dalam rapat pimpinan dalam rangka membahas serapan APBA 2010 dan percepatan realisasi APBA 2011, di Sekretariat Pengendalian dan Percepatan Kegiatan (P2K) APBA, Senin (24/1). Penegasan tersebut disampaikan Irwandi untuk menghilangkan kegalauan sebagian rakyat Aceh yang telah merasakan manfaat dari program pro rakyat ini. Pada kesempatan yang sama Sekda Aceh, T. Setia Budi juga menegaskan bahwa tidak benar ada keku-

rangan dana untuk JKA. “Dana yang diprogram dalam RAPBA 2011 adalah hanya usulan awal dan akan kita sesuaikan dengan kebutuhan riil dalam pembahasan dengan pihak DPRA,” tegas Setia Budi. Pada kesempatan tersebut Irwandi juga menyampaikan bahwa pelayanan kesehatan yang layak untuk rakyat melalui program JKA adalah hak mutlak rakyat Aceh sebagai pemilik negeri ini. “Jadi program ini bukan untuk mencari popularitas,” tegasnya. (b07)

Ribuan Warga ....

17 Anggota ....

Akbar mengatakan bahwa 35 pegawai di Direktorat Jenderal Imigrasi telah dinonaktifkan terkait kasus pembuatan paspor mafia pajak Gayus HP Tambunan atas nama Sony Laksono. “Dari kasus Gayus ini dari kementerian hukum dan HAM sudah melakukan penindakan terhadap 35 orang pegawai keimigrasian, baik di kantor imigrasi Jakarta Timur dan Bandara Soekarno Hatta,” katanya, usai menghadiri rapat koordinasi bidang hukum yang dipimpin Wakil Presiden (Wapres) Boediono di Jakarta, Senin (24/1). Patrialis mengatakan, penonaktifan 35 pegawai Direktorat Jenderal Imigrasi tersebut merupakan bukti keseriusan pemerintah dalam memberantas kasus mafia hukum dan pajak yang terjadi saat ini. (vivanews/ant)

tas. Pengoperasian selama ini telah merugikan masyarakat, karenanya, Amakar menuntut ditutupnya perusahaan pertambangan yang telah terbukti merugikan daerah dan masyarakat Di bawah pengawalan aparat kopolisian Polres Aceh Selatan, aksi tersebut semula berlangsung tertib dan aman. Namun karena kecewa gagal menemui Bupati Aceh Selatan Husin Yusuf, aksi mereka berubah anarkis dengan melempar botol bekas minuman mineral ke arah kantor bupati Tetapi aksi demo kembali

terkendali setelah mereka ditemui Sekdakab Drs.H.Harmaini dan Asisten Administrasi dan Keuangan Drs.H. Syamsulijar, guna menerima pernyataan sikap mereka. Kepada pendemo, mereka berjanji akan menyampaikan aspirasi tersebut kepada bupati agar ditindaklanjuti sesuai ketentuan yang berlaku. Setelah menyerahkan pernyataan sikap, massa akhirnya mundur dari kantor bupati dan dengan berjalan kaki dikawal aparat kepolisian. Mereka bergerak ke kantor DPRK guna melakukan aksi serupa. (b19)

9 Tersangka ....

tidak bisa jelaskan,” tandasnya Asisten Pidana Umum (Aspidum) Kejatisu Warsa Susanta mengatakan, proses penyerahan tersangka dan barang bukti ini dilakukan setelah berkasnya dinyatakan lengkap. “Penyidik kasus ini Densus 88 Mabes Polri,” bebernya. Menurut Warsa, setelah pelimpahan ini, langkah selanjutnya penyerahan berkas dakwaan ke pengadilan untuk disidangkan. “Proses persidangannya nanti dalam pengawasan bersama Kejagung, Kejatisu dan Kejari Medan,” jelasnya. Persidangan belum ditentukan Kasi Penerangan Hukum/ Humas Kejatisu Edi Irsan Kurniawan menambahkan, selain penyerahan tersangka dan berkas acara pemeriksaan, turut disertakan sejumlah barang bukti. Tim penyidik Densus membawa 11 paket barang bukti yang diperoleh selama proses penyidikan. “JPU yang menangani kasus ini nanti terdiri dari lima orang setiap satu tersangka. Terdiri dari dua dari jaksa

Kejagung, dua dari Kejari dan satu Kejatisu,” tambah Warsa lagi. Dari sembilan tersangka itu, empat orang di antaranya ikut terlibat dalam kasus perampokan Bank CIMB Niaga Jalan Aksara Medan pada pertengahan Agustus 2010. Selebihnya ikut terlibat dalam penyerangan Mapolsek Hamparan Perak dan aksi terorisme lainnya di sejumlah daerah. Sementara itu, Direktur Reskrim Polda Kombes Pol Agus Adriyanto mengatakan, para tersangka hanya sementara di tahanan Kejati Sumut. Selanjutnya akan dipindahkan ke tahanan Polda Sumut sebagai tahanan titipan. “Rencananya para tersangka akan dititipkan di tahanan Polda Sumut. Tetapi saya tidak tahu pasti apakah semuanya atau sebagian saja. Sekarang Direskrim Polda Sumut sedang menunggu berita acara penyerahannya,” jelas Agus. Agus juga menegaskan, para tersangka tidak dititipkan di rutan Tanjung Gusta Medan atas pertimbangan keamanan. (m49/m32/m39)

Dita Ningsih, mahasiswi fakultas kedokteran. Sekira pukul 08:00. Dita datang menemui korban untuk sesuatu keperluan. Karena pintu terkunci dari dalam, dia mengetuknya berkali-kali, namun tak ada jawaban. Dita yang membawa kunci serap kamar kos kekasihnya itu langsung membuka pintu. Begitu masuk, dia terperanjat melihat Agus terbujur kaku di atas ranjangnya dalam posisi telungkup dan bersimbah darah. Mahasiswi kedokteran itu langsung menjerit histeris sembari keluar dari dalam kamar kos. Sejumlah warga dan tetangga korban mendengar jeritan itu berdatangan. Selanjutnya warga dan sejumlah anak kos melihat mahasiswa asal Kisaran itu telah tewas di tempat tidurnya dengan kondisi tubuhnya bermandikan darah. Petugas identifikasi Polresta Medan dan Polsekta Medan Kota yang turun ke lokasi menemukan ada empat luka tusukan di tubuh korban yakni dua di bagian dada dan dua lagi di bagian belakang. Selanjutnya mayat putra H Anas Fauzi Lubis, mantan calon Wakil Bupati Asahan pada Pilkada 2010 itu dievakuasi ke RSU Dr Pirngadi Medan guna

Mahasiswa Asal ....

keperluan visum dan otopsi. Kakek korban, Aldi yang bertugas di Poldasu, saat ditemui di Instalasi Jenazah RSUD dr Pirngadi Medan mencurigai kematian korban dibunuh oleh kedua pria yang merupakan temannya. “Kedua kawannya sering nginap di rumah sewa si Awi di kawasan Jalan Air Bersih,SM Raja,” sebutnya. Sebelumnya sang kakek mengingatkan agar korban tidak berteman denga kedua temannya, karena memiliki gelagat yang mencurigakan. Namun karena korban merasa kasihan karena kedua pria itu tidak memiliki pekerjaan hingga korban mengindahkan pesan sang kakek. “Dari awal ku lihat orang itu mencurigakan, buktinya saat cucuku meninggal, keduanya menghilang. Bahkan saat ditemui meninggal pintu rumahnya tidak rusak sama sekali,”sebut Aldi. Sementara Kapolsekta Medan Kota Kompol Sandy Sinurat menyatakan, polisi masih melakukan penyelidikan di lokasi kejadian untuk mengungkap pelakunya. “Mengenai motif kasus ini, polisi belum bisa menyimpulkan, masih melakukan penyelidikan dengan memeriksa saksi-saksi,” katanya. (h04/h02/m39)

ingin Daniel tidak perlu ditahan. Apalagi sebelumnya tidak pernah ada pemanggilan, panggil dulu sebagai saksi. Rata-rata penyidikan selama dua minggu. Tapi ini kok langsung dijemput polisi. Tentu kami akan meminta penangguhan penahan dengan jaminan istri dan tentu tidak akan menghilangkan barang bukti,” tegasnya. Daniel Sinambela resmi menjadi tahanan Polda Metro Jaya sejak Rabu 19 Januari 2011. Daniel telah ditetapkan sebagai tersangka kasus penipuan karena diduga membawa lari uang Rp20 miliar. Mengaku Diancam Dan Diperas Daniel Sinambela, ditetapkan sebagai tersangka kasus penipuan terhadap rekan bisnis. Daniel berkilah, dirinya justru menjadi korban pemerasan. “Tuduhan-tuduhan yang

dituduhkan kepada Daniel Sinambela tidak benar. Ini adalah perbuatan tidak terpuji dan fitnah. Ini adalah bentuk pemerasan terhadap Daniel Sinambela menjadi korban. Daniel telah diancam dan pemerasan oleh laporan Yulianis dan M. Nazarudin, yang diduga terlibat tindak pidana rekayasa,” papar kuasa hukum Daniel, Kamaruddin Simanjuntak, SH. Lantaran merasa tidak bersalah seperti yang dituduhkan pelapor, Daniel mengajukan laporan balik ke Polda. “Kita juga telah melakukan laporan ke Polda Metro Jaya,” imbuh Kamaruddin, dalam jumpa pers di City Walk, Jakarta, Minggu (23/1) malam. Daniel melaporkan balik Yulianis dan M Nazarudin dengan pasal 317, tentang laporan palsu serta Pasal pengancaman. (okz)

terbukti terlibat itu akan diproses sesuai aturan yang berlaku. 35 Pegawai Imigrasi Menteri Hukum dan Hak Asasi Manusia (HAM) Patrialis

Islam Tidak ....

kedamaian antarmanusia, tidak boleh ada penganiayaan, meremehkan, mengucilkan diantar sesama manusia, apalagi menghina ajaran agama lain. “Jadi jika ada orang yang menghina ajaran Islam, maka aparat penegak hukum harus menangkap dan memprosesnya secara hukum penista agama tersebut,” katanya. Ketua PW Muhammadiyah Sumut Prof. DR Asmuni menuturkan, upaya untuk memojokkan umat Islam sudah ada sejak dulu. Ini merupakan salah satu cara untuk menghancurkan umat Islam. (h02/m24/m26/m37)

Hasil Pemilukada ....

bukan merubah UUPA namun membatalkan salah satu pasal dalam UU PA, meski kata dia ada klausul dalam UU PA, setiap perubahan UU yang dilakukan di Aceh harus dikonsultasikan dengan DPRA. “Ini kan bukan merubah, tapi membatalkan, jadi keputusan itu harus dilaksanakan,” kata Mawardi. Sebelumnya penolakan putusan MK datang dari Partai Aceh, serta anggota DPRA dari partai lokal tersebut. “MK mengabaikan kekhususan Aceh, Aceh telah diberi kewenanganan mendirikan partai lokal dan tidak ada di daerah lain,” kata Abdullah Saleh, anggota DPRA dari Partai Aceh. Senada dengan Abdulah saleh, sejawatnya di Partai Aceh, Adnan Bueransah juga bersikukuh menolak putusan MK tentang pasal 256 UU Pemerintah Aceh no. 11 tahun 2006. (b32)

Jawaban Problem Catur: 1. ......, c4+. 2. Rc3, KxKe2+. 3. Rb4, Gd2+. 4. Rc5, Kfe4+mat

Jawaban TTS: TTS Topik

Politik & Hukum (Ulang)





Jawaban Sudoku: 5 6 2 1 7 3 4 8 9

8 1 7 9 6 4 3 5 2

4 9 3 5 8 2 6 1 7

3 7 9 8 2 5 1 4 6

6 4 5 7 3 1 2 9 8

2 8 1 6 4 9 5 7 3

7 2 4 3 1 8 9 6 5

1 5 6 2 9 7 8 3 4

sebanyak lima kali. “Di pasar kan banyak orang. Mungkin tembakan itu sengaja dilepaskan perampok supaya warga tidak berani mengejar mareka,” tambahnya. Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Erlintang Jaya, yang dikonfirmasi via telefon sekitar pukul 18:00 kemarin, membenarkan adanya kasus tersebut. “Masih kita selidiki. Kami masih di TKP (Tempat Kejadian Perkara) dan tim khusus dipimpin langsung Kapolres, sedang memburu pelaku,” kata AKP Erlin. Keterangan lain menyebutkan, toko emas tersebut milik Zulkarnaini, 40, warga Lhoksukon. Korban belum bisa dimintai keterangan karena trauma berat dengan kejadian itu. Sedangkan anggota polisi yang berada di dalam toko saat kejadian, berinisial Vic. Ia dikabarkan bertugas di Samsat Lhoksukon. Saat kejadian Vic tidak membawa senjata api. (cmus)

Foto Sawah UFO ....

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.


Komplotan ....

9 3 8 4 5 6 7 2 1

pengunjung yang penasaran ingin melihat crop circle atau lingkaran simetris. “Foto ini saya jual Rp5.000 untuk dua foto,” kata dia, Senin (24/1). Satu foto bergambar sawah terlihat dari atas Gunung Suru. Satu lagi, sambungnya, gambar sawah dari dekat sehingga batang padi yang rubuh terlihat. Menurut dia, pengambilan dan penjualan foto itu dilakukan secara berkelompok. Dana yang terkumpul akan diserahkan kepada pemilik sawah. “Untuk membantu.” Seorang pembeli, Riyan, mengaku membeli foto karya kelompok pemuda Jogotirto itu karena batal naik ke atas gunung dan melihat lambang yang menimbulkan kehebohan itu. “Terlalu mengantri,” kata dia. (vivanews)

Kemenangan ....

Hidup bahagia memang idaman semua orang. Jika ingin bahagia tentu harus berusaha untuk mencapainya. Sekurang-kurangnya anda harus mencari empat perkara yang disebutkan dalam hadits riwayat Ibnu Hibban seperti yang kami kutip di atas. Isteri yang shalehah menduduki urutan pertama dalam kebahagiaan seseorang. Kriterianya antara lain adalah si istri harus tunduk dan patuh kepada suami sepanjang suami itu berada dalam kebenaran. Tugas isteri melayani suami, menyediakan makanan, men-

Masalah ke dua, kata Haniv, masih adanya bendaharawan nakal, juga pengusahapengusaha kelapa sawit yang setoran pajaknya menurun padahal harga sawit sekarang ini tertinggi. Jadi tidak wajar setoran pajaknya menurun, dalam hal ini DJP akan melakukan pemeriksaan dan penyidikan terhadap pengusaha sawit. Selain itu pembayaran PBB dari perkebunan juga belum begitu baik, padahal harga sawit tinggi dan uang yang beredar di pengusaha sawit juga besar seharusanya PBB tidak ada masalah. Namun kenyataannya juga bermasalah. Itu terjadi karena kedisiplinan membayar pajak pengusaha sawit juga berku-rang. Berikutnya pembayaran pajak pribadi sangat memprihatinkan, terutama pada orang kaya di Aceh, seperti kontraktor, pengusaha sawit atau distributor yang setelah diteliti, pembayaran pajaknya sangat memprihatinkan. Bahkan ada yang tidak melaporkan pajak SPT padahal mempunyai NPWP. “Desember kemarin saya melihat setoran pajak SPT banyak yang nihil, inikan tidak benar dan tidak wajar. SPT orang kaya di Aceh saja ditargetkan bisa mencapai Rp21 miliar kalau dihitung, kenyataannya sekarang baru terkumpul Rp600 juta,” paparnya. Untuk menaikkan kembali penerimaan pajak di Aceh pada 2011, terlebih dahulu Kanwil DJP Aceh akan membenahi sistem kinerja internal. (gto)

Ratusan ....


ARUNG BANJIR: Seorang ibu bersama dua anaknya mengarungi banjir di Desa Hagu, Kec. Matangkuli, Kab. Aceh Utara, Senin (24/1) petang.

Matangkuli Kembali Dilanda Banjir MATANGKULI, Aceh Utara (Waspada): Banjir kiriman dari kawasan hulu sungai kembali merendam sejumlah desa di Kec. Matangkuli, Kabupaten Aceh Utara, Senin (24/1). Ketinggian air mencapai setengah meter. Sebagian warga yang rumahnya dekat bantaran sungai juga terpaksa mengungsi ke rumah kerabat atau tetangga yang masih aman dari banjir. Pantauan Waspada, desa-desa yang terendam banjir antara lain, Desa Tumpok Barat, Lawang, Meuria dan Alue Thoe. Selain merendam puluhan rumah, genangan banjir juga merendam sejumlah titik jalan desa, hingga arus lalulintas dari kedua arah terganggu. Namun belum ada desa yang dilaporkan terisolir total karena ketinggian air di atas badan jalan rata-rata hanya sekitar 30 centimeter. “Banjir terjadi karena Krueng (sungai) Peutoe dan Krueng Keuretoe meluap, sejak pukul 11:30 WIB. Kami terpaksa mengungsi ke rumah saudara yang letaknya agak lebih tinggi. Biasanya banjir kiriman seperti ini cepat surut,” kata Fakhruddin Abu Bakar, 27, warga Desa Hagu, kemarin petang. (cmus) ehat Harahap mewakili Kadishub mengungkapkan, pihaknya sepakat untuk melakukan pencegahan agar becak bermotor Super Cup dari Tapteng tidak beroperasi di Kota Sibolga. Kabid Perhubungan E. Dalimunthe menyampaikan, mereka sangat kesulitan untuk melakukan sosialisasi kepada seluruh pengemudi Betor di Kota Sibolga, sebab tidak tahu

kepada siapa undangan yang harus diberikan jika ada rapat dan sosialisasi. Andre Malau, anggota Komisi II DPRD Sibolga mengimbau Polresta Sibolga agar mengusut kutipan-kutipan terhadap pemilik/pengemudi betor yang berlangsung selama ini sesuai dengan pengakuan pengemudi betor yang datang menyampaikan aspirasinya di kantor DPRD.. (a18)

Parapat, wisatawan harus menempuh jarak 3,5 jam. Ini dengan perhitungan wajar tanpa ada hambatan di tengah jalan. Ditambah lagi kondisi jalan yang belum sepenuhnya mulus. Jalur dari Medan melalui Tebingtinggi, Pematangsiantar tergolong jalur yang mulus. Tetapi itu masih jauh dari ideal karena tempat wisata semestinya harus sudah dilalui jalur bebas hambatan (tol) untuk mencapainya. Lain lagi jalur jalan melalui Kabupaten Tanahkaro—Dairi, lubang jalan menganga di mana-mana. Kondisi jalan yang rusak ini mencapai jarak puluhan kilometer. Ironisnya, kondisi seperti ini sepertinya telah terjadi sejak lama. Ada beberapa ruas jalan yang mulus—tampaknya baru diperbaiki. Tapi lebih banyak jalur jalan yang rusak bahkan kupak kapik. Belum lagi jalur jalan yang melingkari Danau Toba, masih tidak sepenuhnya bagus. Ini adalah pesoalan klasik sejak dulu, tapi tak pernah bisa diselesaikan. Sepertinya masalah utama ini diakui pemerintah daerah di wilayah Danau Toba, tetapi sepertinya mereka juga tidak bisa berbuat banyak. ‘’Masalah utama kita memang infrastruktur jalan,’’ kata R.Pardede Kepala Dinas Pariwisata Kabupaten Toba Samosir (Tobasa). Menurut Pardede, kalau jalan negara merupakan domainnya pemerintah Provinsi Sumatera Utara. Pihaknya hanya bisa mengusulkan untuk perbaikan jalan yang rusak atau hal-hal yang menyangkut perawatan kondisi jalan. “Jalur darat itu adalah salah satu pintu masuk di samping jalur udara melalui Bandara Silangit,’’ kata Pardede. Namun untuk masalah jalan dalam tanggung jawab pemerintah kabupaten juga tidak sepenuhnya bisa diatasi. Badan

jalan yang kecil, rusak dan dalam kondisi tak terawat juga banyak terjadi. Pardede tidak menampik kondisi tersebut. Budaya masyarakat setempat masih belum mendukung proses pelebaran jalan yang sempit. Dengan kata lain budaya masih merupakan hambatan bagi pembangunan pariwisata di kawasan Danau Toba. ‘’Masalah infrastruktur juga masalah budaya menjadi tantangan juga peluang bagi pengembangan industri pariwisata,’’ kata Pardede. Sepertinya potensi besar Danau Toba belum menjadikan Kab.Tobasa menaruh perhatian serius bagi pengembangan pariwisatanya. Bayangkan saja, jumlah PAD yang dihasilkan dari sektor ini hanya sebesar Rp48 juta di tahun 2010. Tahun 2011 target yang ditetapkan naik, namun hanya sebesar Rp52 juta. Angka ini menunjukkan secara gamblang bahwa sektor pariwisata masih menjadi “anak tiri” di wilayah ini. Bahkan untuk pembersihan enceng gondok dan tambaktambak milik rakyat di perairan Danau Toba masih belum bisa dikatakan serius untuk dikerjakan. ‘’Anggaran kecil untuk pembersihan enceng gondok,’’ timpal Lisbeth R.Siahaan Kepala Lingkungan Hidup Tobasa. Dia enggan menyebutkan jumlah anggaran tersebut. Tetapi masalah bukan itu saja. Enceng gondok dan tambak yang merupakan “musuh” bagi indistri pariwisata sulit dibersihkan karena adanya penolakkan dari warga sekitar. ‘’Rakyat tidak setuju karena di sela-sela enceng gondok itulah tempatnya ikan bertelur,’’ aku Lisbeth meski mengaku enceng gondok itu masih bisa dibudidayakan. Sama halnya dengan tambak-tambak milik warga. Di

tambak itu warga memelihara ikan. Oleh karena berkaitan langsung dengan kepentingan warga maka di situlah muncul kesulitannya. Adanya penolakkan dari warga. Meski demikian pihak Pemkab Tobasa tetap optimis. Menurut R.Pardede, pembangunan industri pariwisata di Danau Toba tidak bisa dilakukan secara parsial, dalam arti secara sepihak-sepihak oleh masing-masing kabupaten/kota. Harus ada forum bersama pemerintah kabupaten yang dilalui Danau Toba. ‘’Penanganannya harus sentralistik,’’ katanya. Secara kasat mata, pembangunan infrastruktur jalan dari dan ke kawasan Danau Toba memang tidak bisa dilakukan secara parsial oleh masing-masing kabupaten. Betapa tidak, total panjang jalan lingkar luar Danau Toba itu sejauh 248,53 km yang terdiri dari 78 km jalan nasional, 15 km jalan provinsi dan 155,53 km jalan kabupaten. Perlu dana yang tidak sedikit untuk melakukan perawatan dan pemeliharaan infrastruktur tersebut yang tidak mungkin bisa dilakukan secara sepihak oleh pemerintah kabupaten. Pardede menekankan Lake Toba Regional Management (LTRM) yang telah digagas oleh pemerintah kabupaten di tujuh daerah yang dilintasi aliran Danau Toba. Visi ke depan Visi pemerintah menyangkut akses jalan dari dan ke Danau Toba ini sepertinya cukup prospektif menyusul rencana pembangunan Jalan Rawa Saring (Tanjung Morawa-Saribudolok dan Tongging). Akses jalan ini diproyeksikan untuk menjadi penghubung dari dan ke bandara Kaualanamu. Hanya saja prosesnya masih tahap awal sekali. Masih perlu pembuktian lebih dulu atas keinginan

didik anak-anaknya supaya anak-anak juga selamat dari godaan duniawi. Tidak menolak ketika engkau berhajat kepadanya. Rumah yang luas dan indah juga akan mendatangkan kebahagiaan bagi penghuninya. Rumah itu surga bagi mereka yang beriman. Di rumahlah seseorang akan mendapat ketenangan dan kebahagiaan. Rumah adalah istana dan engkau adalah rajanya, isterimu ratu di rumah tanggamu, dan anak-anak itu rakyatmu. Allah menjadikan untuk kamu rumah-rumah kamu sebagai tempat kete-

nangan ( QS. An-Nahlu:80). Anda juga akan sangat bahagia bila menemukan tetangga yang baik, dermawan, murah hati, saling menghormati, dan memberi perhatian kepada anda sekeluarga. Tetangga yang baik tidak akan mengganggu keluarga anda. Tidak iri hati terhadap kekayaan anda. Mereka memuliakan anda dan sebaliknya anda juga akan memuliakan mereka. Bila anda mendapat nikmat mereka turut bersyukur, bila anda mendapat musibah mereka segera menolong. Kendaraan baru (mobil

mewah) juga akan mendatangkan kebahagiaan tersendiri. Tetapi yang satu ini harus hati-hati, jangan sampai mobil itu memperbudak anda. Misalnya anda selalu merawatnya, menjaga oli, minyak rem, dana perawatan, mencuci dari debu, dan sebagainya. Hitunghitung anda selalu menjaga kebersihannya, tetapi anda lupa menjaga kebersihan diri sendiri. Anda lupa mandi, gatal dan berpanu, belum lagi lupa membersihkan rohani anda dari dosa-dosa. Bila ini yang terjadi, mobil anda telah menjadi “tuan” yang memperbudak anda. ** ** **

Aswad mengakui sudah ada 20 organisasi becak yang terbentuk di Kota Sibolga, namun tidak ada yang dapat memperjuangkan nasib mereka, padahal setiap tahun mereka membayar kewajiban yang dipotong langsung saat pelunasan pembayaran pajak STNK oleh Samsat Sibolga. Sekretaris Dinas Perhubungan Kota Sibolga Maras-

Danau Toba ....

Koordinator aksi, Ali Zamzami menyatakan keberadaan dan aktivitas perusahaan pertambangan bijih besi, sudah lama menjadi polemik serta telah merugikan daerah dan masyarakat. Sebab, selain kerusakan jalan kabupaten dari Kota Fajar Kluet Utara, Menggamat, Kecamatan Kluet Tengah, juga terjadi manipulasi kandungan mineral (emas) yang diekploitasi. Masyarakat di sana sebelumnya, telah berkali-kali melakukan aksi serupa, namun penanganan dan penyelesaiannya belum kunjung tun-

Bahkan dua di antaranya menggunakan kursi roda saat mulai turun dari tangga pesawat hingga masuk ke mobil yang membawa mereka menuju Kejatisu untuk penyelesaian administratif. “Para tersangka ini hasil penyidik Densus 88 Mabes Polri dan dibawa ke Medan untuk kebutuhan proses persidangan,” kata Direskrim Polda Sumut Kombes Pol Agus Andrianto. Agus tidak menjelaskan secara detail posisi kesembilan tersangka karena penyidikan kasusnya berada di Mabes Polri. Pihaknya hanya bertugas untuk proses pengamanan pelimpahan tersangka ke jaksa. “KesembiIan tersangka ini beda dengan empat tersangka yang kita tangani. Jadi, saya pemerintah ini. Jika benar-benar selesai, pembangunan akses jalan ini nantinya akan meningkatkan akses Jalan Tanjung Morawa - Saribudolok - Tongging sepanjang kurang lebih 90 Km dengan perkiraan waktu tempuh hanya 1,5 jam. Selai bisa menjadi jalan alternatif dari kawasan pertanian dengan kawasan pariwisata, akses jalan ini juga akan diintegrasikan dengan pembangunan jalan lingkar luar Danau Toba. ‘’Kalau akses jalan dari Lubukpakam ke Saribudolok dan Tongging sudah terbuka, maka kita tinggal membangun jalur laut melalui Danau Toba ke Pulau Samosir,’’ kata Bupati Samosir Ir Mangindar Simbolon. Tanda-tanda ke arah pembangunan itu sepertinya bergayung bersambut dengan rampungnya pembangunan Taman Simalem Resort di kawasan Kabupaten Tanahkaro. Proyek wisata ratusan miliar ini tentunya tidak salah jika diasumsikan menyambut pembangunan infrastruktur jalan tersebut. Karena tentunya penguasaha akan enggan merugi ketika telah menginvestasikan dana dalam jumlah yang besar. Namun itu adalah harapan. Nyatanya saat ini semuanya masih berbentuk rencana. Karena belum ada aksi teknis untuk menuju ke arah sana. Dengan kata lain, pembangunan kawasan wisata Danau Toba masih tidak maksimal sampai saat ini. Hingga wisatawan pun masih enggan melangkahkan kaki ke sana. * Dedi Sahputra

Joy Tobing ....

Presiden dan ibu Presiden. Berikanlah keadilan,” tutur Joy mengiba, dalam jumpa pers di City Walk, Jakarta, Minggu (23/1) malam. “Kalaupun suami saya bersalah, ada prosesnya. Jangan main asal tangkap. Punya hati nurani enggak kalau itu terjadi sama keluarga mereka. Saya mohon,” kata Joy lagi. Lantaran merasa ada ketidakadilan, Joy dan keluarga Sinambela akan melakukan upaya hukum agar Daniel tidak ditahan di Polda Metro Jaya. “Akan sebisa mungkin untuk melakukan upaya hukum dengan melapor ke Mabes Polri, Presiden, dan Komnas HAM,” paparnya. Mantan jawara Indonesian Idol itu menuding, proses hukum yang dialami Daniel tidak sesuai prosedur. “Tentunya kalau dari keluarga karena istri hamil, tentu

Berita Utama

A2 Pengurus MUI ... “Kami akan memberikan pilihan kepada pengurus yang sudah masuk struktur pilihan, yakni berhenti merokok atau keluar dari kepengurusan MUI Sumbar,” katanya. Kebijakan tersebut terkait dengan yang sudah menjadi kesepakatan dan rekomendasi dari hasil musyawarah daerah MUI Sumbar pada 24-26 Desember 2010, yakni pada poin 12 berbunyi “memerintah seluruh pengurusMUIprovinsidankabupaten/kotase-Sumbarberhentimerokok, karena menjatuhkan citra MUI di mata masyarakat”. Namun, pada kenyataannya setelah lahirnya rekomendasi Musda MUI Sumbar pada Desember 2010, masih ada pengurus yang tidak mengindahkan atau tetap merokok.

SMS Terakhir ... Asmawati tak menyangka, pesan singkat itu adalah menjadi pesan terakhir dari sang cucu. Bagi sang nenek, korban merupakan anak pendiam, cukup baik, dan patuh. “Hanya Allah lah yang tahu kayak mana bagusnya dia di keluarga selama ini,” sebutnya. Sang nenek yang merasa terpukul begitu mendengar kabar kematian cucunya pada Senin pagi,berharap agar kasus pembunuhan tersebut bisa terungkap. Sementara itu dari pengakuan tantenya Kiki, 28, korban pernah menghubungi dirinya untuk menyampaikan sesuatu, Jum’at(21/1). Namun, berhubung sibuk kerja, Kiki tidak sempat menjumpai korban dan berencana menghubungi melalui nomor handphone yang sering digunakan korban. “Tapi pas mau dihubungi, Sabtu (22/1) sore, hp dia gak aktif lagi hingga dia (korban) ditemukan tidak bernyawa,” ungkap Kiki. Dari pantauan di Instalasi Jenazah,tangis haru kedua orang tua korban tak terbendung begitu melihata jenazah sang anak. Ayahnya bahkan nyaris pingsan, saat melihat anak pria satu-satunya itu tewas dengan kondisi mengenaskan. Ayahnya, Anas Fauzi, mengaku sempat melarang anaknya untuk mengontrak rumah. Namun, karena keinginan kuat sang anak untuk mandiri, sang ayahnya mengabulkan permintaan anaknya dengan syarat harus memiliki nilai yang bagus. “Dia sudah dilarang untuk menyewa rumah, dan disarankan untuk tetap tinggal bersama uwaknya. Tapi karena nilainya bagus di semester dua, dia kami carikan rumah sewa,” ungkap Anas. Muhammad Agus Widia Lubis yang akrab disapa Awid

Mahasiswa Asal ... Mahasiswi kedokteran itu menjerit histeris sembari keluar dari dalam kamar kos. Sejumlah warga dan tetangga korban yang mendengar jeritan itu berdatangan. Selanjutnya warga dan sejumlah anak kos melihat mahasiswa asal Kisaran itu tewas di tempat tidurnya dengan kondisi mengenaskan. Petugas identifikasi Polresta Medan dan Polsekta Medan Kota yang turun ke lokasi menemukan ada empat luka tusukan di tubuh korban yakni dua di bagian dada dan dua lagi di bagian belakang. Sedangkan sepeda motor dan laptop korban juga tidak ada ditempat. Selanjutnya mayat putra H Anas Fauzi Lubis, mantan calon

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, c4+. 2. Rc3, KxKe2+. 3. Rb4, Gd2+. 4. Rc5, Kfe4+mat

Jawaban TTS: TTS Topik

Politik & Hukum (Ulang)





Jawaban Sudoku: 5 6 2 1 7 3 4 8 9

8 1 7 9 6 4 3 5 2

4 9 3 5 8 2 6 1 7

3 7 9 8 2 5 1 4 6

6 4 5 7 3 1 2 9 8

2 8 1 6 4 9 5 7 3

7 2 4 3 1 8 9 6 5

1 5 6 2 9 7 8 3 4

9 3 8 4 5 6 7 2 1

Menurut dia, kondisi ini tak bisa dibiarkan karena dampaknya terhadap fatwa-fatwa yang dikeluarkan MUI, artinya sama dengan “tongkat yang membawa rubuh”. Padahal, tambahnya, saat pemelihan formatur Ketua MUI Sumbar dalam Musda ke-VIII telah diberlakukan bagi yang merokok tidak bisa masuk mencalonkan. Hal itu, sudah diberlakukan dan ada salah seorang calon formatur dengan secara hormat mengundurkan diri dari pencalonannnya, karena memilih untuk mengerokok. Akan tetapi setelah disusun struktur kepengurusan ternyata masih ada 4 orang pengurus inti MUI yang tetap merokok, tentu kondisi ini akan memalukan/ melemahkan keputusan-keputusan yang dilahirkan organisasi keagamaan itu.

KTP Elektronik Mulai Februari 2011 JAKARTA (Waspada): Kartu tanda penduduk (KTP) berbasis nomor induk kependudukan (NIK) atau KTP elektronik (E-KTP) diterapkan secara menyeluruh mulai bulan Februari 2011. Mendagri Gamawan Fauzi memastikan warga negara Indonesia, tak akan mengeluarkan biaya sepeser pun untuk mengurus dan mendapatkan E-KTP ini. “KTP ini gratis. Penduduk tak dipungut biaya sepeser pun,” katanya di Gedung KPK, Jakarta, Senin (24/1). Untuk memastikan kebijakan ini berjalan, Gamawan mengaku sudah melayangkan

surat edaran pemberitahuan kepada seluruh kepala daerah yang ada di Indonesia. Mendagri juga mempersilakan warga masyarakat yang dan atau mengetahui adanya praktik pemungutan biaya dalam pengurusan dan kepemilikan E-KTP ini nantinya, untuk melaporkannya ke Kemendagri. Gamawan berharap, pelaporan itu harus berdasarkan bukti dan tidak asal memfitnah atau isu. “Kalau media menemukan permainan, silakan bongkar. Kalau di daerah memungut biaya silakan (dilaporkan),” katanya.

Untuk diketahui, sebelum menerapkan KTP elektronik ini, Kemendagri sudah pernah melakukan uji coba penerapannya di enam daerah di Indonesia, yakni Cirebon, Padang, Jembrana, Makassar, dan Yogyakarta. KTP elektronik ini nantinya bisa digunakan untuk bermacam keperluan, mulai dari pengurusan akta tanah hingga pelayanan kesehatan. Kartu indentitas ini juga ditanami chip dan dibubuhi sidik jari. EKTP juga diharapkan dapat mengatasi masalah identitas ganda seperti yang kerap muncul saat pemilihan umum. (m11/kps)

tewas akibat korban perampokan. “Awid yang bertubuh tegap dan tinggi kelahiran 15 Agustus 1991 merupakan teman yang supel semasa sekolah di SMA Negeri 3 Kisaran,” ujar teman sekelas korban Dyan Riski, 21, yang terakhir ketemu masa liburan kuliah tahun lalu. Dia dikenal juga mempunyai kelebihan supranatural dapat membantu mencari sesuatu yang hilang. “Semasa sekolah pernah seorang teman kehilangan dompet, dia berhasil menemukan dompet tersebut melalui indera keenamnya dan tak mau menjelaskan pelaku yang mencuri atau mengambilnya,” ujar Dyan Riski di rumah duka di JalanWilliem Iskandar Kisaran. Almarhum merupakan anak angkat dari Bupati Asahan Taufan Gama Simatupang yang pernah sama-sama melaksanakan umrah di Tanah Suci pada 2007. Awid di mata adiknya Ade Tria Fauwijaya Lubis merupakan sosok pendiam dan di rumah yang punya hobi kesenian dan sepakbola. Tak ada firasat yang merupakan tanda-tanda almarhum akan menghadap sang Khalik. Terakhir bertemu pada tahun baru. Almarhum merupakan mahasiswa semester tiga di Institut Teknologi Medan (ITM). Kelebihan Awid pernah menolong menemukan orang yang hilang, pada keluarga korban yang kehilangan. Awid menyatakan orang tersebut masih hidup dan kalau ditemukan paling hilang ingatan. Ternyata memang ditemukan kembali oleh keluarga orang yang dinyatakan hilang itu. Mendiang sering membantu orang yang kehilangan HP dan sebagainya. Almarhum merupakan keponakan dari Erwis Edi Pauja Lubis, Kadis Tenaga Kerja Asahan dan keponakan dari Ketua Pemuda Panca Marga Asahan Aris Fadillah Lubis. (h02/a36)

Unimed Tutup ...

buka penerimaan mahasiswa baru jalur seleksi mandiri PTN. Harus dibatasi Sementara itu, Sekretaris Forum Indonesia Untuk Transparansi Anggaran (Fitra) Elfenda, secara terpisah, kemarin, mengatakan, seharusya PTN membatasi jalur mandiri. Jika pun ada sebaiknya dibatasi atau tidak lebih dari 5 persen saja. Selain itu perlu transparan dalam hal penarikan dana pendaftaran dan pemberitahuan kepada masyarakat tentang penggunaan anggaran itu, agar masyarakat bisa memahami mengapamasihadajalurmandiri. Menurut Elfenda, usulan itu menyikapi prinsip keadilan bagi calon mahasiswa dari ekonomi lemah tetapi ingin kuliah di PTN. Karena penerimaan jalur mandiri tetap memerlukan dana pendaftaran yang secara otomatis bisa menghempang orang yang tidak berduit untuk ikut seleksi. Karenanya, dengan pengeluaran dana yang tidak

sedikit dan jumlah pesertanya dipastikan cukup banyak, diharapkan pihak kampus transparan dalam pengelolaan dana tersebut nantinya kepada masyarakat. Sekretaris Pimpinan Wilayah Ikatan Putera Puteri Al Washliyah Kurnia Salam setuju dengan pembatasan kuota jalur mandiri. Namun sebaiknya jalur mandiri ditiadakan saja, karena cara ini menimbulkan sistem penarikan uang baru bagi masyarakat yang tetap ingin kuliah di PTN. Sehingga calon mahasiswa yang tidak punya uang tidak bisa ikut testing lagi. Sementara orang yang kaya dan berduit, bisa ikut testing berkalikali sehingga lulus. Orang miskin yang ingin kuliah harus masuk PTS dengan biaya lumayan mahal. Di samping itu, dengan penghentian jalur mandiri ini, lebih memberi peluang pada PTS mendapatkan mahasiswa yang kaya dan berprestasi. (m41/m37)

Kisaran Timur, polisi langsung membekuk AHH berikut empat lembar upal pecahan Rp.100.000 dari rumahnya pukul 14:00. Kedua tersangka digelandang ke Mapolsek Airbatu guna penyidikan lebih lanjut, berikut 17 lembar upal dan tiga HP. Kapolres Asahan AKBP J.Didiek Priantono SH melalui Kapolsek Airbatu AKP Syahrul SH didampingi Kanit Reskrim IPTU A.Siringoringo SH mengatakan kepada Waspada kedua tersangka dalam pemeriksaan intensif guna pengembangan kemungkinan jaringan besar

pembuatan upal dimaksud. Pemeriksaan sementara AHH mengaku membeli upal dari seseorang yakni teman F dengan harga Rp.300.000 per Rp.1.000.000. Sedangkan F mengaku belum berhasil menggunakan upal, sudah ditangkap polisi. Perjanjian di antara mereka bagi hasil dari penggunaan upal. F mengaku akan membelanjakan upal dengan cara membeli sebungkus rokok di tiap kedai untuk tiap lembar Upal pecahan Rp.100.000. (a10/a11)

bisa diatasi. Badan jalan yang kecil, rusak dan dalam kondisi tak terawat juga banyak terjadi. Pardede tidak menampik kondisi tersebut. Budaya masyarakat setempat masih belum mendukung proses pelebaran jalan yang sempit. Dengan kata lain budaya masih merupakan hambatan bagi pembangunan pariwisata di kawasan Danau Toba. ‘’Masalah infrastruktur juga masalah budaya menjadi tantangan juga peluang bagi pengembangan industri pariwisata,’’ kata Pardede. Sepertinya potensi besar Danau Toba belum menjadikan Kab.Tobasa menaruh perhatian serius bagi pengembangan pariwisatanya. Bayangkan saja, jumlah PAD yang dihasilkan dari sektor ini hanya sebesar Rp48 juta di tahun 2010. Tahun 2011 target yang ditetapkan naik, namun hanya sebesar Rp52 juta. Angka ini menunjukkan secara gamblang bahwa sektor pariwisata masih menjadi “anak tiri” di wilayah ini. Bahkan untuk pembersihan enceng gondok dan tambak-tambak milik rakyat di perairan Danau Toba masih belum bisa dikatakan serius untuk dikerjakan. ‘’Anggaran kecil untuk pembersihan enceng gondok,’’ timpal Lisbeth R.Siahaan Kepala Lingkungan Hidup Tobasa. Dia enggan menyebutkan jumlah anggaran tersebut. Tetapi masalah bukan itu saja. Enceng gondok dan tambak yang merupakan “musuh” bagi indistri pariwisata sulit dibersihkan karena adanya penolakkan dari warga sekitar. ‘’Rakyat tidak setuju karena di sela-sela enceng gondok itulah tempatnya ikan bertelur,’’ aku Lisbeth meski mengaku enceng gondok itu masih bisa dibudidayakan. Sama halnya dengan tambak-tambak milik warga. Di tambak itu warga memelihara ikan. Oleh karena berkaitan langsung dengan kepentingan warga maka di situlah muncul kesulitannya. Adanya penolakkan dari warga. Meski demikian pihak PemkabTobasa tetap optimis. Menurut R.Pardede, pembangunan industri pariwisata di Danau Toba tidak bisa dilakukan secara parsial, dalam arti secara sepihak-sepihak oleh masingmasing kabupaten/kota. Harus ada forum bersama pemerintah kabupaten yang dilalui Danau Toba. ‘’Penanganannya harus sentralistik,’’ katanya. Secara kasat mata, pembangunan infrastruktur jalan dari dan ke kawasan Danau Toba memang tidak bisa dilakukan secara parsial oleh masingmasing kabupaten. Betapa ti-

dak, total panjang jalan lingkar luar Danau Toba itu sejauh 248,53 km yang terdiri dari 78 km jalan nasional, 15 km jalan provinsi dan 155,53 km jalan kabupaten. Perlu dana yang tidak sedikit untuk melakukan perawatan dan pemeliharaan infrastruktur tersebut yang tidak mungkin bisa dilakukan secara sepihak oleh pemerintah kabupaten. Pardede menekankan Lake Toba Regional Management (LTRM) yang telah digagas oleh pemerintah kabupaten di tujuh daerah yang dilintasi aliran Danau Toba. Visi ke depan Visi pemerintah menyangkut akses jalan dari dan ke Danau Toba ini sepertinya cukup prospektif menyusul rencana pembangunan Jalan Rawa Saring (Tanjung Morawa-Saribudolok dan Tongging). Akses jalan ini diproyeksikan untuk menjadi penghubung dari dan ke bandara Kaualanamu. Hanya saja prosesnya masih tahap awal sekali. Masih perlu pembuktian lebih dulu atas keinginan pemerintah ini. Jika benar-benar selesai, pembangunan akses jalan ini nantinya akan meningkatkan akses Jalan Tanjung Morawa Saribudolok - Tongging sepanjang kurang lebih 90 Km dengan perkiraan waktu tempuh hanya 1,5 jam. Selai bisa menjadi jalan alternatif dari kawasan pertanian dengan kawasan pariwisata, akses jalan ini juga akan diintegrasikan dengan pembangunan jalan lingkar luar Danau Toba. ‘’Kalau akses jalan dari Lubukpakam ke Saribudolok dan Tongging sudah terbuka, maka kita tinggal membangun jalur laut melalui Danau Toba ke Pulau Samosir,’’ kata Bupati Samosir Ir Mangindar Simbolon. Tanda-tanda ke arah pembangunan itu sepertinya bergayung bersambut dengan rampungnya pembangunan Taman Simalem Resort di kawasan Kabupaten Tanahkaro. Proyek wisata ratusan miliar ini tentunya tidak salah jika diasumsikan menyambut pembangunan infrastruktur jalan tersebut. Karena tentunya penguasaha akan enggan merugi ketika telah menginvestasikan dana dalam jumlah yang besar. Namun itu adalah harapan. Nyatanya saat ini semuanya masih berbentuk rencana. Karena belum ada aksi teknis untuk menuju ke arah sana. Dengan kata lain, pembangunan kawasan wisata Danau Toba masih tidak maksimal sampai saat ini. Hingga wisatawan pun masih enggan melangkahkan kaki ke sana. Dedi Sahputra

Wakil Bupati Asahan pada Pilkada 2010 itu dievakuasi ke RSU Dr Pirngadi Medan guna keperluan visum dan otopsi. Dua tetangga kos korban masing-masing Syahrul dan Zakaria yang ditanyai Waspada di lokasi kejadian mengaku tak tahu menahu tewasnya Agus. “Tadi malam, kami tidak ada mendengar suara gaduh atau ribut-ribut dari dalam kamar korban. Pagi ini kami baru tahu korban tewas dibunuh,” ujar Syahrul yang sempat dibawa ke kantor Polsekta Medan Kota untuk dimintai keerangan. Menurut Syahrul, malam sebelum kejadian, dirinya tidur agak larut karena menonton pertandingan sepakbola di televisi dan tidak mendengar suara yang mencurigakan. “Padahal, saya tidur menjelang dinihari dan tidak ada mendengar suara gaduh dari kamar sebelah,” jelasnya yang kamar kosnya bersebelahan dinding kamar korban. Sedangkan kakek korban, Aldi yang bertugas di Poldasu, saat ditemui di Instalasi Jenazah RSUD dr Pirngadi Medan mencurigai kematian korban dibunuh oleh kedua pria yang merupakan temannya. “Kedua kawannya sering nginap di rumah sewa si Awi di kawasan Jalan Air Bersih,SM Raja,” sebutnya. Sebelumnya sang kakek mengingatkan agar korban tidak berteman denga kedua temannya, karena memiliki gelagat yang mencurigakan. Namun, korban merasa kasihan karena kedua pria itu tidak memiliki pekerjaan hingga korban mengindahkan pesan sang kakek. “Dari awal ku lihat orang itu mencurigakan, buktinya saat cucuku meninggal, keduanya menghilang. Bahkan pintu rumahnya tidak rusak sama sekali,”sebut Aldi. Sementara Kapolsekta Medan Kota Kompol Sandy Sinurat menyatakan, polisi masih melakukan penyelidikan di lokasi kejadian untuk mengungkap pelakunya. “Mengenai motif kasus ini, polisi belum bisa menyimpulkan, masih melakukan penyelidikan dengan memeriksa saksi-saksi,” katanya. Sandy menjelaskan, di lokasi kejadian ditemukan peralatan untuk nyabu yakni mancis, bong. “Sedangkan saksi yang dimintai keterangan sudah lima orang yakni pacar korban dan empat teman kosnya,” ujarnya. (h04/h02/m39)

Sekadar mengingatkan kembali, untuk pendaftaran SNMPTN jalur undangan dimulai 1 Februari - 12 Maret 2011. Proses seleksi pilihan I di PTN masing-masing pada (21 Mare9 April), penetapan hasil seleksi tahap I (15-16 April). Kemudian proses seleksi pilihan II di PTN masing-masing (18 April-7 Mei) dan penetapan hasil seleksi akhir SNMPTN Jalur Undangan (1314 Mei). Pengumuman hasil SNMPTN jalur undangan (18 Mei) dan pra registrasi dan registrasi (31 Mei-1 Juni 2011). Sedangkan untuk pendaftaran SNMPTN jalur ujian tertulis/keterampilan dimulai 224 Mei 2011, untuk pelaksanaan ujian tertulis (31 Mei-1 Juni), pelaksanaan ujian keterampilan (3-4 Juni). Penetapan hasil SNMPTN jalur ujian tertulis/ keterampilan (26-28 Juni) dan pengumuman (30 Juni). Kemudian pada 13 Juli 2011 baru di-

Polsek Airbatu ... Mukhsin dipimpin Kanit Reskrim IPTU A. Siringoringo SH, “mengendus” gerakan tersangka, kemudian membekuk tersangka F,33, saat melakukan transaksi (belanja-red) di salah satu kedai. Dari tersangka F warga jalan Sisingamangaraja gang Rahmad Kisaran ini disita barang bukti 17 lembar upal pecahan Rp.100.000, lalu dikembangkan F mengaku mendapatkan upal dari tersangka AHH,38 warga Kelurahan Teladan Kecamatan

Danau Toba Tidak ... Pemandangan dari Tele, salah satu puncak tertinggi di Danau Toba, sungguh sangat memukau. Dari bebukitan biru itu memuncrat buih-buih putih berbentuk tali temali. Tali putih itu mengalir ke permukaan danau seperti semburan busa. Sungguh estetis. Perjalanan sekitar lima jam dari Medan serasa terbalas dalam sekejab. Tapi wisata ternyata bukan cuma soal memandang keindahan saja. Ada banyak faktor yang mempengaruhinya seperti kebersihan, budaya lokal, kenyamanan dan infrastruktur pendukung seperti hotel dan akses jalan penghubung. Persoalan utama infrastruktur jalan ke objek wisata Danau Toba ini masih “tradisional”. Untuk sampai ke Parapat, wisatawan harus menempuh jarak 3,5 jam. Ini dengan perhitungan wajar tanpa ada hambatan di tengah jalan. Ditambah lagi kondisi jalan yang belum sepenuhnya mulus. Jalur dari Medan melalui Tebingtinggi, Pematangsiantar tergolong jalur yang mulus. Tetapi itu masih jauh dari ideal karena tempat wisata semestinya harus sudah dilalui jalur bebas hambatan (tol) untuk mencapainya. Lain lagi jalur jalan melalui Kabupaten Tanahkaro—Dairi, lubang jalan menganga di mana-mana. Kondisi jalan yang rusak ini mencapai jarak puluhan kilometer. Ironisnya, kondisi seperti ini sepertinya telah terjadi sejak lama. Ada beberapa ruas jalan yang mulus—tampaknya baru diperbaiki. Tapi lebih banyak jalur jalan yang rusak bahkan kupak kapik. Belum lagi jalur jalan yang melingkari Danau Toba, masih tidak sepenuhnya bagus. Ini adalah pesoalan klasik sejak dulu, tapi tak pernah bisa diselesaikan. Sepertinya masalah utama ini diakui pemerintah daerah di wilayah Danau Toba, tetapi sepertinya mereka juga tidak bisa berbuat banyak. ‘’Masalah utama kita memang infrastruktur jalan,’’ kata R.Pardede Kepala Dinas Pariwisata Kabupaten Toba Samosir (Tobasa). Menurut Pardede, kalau jalan negara merupakan domainnya pemerintah Provinsi Sumatera Utara. Pihaknya hanya bisa mengusulkan untuk perbaikan jalan yang rusak atau hal-hal yang menyangkut perawatan kondisi jalan. ‘’Jalur darat itu adalah salah satu pintu masuk di samping jalur udara melalui Bandara Silangit,’’ kata Pardede. Namun untuk masalah jalan dalam tanggung jawab pemerintah kabupaten juga tidak sepenuhnya

Polisi Ringkus ... ‘’Kita tidak ingin Labuhanbatu menjadi tempat penyebaran buku-buku yang dapat menyesatkan pikiran masyarakat sehingga menjadikan Labuhanbatu menjadi keruh,’’ tegasnya. Kapolres mengimbau khususnya kepada Forum Lintas Agama agar dalam menyampaikan informasi lebih bijak dan dewasa. “ Kita menginginkan Labuhanbatu kondusif dan masyarakat tidak terpecah belah. Kita tidak ingin Labuhanbatu seperti Ambon, katanya. MUI Minta Polisi Proaktif Sementara, Majelis Ulama Indonesia (MUI) Kabupaten Labuhanbatu meminta Polres Labuhanbatu proaktif menangani kasus penyebaran buku dan VCD sesat ke masjidmasjid seperti di Kota Medan agar kerukunan umat beragama khususnya di L.Batu tetap kondusif Ketua MUI Labuhanbatu Drs H Ahmad Idris menyampaikan itu di Rantauprapat setelah menerima informasi adanya penangkapan seorang pelaku penyebaran buku dan VCD sesat oleh Polres setempat. Menurutnya, tindakan menyebarkan buku dan VCD sesat dilakukan oleh orang yang

Sembilan Tersangka ... Agus tidak menjelaskan secara detail posisi kesembilan tersangka karena penyidikan kasusnya berada di Mabes Polri. Pihaknya hanya bertugas untuk proses pengamanan pelimpahan tersangka ke jaksa. “KesembiIan tersangka ini beda dengan empat tersangka yang kita tangani. Jadi, saya tidak bisa jelaskan,” tandasnya Asisten Pidana Umum (Aspidum) Kejatisu Warsa Susanta mengatakan, proses penyerahan tersangka dan barang bukti ini dilakukan setelah berkasnya dinyatakan lengkap. “Penyidik kasus ini Densus 88 Mabes Polri,” bebernya. Menurut Warsa, setelah pelimpahan ini, langkah selanjutnya penyerahan berkas dakwaan ke pengadilan untuk disidangkan. “Proses persidangannya nanti dalam pengawasan bersama Kejagung, Kejatisu dan Kejari Medan,” jelasnya. Persidangan belum ditentukan Kasi Penerangan Hukum/ Humas Kejatisu Edi Irsan Kurniawan menambahkan, selain

Heboh Lingkaran ... Untuk naik ke atas bukit, warga membutuhkan waktu sekitar 15 menit. Belum lagi ditambah jalan yang licin dan sedikit berbahaya. Warga memilih naik ke bukit Gunung Suru, karena pemandangan dari atas tampak terlihat jelas. Lokasi yang diduga jejak pendaratan UFO berada di atas sekitar enam sampai tujuh petak sawah yang siap panen. Sawah yang menjadi jejak geometris aneh itu berada di sebelah barat pinggiran jalan pedesaan. Ratusan warga berjejalan di lokasi yang menjadi pusat perhatian. Tali tambang membentang di lingkaran jejak aneh itu. Tali itu untuk membatasi agar tidak ada warga yang masuk ke lokasi. Seorang warga Edi Winarno yang sempat masuk ke lokasi bersama pemilik sawah menceritakan kesaksiannya. Kata dia, pola yang terbentuk sangat rapi, tidak ada padi yang patah. “Saat itu tanah di situ terasa hangat, kalau dari bentuknya seperti pesawat luar angkasa,” kata Edi kepada, Senin 24 Januari 2011. Basyori, 41, warga Dusun Rejosari, Jogotirto, Berbah, yang

Ledakan Di Bandara.. penuh dengan ribuan orang dan terminal segera dipenuhi asap akibat ledakan. “Dari informasi sementara yang kami miliki, itu adalah satu serangan teror,” kata Presiden Medvedev memberitahu para pejabat dalam satu briefing televisi. Dia segera memerintahkan pihak berwenang untuk meningkatkan keamanan di dua

WASPADA Selasa 25 Januari, 2011 ingin memancing kerusuhan serta perpecahan antar umat beragama di Sumatera Utara khususnya Kota Medan dan Labuhanbatu. Untuk itu, kata Ahmad, Polres Labuhanbatu harus serius mengusut kasus itu dan diharapkan dapat membongkarnnya hingga ke aktor intelektualnya. Sebaliknya, atas prestasi Polres Labuhanbatu yang berhasil menangkap salah seorang pelaku penyebaran buku dan VCD sesat tersebut, MUI Labuhanbatu memberikan apresiasi dan berharap kepolisian setempat dapat memahami perasaan keagamaan umat Islam yang saat ini lagi tersakiti oleh pihak-pihak tidak bertanggungjawab. Dan, mengimbau umat Islam agar tetap waspada terhadap upaya-upaya yang mencoba menodai dan menista agama Islam dan tidak terprovokasi sehingga kerukunan beragama tetap kondusif. Non Muslim Hormati Muslim Dari Kota Binjai, Ketua Majelis Ulama Indonesia (MUI) Kota Binjai DR HM Jamil, MA pada hari yang sama meminta seluruh nazir dan Badan Kemakmuran Masjid/Mushala (BKM) di Kota Binjai mewaspadai pengiriman buku danVCD berisi ajaran-ajaran yang tidak

sesuai ajaran Islam. Seperti yang terjadi di Kota Medan, katanya, bukan tidak mungkin buku dan VCD seperti itu akan dikirimkan kepada nazir dan BKM di Kota Binjai. Ketua MUI Binjai HM Jamil mengaku menerima informasi, sudah ada masjid di Kota Binjai menerimanya. Tetapi informasi itu belum mendapat kepastian, sebab tidak ada yang melapor kepada MUI.Pengurus MUI sudah melakukan rapat harian membahas beredarnya buku danVCD di masjid-masjid di Kota Medan dan mengantisipasi supaya tidak beredar di Kota Binjai. Salah satu keputusan MUI Kota Binjai adalah mengutuk keras perbuatan pengiriman buku danVCD ke masjid di Kota Medan, sebab hal itu merusak ajaran agama dan mengganggu ketertiban umat beragama. ’’ Jika ada menerima pengiriman buku dan VCD segera melapor ke MUI Kota Binjai, Jalan Olahraga (di samping Masjid Agung Binjai,’’ katanya. Selain masalah peredaran buku dan VCD, ujarnya, MUI Kota Binjai membahas karyawan atau pembantu rumah tangga (PRT) muslim yang bekerja di rumah atau usaha milik warga non muslim agar memberikan fasilitas beribadah. (a26/a27/a03)

penyerahan tersangka dan berkas acara pemeriksaan juga turut disertakan sejumlah barang bukti. Tim penyidik Densus membawa 11 paket barang bukti yang diperoleh selama proses penyidikan. Namun, ia belum merinci secara detail mengenai barang bukti itu. “Kita lihat saja nanti di persidangan,” tegasnya. Begitu juga ketika ditanya jadwal persidangan para tersangka, juga belum bisa dipastikan jadwalnya, sebab tim kejaksaan masih akan menyusun berkas dakwaan. Dalam kasus ini, para tersangka dikenakan pasal berlapis, yakni Pasal 6, 7, 9, 13, 15, 17, 9, UU No15 tahun 2003 tentang pemberantasan tindak pidana terorisme dan Pasal 340 KUHP, jo Pasal 365 ayat 4 KUHP, jo pasal 55 ayat 1 ke 1 KUHP, jo pasal 56 ke 1 KUHP dengan ancaman maksimal hukuman mati “JPU yang menangani kasus ini nanti terdiri dari lima orang setiap satu tersangka. Terdiri dari dua dari jaksa Kejagung, dua dari Kejari dan satu Kejatisu,” tambah Warsa lagi. Dari sembilan tersangka itu,

empat orang di antaranya ikut terlibat dalam kasus perampokan Bank CIMB Niaga Jalan Aksara Medan pada pertengahan Agustus 2010. Selebihnya ikut terlibat dalam penyerangan Mapolsek Hamparan Perak dan aksi terorisme lainnya di sejumlah daerah. Sementara itu, Direktur Reskrim Polda, Kombes Pol Agus Adriyanto mengatakan, para tersangka hanya sementara di tahanan Kejati Sumut. Selanjutnya akan dipindahkan ke tahanan Polda Sumut sebagai tahanan titipan. “Rencananya para tersangka akan dititipkan di tahanan Polda Sumut. Tetapi saya tidak tahu pasti apakah semuanya atau sebagian saja. Sekarang Direskrim Polda Sumut sedang menunggu berita acara penyerahannya,” jelas Agus. Agus juga menegaskan, para tersangka tidak dititipkan di rutanTanjung Gusta Medan atas pertimbangan keamanan. “Semua atas pertimbangan keamanan dan kemudahan tim penyidik dalam melakukan kerjanya. Itu saja, bukan alasan lain,” tambah Agus. (m49/m32/m39)

tinggal di dekat crop circle di persawahan Berbah, Sleman, mengaku pada pukul 22.30 Sabtu (22/1) mendengar suara seperti bunyi pesawat atau helikopter. “Tapi suaranya halus dan tidak bising,” katanya ditemui di rumahnya, Sleman, Senin. “Saya tanyakan istri, ini suara apa sih Bu? Kok kayak pesawat, tidak keras tapi jelas terdengar’,” katanya. Tapi istrinya diam saja. Basyori pun tak merespons lebih lanjut. Minggu siang, setelah warga heboh bahwa padi yang rubuh membentuk pola tertentu berdasarkan foto seorang anak, barulah Basyori teringat suara semalam itu. Crop circle itu diduga terbentuk pada Sabtu malam itu. Ngadiran, salah satu pemilik sawah tempat pola terbentuk, menyatakan pada malam menjelang masuk ke hari Minggu sudah melihat padinya rubuh. Bukan UFO Astronom Lembaga Penerbangan dan Antariksa Nasional (LAPAN) Thomas Djamaluddin mengatakan, fenomena itu sangat diragukan ada kaitannya dengan UFO, bahkan hampir mustahil. Sebab, kata profesor itu, “UFO secara sains tidak ada. Tidak ada bukti ilmiah keberadaan UFO. Tidak mungkin crop

circle disebabkan UFO.” Fenomena yang sama di banyak negara, tambah Thomas, membuktikan bahwa crop circle adalah rekayasa manusia saja. “Tujuannya macam-macam, ada karya seni, komersial, dan lain-lain.” Meski kelihatannya pola yang dihasilkan rumit dan susah, nyatanya banyak orang yang membuatnya. “Ada triktrik tertentu untuk membuat lingkaran, atau garis tertentu.” Dugaan bahwa crop circle adalah buatan manusia diperkuat fakta bahwa pola itu muncul di area persawahan yang sepi, diapit tiga bukit. “Mungkin idenya agar karya seni itu bisa dilihat dari bukit,” tambah dia. Soal dugaan penyebabnya adalah faktor alam, Thomas mengatakan juga tak mungkin. Sebab, pola yang ada terlihat rapi. “Tidak mungkin karena puting beliung, karena faktor alam. Juga tidak ada alasan proses elektromagnetis membentuk hal semacam itu.” Sebelumnya, Kepolisian Daerah Istimewa Yogyakarta membenarkan munculnya lambang misterius itu. “Kami memang menerima laporan dari masyarakat adanya fenomena itu. Selain itu, banyak warga sekitar yang penasaran dan menonton langsung persawahan yang terbentuk lambang seperti UFO,” kata Kepala Bidang Humas Polda DIY, AKBP Anny Pujiastuti. Beberapa petugas dari Polsek sudah melakukan pengecekan, namun menurut dia, belum bisa dipastikan apa penyebab terjadinya. “Petugas hanya mengecek saja dan berjaga-jaga. Namun belum bisa dipastikan asal mula terjadi fenomena itu,” ujar dia. (Ant/VIVAnews)

bandara komersial Moskow dan beberapa fasilitas angkutan lainnya, termasuk sistem kereta api bawah tanah, sasaran serangan teror masa-masa lalu. Meski terjadi berulangkali serangan di kereta api bawah tanah Moskow dan kereta api Rusia — yang sebagian besar dituduhkan pada militan Chechen — pengeboman Senin merupakan pertama kalinya melibatkan satu bandara Rusia sejak 2004. (m10)

Kebahagiaan ... Hidup bahagia memang idaman semua orang. Jika ingin bahagia tentu harus berusaha untuk mencapainya. Sekurang-kurangnya anda harus mencari empat perkara yang disebutkan dalam hadits riwayat Ibnu Hibban seperti yang kami kutip di atas. Isteri yang shalehah menduduki urutan pertama dalam kebahagiaan seseorang. Kriterianya antara lain adalah si istri harus tunduk dan patuh kepada suami sepanjang suami itu berada dalam kebenaran. Tugas isteri melayani suami, menyediakan makanan, mendidik anakanaknya supaya anak-anak juga selamat dari godaan duniawi. Tidak menolak ketika engkau berhajat kepadanya. Rumah yang luas dan indah juga akan mendatangkan kebahagiaan bagi penghuninya. Rumah itu surga bagi mereka yang beriman. Di rumahlah seseorang akan mendapat ketenangan dan kebahagiaan. Rumah adalah istana dan engkau adalah rajanya, isterimu ratu di rumah tanggamu, dan anak-anak itu rakyatmu. Allah menjadikan untuk kamu rumah-ru-

mah kamu sebagai tempat ketenangan ( QS. An-Nahlu:80). Anda juga akan sangat bahagia bila menemukan tetangga yang baik, dermawan, murah hati, saling menghormati, dan memberi perhatian kepada anda sekeluarga. Tetangga yang baik tidak akan mengganggu keluarga anda. Tidak iri hati terhadap kekayaan anda. Mereka memuliakan anda dan sebaliknya anda juga akan memuliakan mereka. Bila anda mendapat nikmat mereka turut bersyukur, bila anda mendapat musibah mereka segera menolong. Kendaraan baru (mobil mewah) juga akan mendatangkan kebahagiaan tersendiri. Tetapi yang satu ini harus hati-hati, jangan sampai mobil itu memperbudak anda. Misalnya anda selalu merawatnya, menjaga oli, minyak rem, dana perawatan, mencuci dari debu, dan sebagainya. Hitung-hitung anda selalu menjaga kebersihannya, tetapi anda lupa menjaga kebersihan diri sendiri. Anda lupa mandi, gatal dan berpanu, belum lagi lupa membersihkan rohani anda dari dosa-dosa. Bila ini yang terjadi, mobil anda telah menjadi “tuan” yang memperbudak anda.

Medan Metropolitan Pedagang Audit Sendiri WASPADA Selasa 25 Januari 2011


Tunggakan Pedagang Rp5,2 Miliar Di PD Pasar Diduga Kebocoran MEDAN (Waspada): Pedagang Pasar Aksara tidak percaya dikatakan memiliki tunggakan tarif kontribusi tempat berjualan dan kebersihan sebesar Rp593 juta lebih kepada PD Pasar Medan pada 2009. Hal tersebut juga menimbulkan kecurigaan pedagang di pasar-pasar tradisional lainnya yang juga tidak percaya dan dinilai mengada-ada, jumlah tunggakan pedagang hingga tahun 2009 membengkak sebesar Rp5,2 miliar lebih. Untuk itu pedagang Pasar Aksara akan melakukan audit sendiri seluruh tunggakan pedagang di lantai II untuk menyelamatkan uang negara yang diduga dimanipulasi oleh direksi PD Pasar kemudian akan dilaporkan kepada Badan Pemeriksa Keuangan (BPK), Kejaksaan dan Badan Pengawas Pemko. “Kami akan audit sendiri terkait adanya dugaan telah terjadi kebocoran uang kontribusi tempat berjualan yang berasal dari

aset negara. Kami lebih percaya itu hanya kebocoran akibat penyelewengan dan penyalahgunaan jabatan yang dilakukan berbagai oknum PD Pasar dalam jumlah besar,” ujar Muslim Sikumbang, pedagang Pasar Aksara, kemarin. Menurutnya, dia bersama pedagang lainnya merasa sangat heran dengan besarnya jumlah tunggakan yang terjadi di Pasar Aksara tempat mereka berjualan, yang menurut PD Pasar pada 2009 di Pasar Aksara, membengkak Rp593 juta lebih. Padahal, lanjutnya, hanya sebagian kecil pedagang Pasar Aksara yang menunggak pembayaran tarif tempat berjualan dan kebersihan. Hal tersebut dapat dibuktikan dengan kartu

hak sewa yang terus diperbaharui setiap tahunnya. Menurut Sikumbang, apabila mengalami tunggakan maka kartu hak sewa tidak akan dapat diperbaharui karena syarat pembaharuan kartu yang harus dilakukan setiap tahun tidak dapat dilakukan jika memiliki tunggakan. Menurut perkiraannya bersama para pedagang lain, tunggakan pedagang Pasar Aksara diperkiraan hanya berkisar Rp100 juta lebih, tetapi jika jumlahnya membengkak Rp593 juta lebih di PD Pasar diduga terjadi penyelewengan oknum pejabat PD Pasar terhadap uang negara. “Audit tersebut dilakukan pedagang bersama pedagang lainnya terhadap utang sesama mereka karena melihat terjadi kejanggalan yang membuat pedagang merasa dikambinghitamkan PD Pasar,” ujarnya. Sementara itu Kepala Bagian Pendapatan PD Pasar Muhammad Jalil kepada wartawan

mengatakan, jumlah tunggakan pedagang sebesar Rp5,2 miliar lebih pada 2009 sesuai laporan bagian keuangan. Sedangkan jumlah tunggakan pada 2010 belum dapat diketahui karena pihaknya masih dalam penyusunan laporan keuangan yang akan segera di sosialisasikan ke masyarakat setelah selesai audit badan pengawas dan instansi berwenang. Sementara itu, menurut PD Pasar tunggakan pedagang di Cabang I pada 2009, yakni Pusat Pasar sebesar Rp523 juta lebih, Pasar Sambu Rp350 juta lebih, Pasar Jalan Timah Rp33 juta lebih, Pasar Halat Rp155 juta lebih, Sukaramai Rp1 miliar lebih, Pasar Simpang Limun. Selain itu, pasar lainnya di Cabang I seperti Titi Kuning dan Kampung Baru menunggak Rp6,9 juta, Pasar Jalan Bakti Rp73 juta lebih, Pasar Sambas, Pandu Baru menunggak Rp31 juta lebih dan Pasar Penampungan Jalan Bulan menunggak

Rp126 juta lebih. Tunggakan pedagang pasar tradisional di Cabang II pada 2009 juga tinggi, yakni Pasar Petisah menunggak Rp91 juta lebih, Pasar Padang Bulan Rp74 juta lebih, Sikambing Rp50 juta, Pasar lalang menunggak Rp44 juta lebih, Pasar Muara Takus dan Pasar Ikan Lama menunggak Rp566 juta lebih. Sedangkan pasar lainnya di Cabang II seperti Pasar Kwala Bekala juga menunggak Rp57 juta lebih dan Pasar Helvetia menunggak Rp78 juta lebih. Tunggakan di pasar Cabang III, yakni Pasar Aksara Rp593 juta lebih, Pasar Pendidikan Rp99 juta lebih, Pasar Sentosa Baru Rp206 juta lebih, Pasar Glugur Kota Rp176jutalebihdanPasarMedan Deli Rp359 juta lebih, Pasar Titi Papan Rp17 juta lebih, Pasar Labuhan, Paus dan Pasar Simpang Atap menunggak Rp37 juta lebih dan Pasar Jalan Jawa, Kapuas dan Pisang menunggak Rp417 juta lebih.(m40)

Bank Sumut Raih Penghargaan BUMD & CEO BUMD Terbaik MEDAN (Waspada): Bank Sumut menerima anugerah sebagai The Best BUMD of The Year 2010 yang diselenggarakan majalah Bussines Review bekerjasama dengan Badan Kerjasama BUMD Seluruh Indonesia (BKS BUMD SI) dengan menyisihkan 2000-an BUMD (Badan Usaha Milik Daerah) di Indonesia. Selain itu, Direktur Utama Bank Sumut Gus Irawan Pasaribu yang pada tahun 2008 meraih predikat CEO of The Year kembali mempertahankan perestasinya dengan meraih The Best CEO BUMD of The Year 2010 sekaligus menerima penghargaan The Best CEO for Business Team Work Development 2010.

Penyerahan penghargaan itu diselenggarakan di Hotel LeMeredian, Jakarta, Jumat (21/1) sore, disaksikan Mendagri yang diwakili Dirjen Keuangan Daerah Kemendagri, Yuswandi A Temenggung, para top management BUMD, pejabat daerah dan anggota DPRD dari berbagai provinsi, termasuk Ketua DPRD SU, Saleh Bangun, Ketua Komisi C Edy Rangkuti serta Wakil Ketua dan Sekretaris Komisi C DPRDSU. Bank Sumut juga mendapat penghargaan lainnya, yakni The Best Marketing & Customer Service dan The Best Performance Management System. Dengan keberhasilan Bank Sumut mendominasi 8 penghargaan terbaik dari 10 penghar-

gaan yang dikompetisikan, Gubernur Sumatera Utara dinobatkan sebagai Pembina Terbaik BUMD dan BPD seIndonesia. Sedangkan untuk kategori kinerja keuangan dan human capital (sumber daya manusia), meski direbut BUMD lain, namun untuk kedua penghargaan itu Bank Sumut meraih peringkat kedua. Pencapaian ini meningkat dari periode sebelumnya. Pada tahun 2008, Bank Sumut secara over all berada di peringkat 3, demikian juga di setiap kategori berada di peringkat 3 dan 4. Penghargaan terbaik pertama itu masing-masing diterima oleh Komisaris Utama Bank Sumut, Djaili Azwar, Direktur Utama (Dirut) Bank Sumut, Gus

Irawan Pasaribu, Direktur Umum, M Yahya dan Direktur Pemasaran dan Syariah, Zenilhar. Untuk penghargaan Pembina Terbaik BUMD diterima oleh Gubernur Sumatera Utara (Gubsu) yang diwakili Wagubsu Gatot Pujonugroho. Wagubsu Gatot Pujonugroho menyambut gembira keberhasilan Bank Sumut meraih prestasi gemilang tersebut, yang membuktikan bank kebanggaan masyarakat Sumatera Utara itu memiliki semangat profesionalisme tinggi dan mampu meningkatkan kinerjanya dalam rangka memberikan kontribusi bagi pembangunan perekonomian daerah dan peningkatan taraf hidup rakyat Sumatera Utara. “Saya pikir, ke

depan Bank Sumut harus lebih fokus mengembangkan kredit di sektor-sektor produktif, terutama untuk pelaku usaha mikro,” katanya. Direktur Bank Sumut Gus Irawan Pasaribu mengatakan, keberhasilan Bank Sumut diharapkan menjadi pemicu semangat bagi seluruh karyawan Bank Sumut dan pemerintah daerah selaku shareholders untuk mengejar visi ke depan yang lebih besar yakni BPD Regional Champion 2014. “Kita sedang melakukan akselerasi untuk menjadi leader perbankan di Sumatera Utara, yang diharapkan bisa tercapai lebih cepat dari target BPD Regional Champhion, yakni tahun 2013,” ujar Gus Irawan. (m28)

Waspada/ Rustam Effendi

MEMPERBAIKI SAMPAN: Dengan menggunakan peralatan sederhana, seorang nelayan tradisional di Kelurahan Labuhan Deli, Kec Medan Marelan memperbaiki sampannya di bantaran Sungai Deli, Sabtu (22/1). Nasib nelayan semakin menderita akibat sulitnya mencari ikan disebabkan tingginya gelombang laut di Selat Malaka.

Elfachri Budiman Tak Hadir Sidang Ruislagh KBM Ditunda MEDAN (Waspada): Majelis Hakim Pengadilan Negeri Medan, Senin (24/1), menunda sidang mantan Wakil Walikota Medan Ramli Lubis, terkait kasus ruislagh Kebun Binatang Medan (KBM) karena sejumlah saksi yang dipanggil jaksa tidak hadir. “Sidang kita undur karena saksi tidak datang. Sidang kembali digelar Kamis (26/1),“ kata Ketua Majelis Hakim Sugiyanto sebelum menuntup persidangan, kemarin. Pada persidangan itu juga, Sugiyanto mengingatkan Jaksa Penuntut Umum Rehulina Purba dkk agar lebih pro aktif menghadirkan saksi. “Tolong saudara jaksa maksimalkan pemanggilan saksi, hingga proses pemeriksaan perkara ini tidak berlarut-larut dengan demikian prinsip persidangan cepat biaya ringan dapat terpenuhi,” tegas Sugiyanto. Menurut Rehulina Purba, sesuai surat panggilan, hari ini (Senin-red) dijadwalkan hadir tiga saksi, yakni pihak mantan dan pejabat Kantor Badan Pertanahan Nasional (BPN) Kota Medan serta pemilik tanah Kebun Binatang yang baru. Salah satu saksi disebut-sebut mantan Kepala BPN Medan Elfachri Budiman. “Kami sudah melayangkan surat panggilan sidang kepada para saksi, namun mereka belum hadir,” tegas Rehulina menjelaskan kepada majelis hakim. “Hari ini sidang ditunda karena saksi jaksa tak datang, Kamis dilanjutkan,” kata Benni Harahap, ketua Tim Advokasi Ramli Lubis

seusai persidangan menjawab wartawan. Sementara Ramli Lubis kepada wartawan seusai persidangan mengatakan, penundaan sidang ini tidak masalah karena memang saksi tidak datang. “Tapi, kalau seandainya jaksa menyiapkan saksi cadangan tentu, sidang ini tidak ditunda,” tegas Ramli sebelum meninggalkan PN Medan. Pantauan, kemarin, sebelum sejumlah saksi telah diperiksa, dimana secara umum, para saksi mengatakan, ruislagh KBM menguntungkan PemkoMedandanprosesnyamelaluimekanisme. Bahkan, ada dua saksi JPU, yakni mantan Camat Medan Tuntungan dan Maimun mencabut keterangannya di Berita Acara Pemeriksaan (BAP) dan Direktur III PT GKU U.Tandias meminta kepada majelis hakim agar mengembalikan KBM baru kepada mereka, sebeb, menurutnya, ruislagh hanya menguntungkan Pemko Medan. Begitu juga dengan keterangan Lurah Simalingkar B, Perdana Sembiring, di mana kehadiran KBM di kawasan itu telah mengangkat perekonomian warganya, baik dari harga tanah yang meningkat cukup signifikan maupun wisata. Terbukti, saat ini pembangunan perumahan di daerah itu meningkat pesat. “Kami warga Simalingkar B sangat berterima kasih dengan adanya ruislagh KBM tersebut,” kata Perdana ketika itu. Berangkat dari keterangan para saksi, Ramli menilai dugaan rekayasa kasus ini sedikit demi sedikit mulai terungkap. (m49)

Medan Metropolitan


WASPADA Selasa 25 Januari 2011

Pansel Anggota KIP Akui Terjadi Kesalahan Anggota DPRDSU Beda Pendapat MEDAN (Waspada): Polemik tentang pengumuman seleksi Calon Anggota Komisi Informasi Publik (KIP) Sumut belum menemukan jalan keluar. Senin (24/1), Komisi A DPRD Sumut mengundang panitia seleksi (Pansel) untuk mengadakan rapat dengar pendapat. DPRDSU mempermasalahkan seleksi yang dilakukan Pansel karena adanya dua pengumuman. Pada pengumuman pertama nama salah seorang calon Mayjen Simanungkalit tidak masuk. Namun pada pengumuman kedua, nama itu muncul. Nama yang hilang kemudian adalah Josep Sihombing. Masalah kemudian muncul karena satu dari lima orang

Pansel, yakni Benget Silitonga tidak bersedia menandatangani surat keputusan yang kedua. Ketua Komisi A Hasbullah Hadi mengatakan, pertemuan hari itu dilakukan untuk mempertanyakan kembali kepada Pansel KIP tentang dua pengumuman hasil seleksi yang dilaksanakan November 2010. Hasil yang semula dimasukkan ternyata berubah sehingga penan-

KBPP Polri Sumut Solid MEDAN (Waspada): Pengurus Daerah Keluarga Besar PutraPutri (KBPP) Polri Sumut tetap solid, sekalipun muncul upaya memecah-belah dari pihak yang menamakan dirinya Tim-9. ‘’Kami tidak terpengaruh,’’ kata Ketua PD KBPP Polri Sumut Ir Diapari Siregar kepada wartawan, Sabtu (22/1). Didampingi sekretaris Zulkifli Dahlan, SH, Direktur LBH KBPP Hilmar Robinso Silalahi, SH, Kasat Sibhara Anggiat Rumapea, Diapari menegaskan Tim-9 tidak tercantum, dalam AD/ART dan peraturan organisasinya. Oleh karena itu kami tidak mengakui keberadaan Tim-9. Sekaitan dengan munculnya pihak yang mengaku Tim9, PD KBPP Polri Sumut meminta jangan coba-coba memalsukan kop surat, stempel, logo. Hilmar R. Silalahi menambahkan, ada pihak yang tendensius terhadap PD KBPP Polri Sumut dengan cara memfitnah untuk kepentingan pribadi. Sedangkan Anggiat Rumapea menegaskan pihaknya tidak pernah mengeluarkan SK pelantikan kepengurusan Sibhara KBPP Polri Medan.(m03)

Siswa Terbaik Melancong Ke Jepang MEDAN (Waspada): Festival Budaya Jepang dan Lomba Pidato Bahasa Jepang tingkat SMA sederajat se Sumatera Utara, mencari siswa terbaik untuk diadu ke tingkat provinsi dan kemudian bagi juara satu akan diberangkatkan ke Jepang, Sabtu (22/1). Acara ini dihadiri oleh Aya Kumakura Konsulat Jepang, Fumiaki Ketua Medan Javan Club, Eman Kusdiyana, Konsulat Jenderal Jepang, dan Lili Fatma, pengajar di Harapan. Dan mereka juga sebagai juri cerdas cermat, komik dan pidato bahasa Jepang. Syahrin Harahap, rektor Univa, yang memberi sambutan dalam acara itu mengungkapkan, acara ini bagian dari visi-misi pembelajaran, bukan hanya bahasa Jepang yang harus dipelajari tapi juga budayanya yang selalu kerja keras.“Marilah kita menyontohnya untuk menghasilkan sesuatu yang terbaik,” ungkapnya. Sementara Nurjannah, ketua panitia menuturkan, festival dan lomba ini diadakan untuk memperkenalkan budaya Jepang dan menambah motivasi anak-anak untuk belajar bahasa Jepang. “Pesertanya bersaing ketat, tapi kami harus memilih satu untuk diikutsertakan ke Jakarta pada 19 Februari,” ujarnya. Peserta pidato Bahasa Jepang 17 orang, cerdas cermat 78 orang, membuat komik 64 orang, kaligrafi Jepang 78 orang, bersaing ketat memperebutkan hadiah dari Konsulat Jepang. (csf)

Alumni SMPN 10 Akan Reuni MEDAN (Waspada): Untuk menjalin tali silaturahmi, alumni SMPN 10 Medan Angkatan 1991 akan menggelar acara temu kangen, alumni di Hall Amaliun Food Court Jalan Amaliun Medan, Minggu (30/1). Kepanitiaan pengurus melalui bendahara Acara Temu Kangen Alumni SMPN 10 Angkatan 1991 Arie Nasution yang datang ke Harian Waspada Medan, Senin (24/1), menjelaskan, kegiatan reuni plus temu kangen itu dilakukan untuk lebih mempererat tali silaturahim antar alumni SMPN 10 yang telah lama tidak berkomunikasi setelah meninggalkan sekolah tersebut. Dalam susunan kepanitian yang diketuai Dodi Sofyan Andika dan Sekretaris Mei Friska serta Bendahara Arie Nasution mengharapkan, alumni yang berada di luar kota agar bisa hadir di acara yang bertema “Temu Kangen Alumni SMPN 10 Angkatan 1991”. (h04)

datanganan pleno pertama dianggap salah dan perlu ditelusuri kembali. Menanggapi ini, Ketua Pansel KIP Eddy Syofian mengaku terjadi kesalahan pemasukan data saat listrik padam sehingga komputer error. Data yang dimasukkan pertama berubah. Pernyataan ini ditambahkan juga oleh seorang anggota Pansel Moh Hatta. Katanya, mereka telah mengupayakan semaksimal mungkin. Dan hasil yang salah itu sempat ditandatangani oleh peserta rapat pleno. “Karena itulah kemudian dilakukan perbaikan.” Sementara itu, seorang anggota Pansel KIP Benget Silitonga pada pertemuan itu mengaku tidak mempersoalkan masuknya nama Mayjen Simanungkalit dalam daftar 15 besar calon anggota KIP Sumut. Sebab dia mengaku lebih mengenal May-

jen Simanungkalit daripada Josep Sihombing. Namun dia tidak menjelaskan mengapa dia kemudiantidakmenandatangani surat keputusan yang kedua. Belum diputuskan Walaupun telah dilakukan rapat dengar pendapat, namun keputusan tentang calon anggota KIP Sumut ini belum juga dapat diselesaikan. Komisi A DPRDSumutbelumdapatmembuat kesimpulan, apakah proses seleksi dilanjutkan atau diulang mulai dari awal. Sejumlah anggota dewan masih berbeda pendapat tentang masalah ini. Beberapa anggota Komisi A yang ditanya wartawan ada yang mengatakan prosesnya harus diulang karena menimbulkan kecurigaan, di antaranya adalah Syamsul Hilal. Tapi ada juga yang menyebutkan sebaiknya dilanjutkan saja, karena prosesnya telah melalui tiga

tahapan. Anggota dewan yang berpendapat demikian adalah Irwansyah Damanik. Menurut Damanik, akan lebih bijaksana kalau proses seleksi calon anggota KIP Sumut dilanjutkan ke tahapan berikutnya. Yakni penjaringan dari 15 orang, menjadi 5 oleh DPRD. Kerja Pansel, menurut Damanik, telah selesai. Yakni menseleksi dari 80 peserta, menjadi 30 dan sekarang tinggal 15 orang. Alasan lainnya, menurut Damanik, adalah persoalan anggaran. Dia sangat yakin kalau anggaran untuk seleksi ini sudah hampir habis. Bila prosesnya dimulai dari awal lagi, maka akan ada penambahan dana lagi. Kalau itu yang terjadi maka harus menunggu PAPBD Sumut tahun 2011. ‘’Jadi menurut saya akan lebih bijaksana bila prosesnya dilanjutkan saja,’’ demikian Damanik. (m12)

Pemko Alihkan Korban Kebakaran Ke Pasar Palapa MEDAN (Waspada): Seluruh pedagang kaki lima di Pasar Brayan dan di bawah jembatan layang (fly over) yang menjadi korban kebakaran, direlokasi ke Pasar Palapa yang jaraknya sekitar 1 km dari tempat kebakaran. “Semua pedagang di pasar tersebut kita relokasi ke Pasar Palapa yang tidak jauh dari lokasi kebakaran. Sedangkan di bawah fly over dan Pasar Brayan harus dikosongkan, dan tidak seorang pun pedagang diperbolehkan berjualan di tempat tersebut,” kata Sekda Kota Medan Syaiful Bahri kepada Waspada melalui teleponnya, Senin (24/1). Dikatakan Syaiful, sebelumnya memang ada rencana akan direlokasi ke lahan PTPN II, namun setelah ditinjau ke Pasar Palapa ternyata masih banyak lapak yang bisa digunakan untuk pedagang. Jadi, para pedagang akan direlokasi ke tempat tersebut yang sifatnya hanya membayar retribusi. “Setelah kita tinjau Pasar Palapa itu, ternyata masih ada sekitar 500 lagi lapak yang bisa digunakan. Jadi, untuk apa kita relokasi ke lahan PTPN II itu. PD Pasar telah membersihkan lapak di Pasar Palapa, dan peda-

gang hanya tinggal menempati,” ucapnya. Dikatakan Syaiful, pihaknya belum tahu apakah semua pedagang bersedia menempati lapak di Pasar Palapa, namun Pemko juga tidak akan mengizinkan siapa pun yang berjualan di pasar yang telah terbakar. “Kalau siapa yang mau menempati lapak tersebut kita izinkan. Bagi yang tidak mau, enggak ada masalah. Namun, yang pasti kita tidak akan mengizinkan siapa pun berjualan di tempat tersebut. Kolong fly over harus dikosongkan, dan akan dibuat taman,” tegasnya. Pada kesempatan tersebut, Syaiful mengatakan kedatangan Tim Kementerian Pekerjaan Umum (PU) Pusat hanya mengambil visual fly over Brayan. “Tim PU Pusat hanya mengambil visual fly over pasca kebakaran. Hasil ini selanjutnya dibahas di Kementerian untuk membicarakan teknis dan masa depan Fly Over Brayan. Mungkin minggu ini akan diambil tindakan teknis,” kata Syaiful. Syaiful menjelaskan, hasil dari Tim Kementerian PU juga sudah disampaikan secara tertulis oleh Dirjen Kementerian PU kepada Menteri PU. Selan-

jutnya, tim akan kembali turun untuk mengambil tindakan teknis dan aksi. Saat ini, sebagai upaya untuk menjaga jembatan agar tidak roboh, Pemko melalui Dinas Perhubungan sudah membuat larangan kepada truk-truk bermuatan di atas 20 ton agar tidak melintas. “Kita tidak bisa jaga 100 persen. Apalagi malam hari, tapi sudah dibuat larangan. Kita berharap pengemudi mematuhinya. Jangan nanti setelah kejadian meminta ganti rugi. Padahal kita sudah larang. Jelas Pemko tidak akan bertanggungjawab,” tegasnya. Demikian juga dikatakan Kepala Satuan Kerja NonVerftikal Tertentu (SKNVT) Pembangunan Jalan dan Jembatan Metropolitan Balai Besar Jalan dan Jembatan Kementerian Pekerjaan Umum (PU) Wilayah I Sumut Simon Ginting. “Hari ini (kemarin-red) tim yang turun pada, Sabtu (22/1), melaporkan hasil visual yang diambil. Mungkin dalam minggu ini, tim kembali turun untuk melihat tindakan teknis. Jadi, belum diketahui apakah fly over masih layak atau tidak,” katanya. (m50)

DPRDSU Minta Pemko Tegas MEDAN (Waspada): Pemko Medan diminta anggota DPRD Sumut tegas menyelesaikan kasus terbakarnya 200 kios liar di kolong Jembatan Layang (Fly Over) Brayan, yakni dengan meminta pertanggungjawaban pengelola pasar tersebut terkait peristiwa kebakaran yang terjadi beberapa hari lalu. Anggota Komisi C DPRD Sumut Muslim Simbolon berbicara kepada Waspada di gedung dewan, Senin (24/1). “Pemko tidak bisa berdiam diri saja atas peristiwa kebakaran yang terjadi,” ujarnya. Pasar Brayan, lanjutnya,

adalah pasar ilegal. Bukan karena pasar itu dikelola oleh swasta, tapi karena penempatannya yang tidak diperbolehkan untuk berjualan. Simbolon mengaku mendapat informasi kalau tim dari pusattelahmengujikembalikonstruksi jembatan layang pasca kebakaran. Bahan karet yang digunakan sebagai perekat di jembatan itu sudah pasti rusak. Sedangkan konstruksi betonnya, kemungkinan juga rusak, karena suhu panas yang memanggang jembatan itu diperkirakan lebih dari 1000 derajat Celsius. Ini menurut Simbolon

merupakan kerugian besar bagi masyarakat Kota Medan yang sangat terbantu oleh keberadaan jembatan layang tersebut. Namun, akibat pengawasan yang sangat lemah dari Pemko, bangunan vital itu kini terancam tidak dapat dioperasikan lagi. ‘’Atau paling tidak membutuhkan perbaikan yang sangat mahal,’’ katanya. Simbolon berharap Pemko segera menurunkan tim untuk meneliti keberadaan pasar yang terbakar tersebut. Pengelola Pasar Brayan harus bertanggungjawab terhadap terjadinya peristiwa tersebut. (m12)

Percepatan Pembangunan Medan Utara Di Mulut Saja SEJAK kepemimpinan Walikota Medan Abdillah, wilayah Medan bagian utara atau yang dikenal Medan Utara: Medan Deli, Medan Labuhan, Medan Marelan dan Medan Belawan telah dicanangkan menjadi kawasan prioritas pembangunan Pemko Medan dengan istilah percepatan pembangunan. Namun dari pantauan dan wawancara Waspada kepada beberapa warga Medan Utara, Sabtu (22/1), menunjukkan program yang sudah berjalan sekitar 6 tahun itu, belum memperlihatkan kemajuan karena pada daerah tertentu seperti Kel. Sei. Mati, Kec. Medan Labuhan, dan lima kelurahan Kec. Medan Belawan, percepatan pembangunan belum dirasakan warga. Kerusakan infrastruktur di 7 kelurahan masih terpampang berupa kerusakan parit dan jalan seperti di Jalan Tunda Lingkungan II, Kel. Sei Mati, dan Jalan Pulau Sinabang Lingkungan VIII, Kel. Belawan Bahari, serta puluhan jalan gang belum dibeton atau mendapat pengerasan. “Seharusnya jalan ini sudah tidak seperti ini lagi, jika percepatan dilaksanakan. Makanya semua pembangunan hanya di mulut pejabat saja,” kata Indah, wargaLingkunganII,Kel.SeiMati, menunjuk jalan dimaksud. Selain itu, tanggul atau benteng sepanjang bibir pantai laut Belawan yang rusak. Hingga kini

belum juga terbangun. Padahal masalah itu dirasa mendesak bagi warga untuk mencegah luapan air pasang yang volumenya meningkat belakangan. “Memang sudah ada tanggul di Kel. Belawan I dan Kel. Nelayan Indah, tapi belum memadai. Kenapa tidak dibuat seperti di negara Belanda saja,” ungkap Wakil Sekretaris Himpunan Nelayan Seluruh Indonesian (HNSI) Kota Medan AwalYatim. Yatim yang bermukim di Kel. Bagan Deli itu meminta penambahan sekolah kejuruan negeri, terutama sekolah kejuruan bidang kelautan yang hanya satu unit di Kel. Nelayan Indah. “Umumnya warga Belawan sebagai nelayan, jika sekolah itu ada maka ke depan SDM generasi nelayan akan lebih baik,” bebernya. Sementara Ketua Presedium Masyarakat Medan Utara (PMMU) Syaharuddin berpendapat berbeda. Medan Utara akan maju jika arah pembangunannya jelas dan sesuai dengan kebutuhan masyarakat. Selama ini, kata Syaharuddin, Pemko kurang menerapkan pembangunan tepat guna sebagaimana yang dihasilkan dalam Musrenbang. “Itu sebabnya banyak bangunan mubazir seperti pasar, dermaga, tempat pelelangan ikan (TPI) di Kelurahan Nelayan Indah, Kecamatan Medan Labuhan serta yang

lainnya,” bebernya. Pasar tradisional yang merupakan pusat pergerakan ekonomi masyarakat menengah ke bawah, dirasa juga masih belum mendapat sentuhan dari Pemko. Misalnya, Pasar Marelan dan Kapuas Belawan. Kedua pasar itu sumpek dan kurang nyaman karena tidak dikelola secara profesional. “Pasar Marelan ini bisa dija-

dikan pasar induk untuk menampung petani yang menjual hasil pertaniannya di sini,” kata Ketua LPM Kel. Rengas Pulau M Ali Arifin. Kecamatan Medan Labuhan yang merupakan kecamatan termiskin di Medan Utara, bisa mengejar ketertinggalannya jika pembangunan jalan lingkar sepanjang 3.000 meter yang menghubungkan Kel. Be-

sar dan Kel. Sei Mati, terlaksana. Kedua daerah itu terisolir akibat jalan yang menghubungkan kedua daerah itu sangat memprihatinkan. “Jika jalan itu dibangun maka pengusaha akan datang yang berujung pada peningkatan ekonomi warga dengan sendirinya,” ucap Muslim, mantan Camat Medan Labuhan. * Rustam Effendi

Waspada/Rustam Effendi

JALAN RUSAK: Warga melintasi Jalan Tunda Lingkungan II, Kel. Sei Mati, Medan Labuhan yang sering tergenang air pasang (rob), Minggu (23/1).


FLY OVER TERKELUPAS : Pondasi Jembatan Layang (Fly Over) Brayan Medan tampak terkelupas akibat kebakaran yang menghanguskan ratusan kios di lokasi tersebut beberapa waktu lalu. Foto diambil Senin (24/1).

Korban Kebakaran Brayan

Sudah Bayar Rp50 Juta, Pengelola Tidak Bertanggung Jawab RINTIHAN pedagang belum juga meluluhkan hati pemerintah untuk mengasihani mereka, padahal kerugian telah mereka alami hingga ratusan juta. Mereka tak kuasa menahan beban yang harus ditanggung untuk menghidupi keluarga. Jika pun Pasar Brayan dibuka kembali, entah darimana lagi akan mencari modal berjualan. Inilah ratapan pedagang pasar Brayan yang tidak terbendung lagi. Iwan, 38, pemilik kios sandal yang bermodalkan ratusan juta, kini harus menerima kenyataan pahit. Usahanya sudah terhenti tidak bisa dilanjutkan kembali karena kerugian yang sangat besar. Padahal dia dan istrinya menggantungkan masa depan anak-anak mereka dari hasil berdagang. “Saya dan istri hanya punya usaha berjualan ini, sebagai mata pencarian. Kami kebingungan untuk meneruskan hidup dan biaya sekolah anak-anak. Istri saya jadi murung dan masih sedih tidak bisa menerima kenyataan ini, tapi kami tidak trauma dan akan mencari modal untuk membuka usaha lagi,” ungkapnya kepada Waspada. Kesedihan yang sama dirasakan Winda, 25, pedagang pakaian yang berjualan di kolong Fly Over yang mengalami kerugian berkisar Rp50 juta. Padahal, dia baru saja membayar uang sewa kios pertahun kepada Koperasi “Firman”, sebagai pengelola pasar di kolong Fly Over. Namun tidak ada ganti rugi atau pengembalian uang sewa karena terjadinya kebakaran ini. “Kami hancur-hancuran cari uang untuk melanjutkan hidup karena sudah kena musibah. Kalau begini saya jadi trauma membuka usaha besar lagi,” ujarnya sambil menatap ke

arah kolong Fly Over yang sudah hitam pekat akibat kebakaran itu. Bercak hitam dan beton yang terkelupas selalu mengingatkan warga dan pedagang tentang peristiwa kebakaran Selasa (18/1) malam itu. Winda menambahkan, sudah 2 tahun lebih dia menjadi pedagang dan sudah terbiasa mengelola uang puluhan juta. Pasca mengalami kerugian ibu yang sedang hamil anak kedua ini terpaksa membuka usaha kecil-kecilan berdagang semangka yang hanya mendapat keuntungan lima ribuan perharinya. “Uang saya hanya bisa buka usaha ini. Belum ada bantuan yang kami dapatkan untuk meringankan beban yang amat rumit untuk dilewati,” ujarnya kemudian ditimpali oleh ibunya, “Pedagang baju turun kasta jadi jual semangka,” ungkap ibunya yang disambut senyuman penuh keikhlasan dari Winda. Winda menuturkan tidak mau lagi berjualan di bawah Fly Over. Melihat bercak hitam yang menempel di kolong jembatan itu, membuat trauma. Takutnya rapuh dan retak, tiba-tiba roboh mengena pedagang dan pembeli. “Bisa-bisa kami mengantar maut yang kedua. Saya sudah trauma,” ungkapnya. Memang jika dipikirkan dan melihat kondisi para pedagang yang banyak stres karena mengalami kerugian, tidak dipungkiri akan memberikan dampak besar pada gangguan emosi dan kejiwaan mereka, apalagi belum mendapat dukungan dan bantuan. Memikirkan biaya sekolah anak, makan anak, perubahan yang drastis akan mereka alami. “Alhamdulillah saya terima kenyataan ini agar tidak mengganggu kehamilan saya,” demikian Winda. * Silfa Humairah

Kasus RS Methodist

PN Diminta Tolak Gugatan Balik MEDAN (Waspada): Tim Kuasa Hukum Ketua Majelis Gereja Methodist Indonesia (GMI) Jemaat Gloria Jalan MT Hariono Binson Logis meminta kepada Pengadilan Negeri (PN) Medan untuk menolak gugatan balik yang diajukan pihak Yayasan RS Methodist. Pasalnya, gugatan balik yang dilayangkan pihak RS Methodist diduga adalah perbuatan melawan hukum karena tidak layak melakukan gugatan terhadap Yayasan RS Methodist tanpa alasan yang kuat. Kuasa Hukum GMI Jemaat Gloria Pinta Nelly Sihite kepada wartawan, kemarin, di PN Medan mengatakan, dalam persidangan sebelumnya di hadapan majelis hakim diketuai E Pasaribu telah menyampaikan agar PN Medan menolak seluruh permohonan gugatan balik Yayasan RS Methodist. Alasannya, apabila Yayasan RS Methodist melakukan gugat balik dengan subjek pelaku pribadi dari Ketua Majelis GMI Jemaat Gloria adalah tidak tepat dikarenakan berdasarkan domisili Binson Logis di Kompleks Cemara Hijau Sampali, Kecamatan Percut Seituan, Kabupaten Deliserdang, yang merupakan wilayah daerah hukum PN Lubukpakam. “Sebaliknya apabila yang dipersoalkan atau digugat balik adalah objek yaitu kepemilikan Rumah Sakit Methodist dalam perkara Nomor 461/Pdt.G/PN.Mdn itu Ketua Majelis GMI Jemaat Gloria sebagai penggugat, maka PN Medan kami minta menolak gugatan balik karena perkara Nomor 461/Pdt.G/PN.Mdn belum

memiliki hukum tetap,” kata Pinta Nelly Sihite. Didampingi rekannya Herry Tobing SH, Pinta Nelly Sihite menjelaskan mdalam perkara Nomor 461/Pdt.G/PN.Mdn menggugatYayasan RS Methodist karena berupaya mengembalikan RS Methodist sebagai asset GMI Jemaat Gloria, dikarenakan pengurus RS Methodist tidak pernah memberikan laporan kepada GMI Jemaat Gloria . “Dalam perkara Nomor 461/Pdt.G/PN.Mdn, Ketua Majelis GMI Jemaat Gloria merupakan perwakilan dari 31 majelis GMI Jemaat Gloria. Disamping itu, pada disiplin GMI yang berlaku di seluruh Indonesia tahun 2005 pada Pasal 48 ayat 8 telah membenarkan dan menegaskan bahwa untuk atas nama GMI, Ketua Majelis GMI Jemaat Gloria diberi wewenang untuk mengambil tindakan untuk mengembalikan asser GM Gloria termasuk RS Methodist Jalan Thamrin,” kata Pinta Nelly Sihite. Herry Tobing SH menambahkan sesuai dengan prosedur hukum berlaku, surat kuasa diberikan diberikan kepada pimpinan jemaat atau majelis GMI Gloria dan surat kuasa khusus ditandatangani oleh ketua Dewan Bishop atau Pimpinan GMI. Seperti diberitakan sebelumnya, pihak Yayasan RS Methodis mengajukan gugatan balik kepada Ketua Majelis GMI Jemaat Gloria ke PN Medan dengan permohonan gugatan Nomor225/Pdt.G/2010/PN Medan dengan alasan Ketua Majelis GMI Jemaat Gloria tidak berhak melakukan gugatan. (m49)

1.649 Lulusan USU Diwisuda MEDAN (Waspada): Rektor Universitas Sumatera Utara, Prof Syahril Pasaribu mewisuda sebanyak 1.649 wisudawan yang telah merampungkan pendidikannya di perguruan tinggi tersebut antara Oktober 2010 - Januari 2011. Prof. Syahril Pasaribu mengatakan, sebanyak 1.649 lulusan yang diwisuda tersebut terdiri dari 122 orang lulusan Program Pascasarjana, 44 orang Program Pendidikan Spesialis, 7 orang program Doktor Jenjang Magister, 84 orang Program Pendidikan Profesi, 1.258 orang dari Program Sarjana dan 132 orang Program Diploma. “Dengan demikian, sejak didirikan sampai ini USU telah meluluskan 123.097 wisudawan dari berbagai jenjang, baik Pascasarjana, Sarjana maupun Diploma. Mereka telah mengabdikan ilmunya di masyarakat baik di lembaga pemerintah maupun swasta,” kata Syahril Pasaribu dalam acara wisuda tersebut. Di antara para wisudawan yang menonjol prestasinya sebanyak 425 orang yang dapat menyelesaikan Program Magister kurang dari tiga tahun, Program Sarjana kurang dari enam tahun serta kurang dari empat tahun untuk Program Diploma. Pada kesempatan itu, Rektor USU mengharapkan kepada para wisudawan agar tetap mengingat almamater yang telah mendidik mereka selama duduk di bangku kuliah. “Jangan terlalu cepat merasa puas atas apa yang telah diperoleh hari ini. Teruslah bekerja keras dan bila memungkinkan tingkatkan kualifikasi pendidikan ke jenjang yang lebih tinggi lagi,” katanya.

Bantuan pendidikan Pada kesempatan itu, Rektor USU mengatakan, di tengah rutinitas dan eskalasi kesibukan dalam menjalankan tiga pilar utama pendidikan tinggi yaitu, pengajaran, penelitian dan pengabdian pada masyarakat, USU tetap memiliki komitmen dan perhatian di dalam melakukan pembinaan mahasiswa. Mulai dari proses akademik hingga persoalan kelanjutan studi mahasiswa yang secara khusus berkaitan dengan biaya pendidikan tetap dianggap sebagai masalah penting. “Kami menyadari bahwa mahasiswa yang akan dan sedang dalam proses pendidikan di USU berasal dari latar belakang yang berbeda. Untuk itulah diperlukan bantuan biaya pendidikan atau beasiswa yang merupakan capaian skala prioritas bagi pengembangan dan kelancaran proses pendidikan di USU,” tambahnya. Berkenaan dengan bantuan biaya pendidikan, USU pada tahun 2010 lalu telah menyalurkan kuota beasiswa kepada sebanyak 5.611 mahasiswa reguler jenjang S1 dan D3 yang tersebar pada 13 fakultas. Beasiswa yang telah disalurkan tersebut berasal dari 17 instansi dan perusahaan baik pemerintah maupun swasta, dengan jenis dan besar bantuan bervariasi antara Rp1,2 juta hingga Rp10 juta pertahunnya. “Kita berharap agar ke depan jumlah bantuan biaya pendidikan ini baik dari segi kuantitas maupun besarannya dapat lebih meningkat lagi,” paparnya. (m41)

Medan Metropolitan

WASPADA Selasa 25 Januari 2011


Jalur Khusus Segera Dibongkar Jln Gajah Mada Dan Jln. Gatot Subroto Jadi Satu Arah MEDAN (Waspada): Setelah menjadi polemik berkepanjangan, akhirnya Pemerintah Kota (Pemko) Medan mengambil sikap tegas soal keberadaan jalur khusus di sejumlah sekolah. Dipastikan jalur khusus tersebut segera dibongkar dalam waktu dekat karena sangat mengganggu kelancaran lalu lintas. Demikian dikatakan Kepala Bidang Lalin di Dishub Medan Edward Pakpahan dalam Rapat Forum Lalu Lintas di ruang rapat satu Kantor Balai Kota Medan, Senin (24/1). Rapat ini turut dihadiri Wakil Walikota Medan Dzulmi Eldin, Dir Lantas Poldasu Kombes Pol Bambang Sukamto, Kadishub Dearmando Purba, Kasat Lantas Polresta Medan Kompol M Arif, Kepala Satpol PP Musaddad, Kadis

TRTB Qamarul Fattah serta sejumlah camat. Menurut Edward, Dishub telah menjadwalkan pembongkaran jalur khusus antar jemput anak sekolah di Jln. Perintis Kemerdekaan depan Sekolah Metodhist dan Jln Thamrin depan Sekolah Sutomo. Sebab, kedua jalur khusus yang semula bertujuan untuk mengatasi kemacetan lalu lintas, justru berubah menjadi lokasi parkir

Kanit Reskrim Polsekta Medan Baru Dicopot MEDAN (Waspada): Kapolresta Medan Kombes Pol Tagam Sinaga mencopot jabatan Kanit Reskrim Polsekta Medan Baru dari AKP Muchdi Hasibuan, SH karena kinerjanya kurang baik. Selanjutnya Muchdi Hasibuan menduduki jabatan baru di Mapolresta Medan. “Kinerja AKP Muchdi Hasibuan selaku Kanit Reskrim Polsekta Medan Baru kurang baik, maka yang bersangkutan di copot,” ungkap Kombes Tagam Sinaga, kemarin. Sementara itu, Kapolsekta Medan Baru Kompol Saptono, SH,SIK mengatakan, belum mengetahui seputar pemindahan AKP Muchdi Hasibuan untuk menduduki jabatan di Mapolresta Medan. “Tapi, kata Kapolresta Medan, kerja yang bersangkutan kurang baik,” ujarnya. Sedangkan Kasi Propam Polresta Medan AKP Subeno mengatakan, pemindahan AKP Muchdi Hasibuan terkait adanya pengaduan seorang tahanan wanita Polsekta Medan Baru ke Propam Poldasu. “Terkait pengaduan tahanan itu, kalau kasusnya pidana, pasti masalah ini dilimpahkan ke Polresta Medan. Permasalahannya pasti kita usut sampai tuntas,” tegas Subeno. Pasca pencopotan AKP Muchdi Hasibuan, kini Kanit Reskrim Polsekta Medan Baru dijabat Iptu AktaWijaya SH, yang sebelumnya sebagai Panit II. Sedangkan Ipda Alexander, SH, tetap menjabat Panit I Reskrim Polsekta Medan Baru. Info yang beredar di Mapolsekta Medan Baru, pencopotan AKP Muchdi Hasibuan diduga terlibat kasus tidak senonoh terhadap tahanan wanita tersebut. Wanita itu berinisial R ditangkap dan ditahan karena terlibat sebagai penadah barang curian. Penahanan wanita itu sempat ditangguhkan tetapi berkasnya lanjut ke JPU. (m36/m39)

Tersangka Dilepas Polisi, Korban Cabul Mengadu Ke KPAID MEDAN (Waspada): Korban pencabulan NS, 16, warga Dusun II Desa Limo Manis Tanjung Morawa Kab. Deliserdang mengadukan FN, 27, ke Komisi Perlindungan Anak Indonesia Daerah (KPAID) Sumut, Senin (24/1). Korban yang datang bersama ibunya Susminah, 38, mengaku tiga kali dicabuli di tempat yang berbeda oleh FN mengaku-ngaku oknum TNI dan juga PNS. Dalam hal ini, pihak keluarga korban pernah mengadukan kasus anaknya ini ke Polres Deli Serdang. Namun, berdasarkan pengakuan Susminah, tersangka masih bebas berkeliaran. “Laporan memang diterima, tapi karena polisi menilai bukti tidak kuat, tersangka dilepaskan,” jelas Susminah yang menduga kalau pelaku sudah menyogok polisi. Susminah mengakui dirinya mengetahui kalau anaknya NS dan FN berpacaran. Tetapi, karena NS masih di bawah umur dan FN juga tidak bertanggungjawab karena sudah mencabuli korban, pihak keluarga membuat laporan ke Polres Deliserdang. “Kami tahu NS tidak perawan, karena si FN ini pernah keceplosan ngomong sama kakak ipar si korban kalau si NS tidak perawan lagi. Setelah kami bawa visum, ternyata benar kalau si NS sudah tidak perawan lagi,” terangnya yang mengaku sejak kasus ini, NS enggan ke sekolah karena malu. Ketua KPAID Zahrin Piliang mengatakan, siap mendampingi pihak keluarga untuk kembali menanyakan ke Polres Delierdang tentang kasus ini. Karena menurut informasi dari keluarga Polres Deliserdang tidak melakukan penahanan terhadap tersangka dengan alasan kurangnya saksi. “Kami juga sudah meminta atau membujuk si korban untuk kembali melanjutkan sekolahnya dan ternyata korban mau melanjutkan dengan syarat tidak sekolah itu lagi.” (h02)

Karyawati Bank Dirampok MEDAN (Waspada): Seorang karyawati Bank DBS Bagian Kredit, Indah, dirampok dua pria mengendarai sepedamotor saat melintas di Jalan Gatot Subroto Medan. “Dalam peristiwa itu, saya menderita kerugian tas berisikan 10 lembar Kartu Tanda Penduduk (KTP) milik nasabah warga Medan dan Deliserdang, uang Rp800 ribu serta surat berharga lainnya,” kata Indah kepada Waspada di Mapolsekta Medan Baru, Senin (24/1) sore. Menurut korban, perampokan itu terjadi, Minggu (23/1), ketika dirinya mengendarai sepedamotor untuk mencari nasabah melintas di Jalan Gatot Subroto. Tas yang disandang korban tibatiba ditarik dan dilarikan dua perampok yang juga mengendarai sepeda motor. Dalam kasus ini, polisi masih melakukan penyelidikan dan memburon pelaku perampokan tersebut. Sementara itu, Polsekta Medan Baru juga menangani kasus penganiayaan yang dialami korban Peter Dugas Bartje S, 19, mahasiswa Methodist yang dilakukan sekelompok pria di Jalan Kartini Medan. Peristiwa itu terjadi, Kamis (20/1) pukul 17:30, berawal saat korban penduduk Jalan Pales IX, LingkunganVII Simpang Selayang, Kecamatan Medan Tuntungan, bersama temannya pulang kuliah. Ketika melintas di Jalan Kartini, korban dan temannya dihadang kelompok TT Cs dan langsung melakukan pemukulan terhadap korban. Selanjutnya para pelaku TT Cs membawa korban dengan mengendarai sepedamotor ke kawasan Sekolah Immanuel di Jalan Sudirman Medan. Sedangkan teman korban melihat kejadian itu tidak bisa berbuat apa-apa. Petugas Brimob Poldasu yang sedang melintas di lokasi langsung mengamankan korban dengan membawanya ke kantor Satpam Immanuel, karena sebelumnya ada terjadi tawuran di kawasan tersebut. Saat diinterogasi ternyata korban tidak terlibat kasus tawuran dan dilepas. Selanjutnya korban membuat pengaduan ke Polsekta Medan Baru dalam kasus penganiayaan yang dialami. Dalam kasus tersebut, polisi telah melakukan pemeriksaan terhadap korban dan saksi. (m36)

mobil penjemput anak sekolah hingga empat lapis. Dukungan terhadap pembongkaran jalur khusus antar jemput anak sekolah tersebut juga disampaikan Wakil Walikota Medan Dzulmi Eldin. Selain untuk mengatasi kemacetan, Eldin tidak menginginkan jalur khusus tersebut dijadikan lokasi parkir hingga empat lapis sehingga menimbulkan kesan sekolah Methodist dan Sutomo mendapat perlakuan istimewa. “Saya minta jalur khusus itu segera di bongkar. Kita harus serius menangani masalah kemacetan, tidak ada yang mendapat perlakuan istimewa,” tegasnya. Eldin juga menyarankan pihak Disbuh Medan agar mengkaji lebih dalam sebelum melakukan rekayasa lalu lintas di Jln Gatot Subroto dan Jln Gajah Mada. Hal itu perlu dilakukan agar rekayasa yang dilakukan benar-benar bisa mengurangitingkatkemacetanyangada. Sebelumnya, Edward juga memaparkan tentang manajemen dan rekayasa lalu lintas di Jln Gatot Subroto serta Jln Gajah Mada. Kedua jalan tersebut akan diubah menjadi satu arah serta perluasan kawasan pembatasan truk yang melebihi tonase. Saat ini, lanjut Edward, rekayasa lalu lintas yang telah dilakukan di tujuh lokasi seputaran Lapangan Merdeka mulai menunjukkan hasil yang baik. Namun masih banyak yang harus dibenahi seperti pelebaran jalan dan penertiban pedagang kaki lima (PKL) di Jln Putri Hijau. Kemudian, penertiban parkir di depan stasiun kereta api dan di Jln Hindu, Jln. Perdana serta Jln Pengadilan.

“Saat ini tingkat kemacetan semakin berkurang setelah beroperasinya Jembatan Sudirman. Sebelum jembatan beroperasi, volume kenderaan selama ini membebani Jln S Parman, Jln Kejaksaan dan Jln Pengadilan. Setelah pengoperasian jembatan, arus lalu lintas kembali lancar,” ungkapnya. Terkait rencana penanganan manajemen dan rekayasa lalu lintas, tambah Edward, Jln Gatot Subroto mulai persimpangan Jln Kapten Muslim hingga Bundaran Majestik akan menjadi satu arah menuju pusat kota (dari Barat ke Timur). Kemudian, Jln Gajah Mada dan Jln Sei Batang Hari mulai persimpangan Jln S. Parman hingga persimpangan Jln Sunggal akan menjadi satu arah menuju keluar kota (dari Timur ke Barat). Lalu, Jln Iskandar Muda mulai persimpangan Jln Gajah Mada hingga persimpangan Jln Gatot Subroto akan menjadi satu arah menuju pusat kota (dari Selatan ke Utara). Jln S. Parman mulai persimpangan Jln Gajah Mada hingga persimpangan Jln Gatot Subroto (Tugu Guru Patimpus) menjadi satu arah keluar kota (dari Utara ke Selatan). Guna mendukung perubahan itu, akses penghubung antara Jln Gatot Subroto, Jln Gajah Mada dan Jln Sei Batang Hari tetap diberlakukan dua arah. Sedangkan langkah terakhir, Dishub akan memperluas kawasan pembatasan truk melebihi tonase meliputi Jln Letda Sujono-Jln Mandala By Pass-Jln Menteng VII-Jln KH A Rivai-Jln A Manaf Lubis-Jln Sisingamangaraja-Jln AH Nasution-Jln Ngumban Surbakti-Jln Merak

Jingga dan beberapa ruas jalan lainnya. Seluruh truk yang melebihi tonase dilarang melintas di ruas jalan tersebut, kecuali mulai pukul 21:00 hingga 05:00. Untuk pembatasan tonase truk ini, Dishub telah menyiapkan satu unit mobil jembatan timbang portable. “Pengoperasian mobil ini untuk memeriksa tonase truk yang akan melalui jalan itu. Mobil ini akan kita tempatkan di pintu masuk Kota Medan. Mobil ini bisa juga dioperasikan di inti kota guna memantau truk yang masuk,” tambah Dearmando. Rencana ini mendapat dukungan penuh dari Dir Lantas Poldasu Kombes Pol Bambang Sukamto. Agar rencana tersebut berjalan efektif, Dir Lantas menyarankan dilakukan perluasan ruas jalan. Kemudian, ruas jalan tersebut harus dikembalikan fungsinya sebagai tempat aktivitas berjalan. Semua kegiatan di luar itu harus ditertibkan seperti parkir semrawut dan pedagang kaki lima. Setelah itu, Dir Lantas mengusulkan dilakukan penataan terhadap angkutan massal dan harus disesuaikan dengan sarana serta prasarana jalan. “Seharusnya angkutan kota itu hanya bis dan taksi saja. Ke depan, kita minta izin becak bermotor tidak diperpanjang lagi,” sarannya. Dir Lantas juga menyampaikan keprihatinan Kapoldasu seputar kesemrawutan lalu lintas di kawasan bundaran Bandara Polonia. Untuk mengatasinya, apakah perlu dibangun traffic light dan melakukan koordinasi dengan pihak Bandara Polonia. “Kita minta kesemrawutan itu segera diatasi,” demikian Dir Lantas. (m50)

Waspadai Masyarakat Pura-pura Miskin MEDAN (Waspada): Tantangan yang dihadapi Pemko Medan terutama Dinas Kesehatan dimasa mendatang semakin komplek seiring besarnya tuntutan masyarakat akan pelayanan kesehatan berkualitas. Di samping itu, program Jaminan Pemeliharaan Kesehatan Medan Sehat (JPKMS) yang telah dijalankan, masih menemui berbagai kendala. “Kita harus mewaspadai adanya masyarakat yang purapura miskin guna mendapatkan fasilitas berobat gratis melalui program JPKMS,” tegas Wakil Walikota Medan Drs. Dzulmi Eldin ketika membuka rapat kordinasi (rakor) Dinas Kesehatan di aula instansi tersebut, Senin (24/1). Karenanya, lanjut Eldin, Pemko Medan memberi dukungan penuh kepada Dinas Kesehatan yang melakukan pemutakhiran data peserta JPKMS. Dengan demikian, tidak ada lagi masyarakat miskin yang tidak mendapat fasilitas berobat gratis melalui program JPKMS. Selain itu, Eldin mengingatkan tentang peran Puskesmas dan Puskesmas Pembantu sebagai ujung tombak pelayanan kesehatan diharapkan mampu menyikapi tuntutan masya-

rakat. “Saat ini, banyak perubahan ke arah lebih baik yang dirasakan masyarakat terutama di sektor kesehatan. Diharapkan, prestasi ini dapat lebih ditingkatkan,” tambahnya. Sebelumnya, Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc mengatakan, rapat kordinasi diikuti seluruh kepala Puskesmas dan Puskesmas Pembantu ini menindaklanjuti program penanggulangan demam berdarah dengue (DBD) yang telah dicanangkanWalikota Drs. H. Rahudman Harahap, MM bertepatan dengan Hari Ulang Tahun (HUT ) ke-64 Harian Waspada. Menurut Edwin, program penanggulangan DBD tersebut akan meraih hasil maksimal jika melibatkan instansi lintas sektor dan seluruh lapisan masyarakat. Sebab, penyakit yang ditularkan melalui gigitan nyamuk aedes aegypti ini berbasis lingkungan. Karena itu, upaya pencegahan terhadappenyakitiniadalahmenjaga kebersihan lingkungan. “Dalam hal ini, Dinas Kesehatan Kota Medan akan melakukan kordinasi dengan Badan Lingkungan Hidup, Dinas Pendidikan, Dinas Kebersihan dan instansi terkait lainnya sehingga program penanggulangan DBD

tersebut membuahkan hasil sesuai yang diharapkan,” tambahnya. Mengenai kasus gizi buruk, Edwin menilai selama ini masyarakat cenderung memberi perhatian serius setelah muncul kasus tersebut. Padahal, gizi buruk dapat dicegah melalui pemeriksaan rutin ke Posyandu. Guna mengantisipasi gizi buruk, Dinas Kesehatan akan melakukan pemetaan di seluruh kelurahan. Bagi kelurahan yang dianggap rawan terhadap gizi buruk, maka harus melakukan pemantauan secara rutin. Jika ditemukan bayi dan balita yang tidak mengalami pertumbuhan secara normal atau pertambahan berat badan, maka pihak kelurahan segera melapor ke Dinas Kesehatan guna dilakukan intervensi sebagai upaya mencegah gizi buruk. Pada kesempatan itu, Edwin memaparkan tentang proses pemutakhiran data kepesertaan JPKMS. Seyogianya, pemutakhirandataberakhirpada31Desember 2010, namun masih ada beberapa kecamatan yang belum selesai membuat laporan. “Dengan adanya pemutakhiran data ini, diharapkan tidak ada lagi masyarakat yang berpura-pura miskin,” demikian Edwin.(m25)

Waspada/David Swayana

BUKA RAKOR: Wakil Walikota Medan Drs. Dzulmi Eldin (kiri) di dampingi Kadis Kesehatan Kota Medan dr. Edwin Effendi, MSc (dua dari kiri) ketika membuka rapat kordinasi Dinas Kesehatan di aula instansi tersebut, Senin (24/1).

Waspada/Surya Efendi

PADAT LALU LINTAS: Ruas Jl. Sutomo salah satu jalan di Kota Medan yang padat kendaraan lalu lintas. Foto diambil beberapa waktu lalu.

Hari Ini, Polresta Medan Periksa Saksi Ahli Kasus Aborsi MEDAN (Waspada): Menyusul dibukanya kasus aborsi yang melibatkan oknum dokter J, pihak Polresta Medan menjadwalkan pemeriksaan terhadap saksi ahli dari Ikatan Dokter Indonesia (IDI) hari ini (Selasa, 25/1). Kasus aborsi yang terungkap melalui penggerebekan di Jln. Sentosa Lama Gg. Margo ini sempat mengendap selama satu tahun karena pihak saksi dari IDI tidak pernah memenuhi panggilan polisi. Informasi yang dihimpun Waspada di lapangan, saksi ahli yang akan dimintai keterangan tersebut merupakan seorang dokter spesialis kebidanan dan kandungan. Dokter ahli ini akan memberikan pendapatnya tentang praktik aborsi yang dilakukan oleh dokter umum di salah satu rumah penduduk tersebut. “Rencananya, pemeriksaaan saksi ahli dari IDI dilakukan hari ini,” jelas Kasat Reskrim Polresta Medan Kompol Fadillah Zulkarnaen ketika dikonfirmasi Waspada, Senin (24/1). Menurut Fadillah, Polresta Medan sudah melayangkan surat panggilan ke kediaman saksi ahli. Sebab, setahun yang lalu, saksi ahli ini belum sempat memberi keterangan. “Setahun lalu, ketika polisi melayangkan surat panggilan untuk saksi ahli, pihak IDI menghunjuk yang bersangkutan. Sekarang, surat panggilan langsung ditujukan ke alamat kediaman saksi ahli,” jelasnya. Soal kemungkinan saksi ahli tidak memenuhi panggilan polisi, Fadillah mengatakan, pihaknya akan melayangkan surat panggilan lagi. Jika saksi ahli sudah memenuhi panggilan dan menyatakan kasus aborsi itu melanggar hukum, polisi segera menyusun BAP-nya guna

dikirim ke Jaksa. “Jadi kita tunggu saja hasil pemeriksaan saksi ahli,” jelas Fadillah. Sebelumnya, Ketua IDI Cabang Medan dr. Syah Mirza Warli yang dikonfirmasi Waspada via telefon, menyatakan kesiapannya mengirimkan saksi ahli dalam persidangan kasus aborsi tersebut. “Itu sudah kewajiban kita memberikan saksi ahli untuk membantu polisi. Namun kita pelajari dulu kasus ini karena kasusnya sudah lama,” tambahnya. Menurut Warli, kasus aborsi tersebut terjadi pada 2009, sebelum dirinya menjadi Ketua IDI Cabang Medan. Sementara Warli dilantik pada Maret 2010. “Itu terjadi sebelum kepengurusan kita. Karena itu kita pelajari dulu dimana masalahnya,” ujarnya. Sementara itu, sumber Waspada di salah satu institusi kesehatan menyatakan optimis kasus aborsi tersebut akan sampai ke pengadilan jika saksi ahli yang merupakan dokter spesialis kebidanan dan kandungan itu memberi kesaksian secara obyektif. Menurutnya, pihak penyidik tentu akan mempertanyakan apakah tindakan aborsi tersebut bisa dilakukan oleh seorang dokter umum? Apakah tindakan aborsi tersebut bisa dilakukan di rumah penduduk dengan peralatan medis sangat minim? Apakah tindakan aborsi bisa dilakukan tanpa alasan medis yang kuat? “Jika tindakan aborsi tersebut dilakukan di daerah terpencil, mungkin masih bisa dimaklumi. Tapi jika dilakukan di kota besar seperti Medan yang memiliki banyak ahli kebidanan dan kandungan serta rumah sakit, tentu patut dipertanyakan,” ujarnya.(m39/m25)

Gudang Pengoplosan BBM Dirazia 2 Ton Solar Diamankan BELAWAN (Waspada): Tim gabungan Polri, TNI AD/AL, Satpol PP dan Pertamina, merazia sejumlah gudang pengoplosan bahan bakar minyak (BBM) yang beroperasi di sepanjang Jalan Pelabuhan Raya atau di samping pabrik PT Smart Tbk Kel, Belawan 2, Kec. Medan Belawan, dan Jalan Yos Sudarso, Kec. Medan Labuhan, Senin (24/1). Pantauan Waspada di Gudang 74 Jalan Pelabuhan Raya, tim bersandi operasi kuda laut yang terdiri dari ratusan petugas itu secara mendadak merazia gudang tersebut. Akibatnya belasan pekerja dan oknum yang diduga membecking kegiatan ilegal itu berlarian menyelamatkan diri dari tangkapan petugas. Dari lokasi ini, petugas mengamankan pemilik gudang yang disebut-sebut bernama P Sinaga dan 10 pekerjanya beserta puluhan drum berisi ratusan ton minyak tanah, bensin, solar dan Crude Palm Oil (CPO) sebagai barang bukti. Selain itu tim juga merazia beberapa gudang pengoplosan BBM di Simpang Seruwai, Kel. Pekan Labuhan dan gudang milik Adul di kawasan Cingwan Kel. Martubung, Kec. Medan Labuhan serta di Kec. Medan Deli. Belum ada keterangan dari petugas berapa orang yang diamankan dari gudang tersebut. Namun petugas berhasil menyita puluhan drum

berisi minyak tanah, solar, bensin dan minyak hitam yang selanjutnya di boyong ke Mapoldasu untuk diproses. Sementara itu, keterangan yang dihimpun di Mapolair Sumut Jalan TM Pahlawan Belawan menyebutkan, operasi pemberantasan pencurian minyak itu merupakan target operasi (TO) Mabes Polri atas laporan Pertamina yang selama ini resah karena minyaknya sering dicuri oleh komplotan pencuri BBM teroganisir yang disinyalir dibecking oknum aparat. Razia yang dilakukan terhadap sejumlah gudang ilegal itu menarik perhatian warga yang datang mendekati lokasi. Akibatnya terjadi kemacetan dan antrian panjang kendaraan pada jalan yang berada di depan lokasi penggerebekan. Sedangkan Kabid Humas Poldasu Kombes Pol Hery Subiansauri yang dikonfirmasi Waspada mengatakan, dalam penggerebekan itu ada lima lokasi yang dirazia tim gabungan. “Dari lima lokasi itu, lima orang diamankan dan diboyong ke Poldasu,” jelasnya. Ketika ditanya barang bukti yang diamankan, juru bicara Poldasu ini mengatakan, ada 2 ton minyak solar yang dioplos diamankan di Poldasu. “Mengenai nama-nama tersangka dan perkembangan kasus ini besok saja dipaparkan,” jelasnya. (h03/m39)



Tangkap, Tindak Tegas Pelaku Penista Agama


ejumlah aksi penistaan agama Islam terjadi lagi. Kali ini dalam bentuk pengiriman paket buku dan rekaman VCD sesat ke sejumlah masjid di Kota Medan. Sebelumnya, aksi serupa juga terjadi berulang-ulang di sejumlah daerah lainnya, termasuk di Aceh. Tidak hanya ke masjid tapi juga ke rumah-rumah penduduk yang beragama Islam. Sudah barang tentu aksi penistaan agama (Islam) itu sangat menyinggung perasaan umat Islam di Sumut, sehingga para tokoh lintas agama pun mengadakan pertemuan di Hotel Garuda Plaza Medan guna mengutuk para pelakunya tanpa pilih kasih. Salah satu isi pertemuan mendadak itu mengimbau agar seluruh tokoh agama yang hadir mensosialisasikan serta mengimbau setiap jamaahnya agar jangan mudah terpengaruh dengan aksi penistaan agama yang kian marak terjadi (Headline Waspada 24/1). Kasus penistaan agama (Islam) acapkali terjadi sehingga diharapkan antisipasi dari aparat keamanan, khususnya kepolisian, guna mengusut para pelakunya, apa motifnya dengan cara menindaklanjutinya. Siapa pun pelakunya harus ditangkap dan diproses sesuai hukum yang berlaku. Hukuman berat pantas dikenakan terhadap penista agama. Tidak hanya terhadap agama Islam tapi juga bagi agama-agama lainnya. Tidak boleh menista agama atas dasar kepentingan apapun. Sebab, hak setiap orang untuk memeluk agama yang diyakininya, dan hak setiap orang pula untuk mengerjakan amalan-amalannya sesuai dengan ajaran agama yang dianutnya. Jadi, pertemuan para tokoh lintas agama di Medan kemarin pantas kita sahuti dengan positif. Artinya, jangan mudah terpancing provokasi pihak-pihak yang ingin merusak hubungan baik, toleransi antarumat beragama yang sudah tercipta demikian kondusif selama ini. Aksi penistaan agama yang terjadi saat ini dengan memasukkan buku dan VCD sesat ke masIntisari jid-masjid dapat memengaruhi keadaan Tak cukup sekadar me- dan kerukunan antarumat beragama yang sudah lama terbina di Medan, Sumut. Sengecam, tapi harus ada hingga harus dicegah bila ada pihak yang penyidikan dan sanksi berusaha merusaknya, tidak saja oleh para agama dan masyarakat, melainkan tegas agar aksi penistaan pemuka juga oleh aparat keamanan –Polri sebagai agama tidak terulang. penyidik. Imbauan agar para tokoh agama dan masyarakat jangan mudah terpengaruh dan terpancing dengan hal-hal yang bersifat provokatif dilakukan pihak-pihak tertentu kita nilai positif. Tapi, jelas tidak cukup hanya sekadar mengeluarkan imbauan semata. Harus ada upaya nyata –penyelidikan dan penyidikan— sehingga siapa pun yang berbuat harus bisa mempertanggungjawabkan perbuatannya sangat tercela itu. Umat Islam jelas sangat resah dengan manuver memasukkan buku-buku dan VCD yang isinya menista agama Islam ke dalam masjid dengan tujuan memengaruhi penganut ajaran Nabi Muhammad SAW. Sebab, perbuatan itu jelas melanggar hukum dan etika umat beragama. Oleh karena itu pelakunya harus dapat ditangkap. Tapi kalau dikirim via jasa pengiriman paket/surat aparat penyidik perlu mengungkap siapa mereka sebenarnya karena tentunya tertera alamat pengirimnya. Kalaupun alamatnya palsu, polisi bisa meminta keterangan petugas jasa pengiriman barang saat ‘’barang haram’’ itu dalam proses ‘’order’’ pengiriman ke tempat tertentu. Hemat kita, aksi-aksi penistaan agama, khususnya Islam, sudah teramat sering terjadi. Kalau selama ini sasarannya selalu di kawasan yang jauh atau terisolir dan terbelakang, banyak warganya hidup dalam kemiskinan, tapi sekarang ini pelakunya sudah semakin berani. Mereka nekat memasuki masjid-masjid dalam kota Medan dan mendatangi warga masyarakat yang hidupnya susah dalam bidang ekonomi. Hal seperti itu jelas tidak boleh dibiarkan. Sebab, umat Islam sangat tersinggung! Masalahnya, selama ini di kawasan yang banyak komunitas pemeluk Islamnya, agama mana saja dapat hidup berdampingan dengan aman, tidak merasa terganggu. Sebaliknya, jika umat Islam hidup di kawasan yang mayoritas pemeluk agama lain (non-muslim), mereka selalu mendapat perlakuan tidak adil. Tidak leluasa menjalankan ibadah, bahkan dikerdilkan. Tidak hanya di dalam negeri, terlebih lagi di luar negeri. Bahkan untuk mendirikan rumah ibadah saja dilarang. Izinnya dipersulit dengan segala macam cara dan alasan. Sehingga sulit mendapatkan rumah ibadah agama Islam di Eropa sampai saat ini, bahkan pemakaian jilbab pun dianggap bermasalah, apalagi dalam bentuk pakaian khas, seperti cadar dan burka. Mereka selalu dicurigai sebagai pengikut aliran keras, Islam fundamentalis, bahkan dicap sebagai jaringan terorisme. Tak pelak lagi, kasus penistaan agama di Kota Medan terhadap pemeluk agama Islam harus distop. Jangan sampai terulang lagi. Formula mempertemukan para tokoh lintas agama cukup tepat, tapi sejalan dengan itu harus diusut sampai tuntas siapa pelakunya dan dihukum seberat-beratnya. Jangan sampai tidak tertangkap, karena hal itu semakin menimbulkan kecurigaan kita (umat Islam) ada pihak yang sengaja merekayasa kasusnya agar tidak sampai ke pengadilan. Itu sebabnya, tidak cukup dengan statement bahwa pelakunya tak mengenal agama saja.+


Faks 061 4510025

Face Book username: smswaspada

+6285761594xxx Ass.Wr.wb.Menanggapi buku2 yg dikirim ke nazir2 mesjid di Kota Medan..dari dulu sampai kiamat..bahwasannya ‘Kaum Yahudi dan Nashrani tidak akan senang melihat kamu (umat islam) sebelum kamu mengikuti ajaran Mereka’ ...(Untukmu agamamu dan Untukku agamaku) karena mereka belum menyadari bahwasanya agama yang paling sempurna disisi Allah SWT adalah Islam +6285761131xxx Jalur Jalan khusus belok kiri tidak ada di persimpangan Traffic Light Pasar Sei Sikambing . Every day pekak telinga , dihantam frekuensi klakson roda empat yang berada dibelakang kenderaan baris depan . Pengemudinya tidak mau tau posisi dan situasi . Pengamen jalanan memaki-maki . Dan awakpun berteriak : “Wahai Petugas DisHub ,cabut sajalah Plank tanda kiri disini !” Crying of Dt.MNSejok * +6281263157xxx Gayus..! kau hancurkan tatanan berbangsa dan bernegara di tanah air mu sendiri. Gayus..! kau obok-obok kantor pajak demi kesenangan mu sendiri. Gayus..! kau obok-obok oknum di kejaksaan,kau obok-obok oknum advokat,kau obokobok oknum di kepolisian dan kau obok-obok oknum di imigrasi degan semua nya itu. +6281397005xxx “TRITURA” buat menteri perdagangan tolong turunkan harga beras, BUAT menteri hukum dan ham jika bapak tidak dapat mengusulkan HUKUM MATI para koruptor lebih baik anda mundur, buat menteri kehutanan tolong cabut ijin para petani sawit karena mereka inilah yg merusak hutan dan lingkungan, KHUSUS PARA ANGGOTA DPRD SUMUT LAPAR +6285262309xxx Komentar saya buat Bung Salim di Jl SM Raja T.Balai, tentangTONG SAMPAH yang kurang didaerah rumah Anda. Bung, indikator suatu Kota yang BERSIH (dari sampah tentunya),BUKANLAH dari banyaknyaTONG SAMPAH yg disediakan, atau tersedia, tapi degan adanya rasa kesadaran dari masyarakat itu sendiri, untuk MENCIPTAKAN KEBERSIHAN itu. Contohnya, disepanjang Jl.AsahanT.Balai, disetiap rumah, yang juga berfungsi sebagai KEDAI IKAN ASIN, telah dibuatTong sampah, namun Jalan Asahan tersebutTETAP KOTOR. Disamping ukuran lobang mulut tong sampah itu yg tdk sesuai (40x60 cm), penghuni rumah juga tidak secara benar memasukkan sampahnya kedalam tong tersebut. Jadi, menurut saya, PEMKO sudah HAMPIR BENAR kerjanya.Yaitu, adanya JADWAL melewati Jalan2 yang akan diambil/ diangkut sampahnya. Namun, perlu kembali seperti beberapa tahun yg lalu, truk sampah ygakanmengambilsampah,kembaliMEMBUNYIKANLAGU2,sebagaiTANDA/ISYARAT,bahwa ‘MOBIL SAMPAH LEWAT, SILAHKAN ANTAR SAMPAH ANDA KEMOBIL SAMPAH INI’. Inilah salah satu cara, agar masyarakat. mau dan juga tau akan KEWAJIBANNYA, utk berpartisipasi dalam hal KEBERSIHAN KOTA dan RUMAH SENDIRI. Kalau masyarakat. TIDAK MAU atau TERLAMBATmembuangsampahnyakemobilsampah,resikonya,rumahnyaakanBAUSAMPAH. INDIKATORKOTAYANGBERSIH,JUSTRUDIPEMUKIMANATAUPERKANTORANDITENGAH KOTA, TIDAK ADANYA TONG SAMPAH.

WASPADA Selasa 25 Januari 2011

Korupsi Dibicarakan KemiskinanTidak Oleh Bachtiar Hassan Miraza Jangan sampai di tengah pemberantasan korupsi rakyat semakin miskin


ikapun dikatakan bahwa telah terjadi pertumbuhan ekonomi, kemungkinan pertumbuhan itu merupakan pertumbuhan yang tidak sehat. Bagaimana mungkin pada suatu pertumbuhan ekonomi ditemukan pertambahan masyarakat miskin. Tapi inilah yang terjadi saat ini. Kita melihat banyak mobil mewah yang lalu lalang dijalan raya. Demikian juga dengan tumbuhnya rumah rumah mewah yang bernilai miliaran. Mal dan gedung bertingkat tinggi pun juga memeriahkan kehidupan ini. Perjalanan wisata ke luar negeri bukan merupakan hal yang luar biasa. Airline pun tidak ketinggalan mempromosikan kegiatan wisata luar negeri. Semuanyainitidakdapatdibantah.Begitulah keadaannyasaatini.Inilahbarangkaliyang dipakai sebagai alasan yang mengatakan telah terjadi pertumbuhan ekonomi di Indonesia. Namun demikian kita juga melihat ada anggota masyarakat yang mengkonsumsi makanan yang ia dapatkan di pembuangan sampah. Ada pula anggota masyarakat yang mengkonsumsi tiwul, banyak balita kurang gizi, banyak anak anak putus sekolah sampai suami isteri yang bunuh diri karena tidak sanggup memenuhikebutuhananakanaknya.Inipunsatu kenyataan yang kita temukan ditengah mayarakat. Dari sisi ini tentulah kita bertanya dimana pertumbuhan itu. Mengapa ini terjadi. Apakah ini yang dimaksud dengan pertumbuhan yang tidak sehat itu. Pilu hati ini melihat nasib mereka dengan kehidupan yang tak layak. Mereka pun terpaksa menerimanya dengan pasrah. Namun sampai bila dan apakah anak keturunanmerekajugaakanmenimpanasib yangsama.Semuapertanyaaninihendaknya direnungkan dengan baik, dengan lapang dada. Ini adalah sebuah kenyataan yang penyelesaiannya memerlukan keikhlasan. Apa yang ditayangkan dilayar televisi semuanya bertentangan dengan kenyataan yang ada dalam masyarakat.Tayangan di televisi hanyalah tayangan khayal yang sebenarnya tidak terjadi di masyarakat. Tak ada kemewahan itu seperti yang digambarkan oleh sinetron televisi setiap malam. Masyarakat di ninabobokan dengankehidupankhayalseolahmasyarakat negarainisudahhidupsepertiitu.Masyara-

kat yang pendidikannya rendah menelannya begitu saja dan melupakan kesengsaraan yang menimpa. Demikian juga dengan pembahasan tentang korupsi di televisi. Tayangan ini hanya membikin sakit hati masyarakat miskin. Tayangan ini menggambarkan bahwa kemakmuran mereka telah direngut oleh sekelompok kecil pelaku negara ini. Suasana menjadi panas dan arogansi pun timbul karena rakyat tidak menerima perlakuan itu. Politisi berdiskusi di televisi menyampaikan pendapatnya, menelanjangi koruptor tapi tak ada solusi menghukum dan menyelesaikan perbuatan korupsi.Diskusiinihanyalah perbuatan mubazir yang tidak berkesudahan. Diskusi berjalan terus dan rakyat miskinpun bertambah terus. Bahkan diskusi ini hanyalah cara penambah dosa politisi yang harus dipertanggung jawabkan di akhirat nanti. Rakyattidakmemerlukan diskusi politisi tapi kehidupan yang wajar. Tidak banyak, hanya kehidupan yang layak. Inilah yang harus diperjuangkan oleh politisi. Inilah tugas politisi, menekan pemerintah agar memperhatikan kehidupan masyarakat. Uraian diatas cukup dipakai sebagai alasan mengapa dikatakan pertumbuhan ekonomiadalahtidaksehat.Kitatidaktahu siapa yang menikmati pertumbuhan itu dandimanaterjadipertumbuhanitu.Yang jelas jurang kehidupan antara si kaya dan si miskin semakin dalam. Kenapa tidak ini yang dibicarakan politisi. Mengapa justru korupsi yang digembar gemborkan. Bangsa ini tidak biasa menempatkan masalah mana yang mendesak dan yang harus segera diselesaikan terlebih dahulu. Bangsa ini biasa mengerjakan apa yang diapikirkansesaat.Tidakberdasarkanskala perioritas dan berjangka panjang. Ini sebagai ciri masyarakat belum maju sebagaimana layaknya kehidupan masyarakat suku terasing. Korupsi memang harus diberantas tapi kemiskinan lebih diutamakan untuk diselesaikan. Jangan sampai

di tengah pemberantasan korupsi rakyat semakinmiskin.Ataujangansampaiterjadi ditengah pemberantasan korupsi justru korupsi itu semakin tumbuh. Bahkan si miskin pun semakin tidak mengerti karena para politisi sudah mulai membicarakan pemilu presiden tahun 2014.Tugas saat ini saja tidak terselesaikan sudah berkeinginan pula merebut kekuasaan tahun 2014. Rakyat ini seperti tidak mempunyai pelindung lagi dan harus siap dengan risiko hidup tanpa pelindung. Kalau begini keadaannya hanya Allah swt yang bisa berbicara dan mengatasi semua permasalahan. Rakyat miskin pasrah dan memulangkan kehidupannya pada Allahswt.Dilihatdarisudutkeimananbegitulah seharusnya. Tapi kita balik bertanya, untuk apa negara ini dibangun kalau tak ada pelindung yang membela kehidupan rakyatnya. Rakyat miskin terus bertambah. Jumlahnya kembali mencapai angka 31 juta orang . Ini diakui pemerintah. Jumlah ini menjadi bahan perdebatan dikalangan masyarakat karena kelompok non pemerintah memperkirakan jumlah itu lebih besar dari angka 31 juta orang. Masing masing pihak mempunyai perkiraan. Ini menyangkutpada kualitas kemiskinan itu. Pemerintah berpendapat seseorang yang bependapatan dan hidup perbulan dengan uang Rp 225.000.- keatas bukan lagi rakyat miskin. Ini kira kira Rp 7.500.-/perhari. Berdasarkan pendapatan dan pengeluaran inilah angka 31 juta itu muncul. Perkiraan kelompok non pemerintahberdasarkanangkayangdikeluarkan oleh UNDP yaitu suatu badan dibawah organisasi PBB yang mengurusi masalah pembangunan.MenurutUNDPseseorang tidak miskin jika pendapatannya telah mencapai $ 2 perhari. Ini setara dengan Rp 20.000.- perhari. Jika angka ini dipakai kemungkinan jumlah rakyat miskin Indonesia mendekati 100 juta orang. Perbedaannya sangat jauh dan kita maklum jika pemerintah memakai angka nya karena angka tersebut bersentuhan dengan kepentingan politik. Sementara angka non pemerintahberdasarkanangkakehidupan nyata. Pengertianrakyatmiskinberbedadulu dengan sekarang. Dahulu dikala negara negara dunia belum maju memang ukuran itu hanya pada pendapatan yang dipakai untuk konsumsi. Keberhasilan

pembangunan suatu negara diukur dari GDP perkapita. Kemudian diperbaharui dengan memasukan unsur pemerataan. Tapi ditengah kemajuan jaman saat ini masyarakat tidak hanya membutuhkan konsumsi makanan. Mereka juga butuh pendidikan dan kesehatan dan jenis barang yang diperlukan juga terus bertambah. Ini konsekwensi sebagai masyarakat yang terus berkembang. Hendaknyalah kita mempergunakan ukuran kemajuan masyarakat sebagai cara untuk mengukur tingkatkemiskinan..Dahuluanakkitatidak sekolahtidakapaapa.Dahulujikakitapakai cawat juga tidak apa apa. Dahulu kemana mana pergi kaki ayam juga tidak apa apa. Tapi saat ini tidaklah demikian. Oleh sebab itu ukuran kemiskinan harus dirubah setiap saat, sesuai dengan kemajuan yang dicapai.Hanyadenganpengukuranseperti iniangkakemiskinanitumenggambarkan angka yang nyata. Biasakanlah hidup sesuaidengankenyataan.Manalahmungkin masa kini manusia bisa hidup dengan Rp 7.500.- perhari. Jangan berkhayal tapi jangan pula ketinggalan jaman. Bekerjalah benar berdasarkan kenyataan dan jujur hati agar bangsa ini diselamatkan Allah swt. Dua puluh tahun lalu, ekonom dari Pakistan,MahbubUlHaq,menyampaikan pendapatnyabahwakeberhasilanpembangunan ekonomi suatu negara harus dilihat dari Indeks Pembangunan Manusia (HumanDevelopmentIndex).Indekspembangunanmanusiaterdiridaritigasisiyaitu sisipendidikan,sisikesehatandansisiGDP perkapita. Pendapat ini diterima oleh negara negara dunia dan dipakai sebagai takaran keberhasilan pembangunan suatu negara. Namun setelah dua puluh tahun badanduniaUNDPkembalimenyempurnakan pendapat ini dengan memperjelas indikator dari masing masing sisi itu. Umpamanya sisi kesehatan dilihat dari tinggi rendahtingkatkematianbayi,sisipendidikan dilihat dari lamanya seseorang mengenyam pendidikan sementara dari GDP perkapita dilihat dari standar kehidupan (living standard). UNDP dalam penerbitannya tahun 2010 menyatakan Indeks Pembangunan Manusia tidak bersifat tetap. Ia berubah dari waktu ke waktu sejalan dengan keberhasilan yang dicapai dalam kehidupan manusia.Dalamlaporanitujugadikatakan intipokokdarisuatupembangunanadalah manusia (The central objective of the HDR for the past 20 years has been to emphasize that development is primarily and fundamentally about people). Penulis adalah Pemerhati Ekonomi

Belum Bernyali Tuntaskan Persoalan Tanah Oleh Prof Dr Muhammad Yamin Lubis SH,MS,CN Hukum agraria yang diberlakukan menyelesaikan masalah di negara ini hanya satu


ika persoalan tanah dibawa ke ranah politik, sudah pasti beralamat tidak menuntaskan persoalan lagi.Tetapi hanya sekedar mengamankan agar persoalan tersebut tidak meluas dan cukup dulusampaidisitu.Dankelakjikaadayang mengingatkan akan dibuka lagi karena saat itu amannya sudah dapat dilalui sekalipun persoalan itu tidak tuntas. Oleh karena itu untuk menuntas persoalan atau permasalah tanah di masayarakat ini sebaiknya jangan dibawa ke ranah politik jika mau diselesaikan, tetapi hanya mungkinlebihtepatjikadibawakeranahhukum. Sehingga diperoleh kepastian hukum atasnya, dan bahkan dapat memenuhi keadilan serta kemanfaatnanya, karena memangitulahkerjanyahukummenyelesaikan persoalan di hidupnya manusia. Namun pihak lain tetap selalu ragu untuk menyelesaikan persoalan tanah akan dapat diselesaikan oleh hukum pertanahan itu sendiri. Ini mungkin pasti dapat diterima sebab orang yang menyelesaikan persoalan itu bukan tahu hukum tanah pulatapihanyatahuhukumataupembicara hukum yang bukan ahli hukum. Maka pastilah hasilnya jadi tidak maksimalmenyelesaikan persoalan tanah yang timbul tersebut sebagaimana kita saksikan selama ini. Jika kita yakin seyakinyakinnya, dan tanpa ragu lagi atas persoalan tanah hanya dapat diselesaikan oleh orang yang tahu hukum tanah dan diselesaikan dengan hukum tanah. Apalagi tidak dibawa ke ranah hukum perdata semata tetapi dibawalah ke ranah hukum agraria denganmenggunakanlogikaagrariamaka pastilahpersoalanituselesai.Logikaagraria dimaksud adalah dengan menerapkan hukumagrariaberdasarkanpilosofiagraria yakni dengan memanfaatkan penggabungan logika berpikir agraria dengan agraria in action sesuai landasan berpikir kewawasan nusantaraan. Iniartinyahukumagrariayangdiberlakukan menyelesaikan masalah di negara ini hanya satu yakni yang saat ini disebut Undang- undang pokok Agraria dan peraturan-peraturan pelaksananya. Maka jika punhukumadatitumasihadadimasyarakat sebagai hukum yang mengatur pertanahannyatetaplahhukumitutundukpada hukum yang disebutkan dalam undangundang pokok Agraria ini sebagai payung dan dasar penyelesaian. Maka jika diambil saat ini beberapa persoalan tanah di Sumatera Utara ini seperti kaus tanah Alwasliayah di Helvetia, okupansi liar di eks areal PTPN dimasukkan ke ranah non hukum atau membonceng mafia hukum ataujugakeranahpoliitik—makakitatunggu saja penyelesaiannya pasti tidak tuntas dan akan membiaskan nilai keadilan akan kepemilikannya atau tenurialnya. Tanah dalam pengertian land Hukum Agraria yang mengatur tanah ini, bukan taah dalam arti tanah sebagai

material atau pembusukan batu-batuan (soilofmatreial)yangseringdiukurdengan M kubik. Bukan pula hamparan sebagai tertancapnya akar yang berpadu dengan unsur hara (yang diukur dengan M bujur sangkar, atau hektar dan luasan meter) atau Soil,tetapi tanah dalam istilah Land . Di dalamnya ada hak (right dan use of right) yang diletakkan di atas tanah.Yang dalam hukum agraria dimaksud sebagai yang ada di permukaan bumi yakni tanah yang terdapat pada kulit bumi, yang di padanya dilengketkan dengan kewenangan atau hak. Inilah yang disebutkan tanah dalam pengertian hukum agraria tersebut. Jika bertitik tolak dari sini tentu diketahuilah bahwa di dalam tanah ada urusan hak dan ada urusan peruntukan dari hak tersebut.Makajikaduluurusaninimenjadi satu yang mengurus yakni Pemerintah Pusat, maka belakangan ini sudah ada diatursebagiandariurusaninilaludiserahkan pada Pemerintah Kabupaten dan atau Kota. Namun hingga saati ini yang mengurusi hak-nya tanah tersebut menurut UUPA adalah tetap urusan Pemerintah Pusat.Tetapisebagaidariurusanperuntukan tanah itu dapat dan telah menjadi menjadi urusan Pemerintah daerah. Kewenangan ini sudah lama ada yakni sejak tahun 2003 menjadi jelas keberadaanya. Lihat dalam Keputusan Presiden no. 34 tahun 2003 tentang Kebijakan Nasional di Bidang Pertanahan. Pasal 2 (dua) tegas disebut ; Sebagian kewengan Pemerintah di bidang Pertanahan dilaksanakan oleh pemerintah Kabupaten/kota. Kewengan yang dimaksudkan antara lain:a.PemberianIzinLokasi.b.penyelenggaraanPengadaantanahuntukkepentinganpembangunan.c.Penyelesaiansengketatanahgarapann.d.Penyelesaianmasalah ganti kerugian dan santunan tanah untuk pembangunan. e. Penetapan subjek dan obyek redistribusi tanah, serta ganti kerugian tanah kelebihan maksimum dan tanah absentee. f. Penetapan dan penyelesaian masalah tanah ulayat. g. Pemanfaatan dan penyelesaian masalah tanah kosong.h.Pemberianijinmembukatanah. i.Perencanaan penggunaan tanah wilayah kabupaten/kota. Keadaaan ini sudah semakin menegaskankewenanganyangadapadadaerah, sehingga seharusnya tidak lagi membuat persoalan tanah di daerah tidak bisa diselesaikannya. Dalam hal seperti ini Pemerintah daerah harus punya nyali untuk mengambil alih urusan ini, jika persoalan tanah itu berada pada perutukan tanah terjadi di daerahnya.Seperti terjadi tumpang tindih peruntukan, peruntukannya tidak sesuai tata guna tanah dan atau RUTW/RUTK atau peruntukannya ditelantarkan. Tetapi untuk tepatnya bahwa wewenang Pemko/Pemkab ini dilaksanakan tentunyaPemerintahKabupatendanKota ini yang paling utama, Pemko/Pemkab

harus mampu mengkordinasikan bagaimana menerapkan regulasi antar instansi atau satuan perangkatnya yang memiliki permasalahantanahitu.Jikaadapersoalan tanah tersebut, barulah mengurusi teknis secara lapangan mengenai apa permasalah tanah yang muncul ini. Dan jika memang tidak ada perosoalan tanah, pemerintah daerah juga tidak perlu mengadaadakan seolah persoalan itu ada yang tidak bisa diselesaikannya untuk saat tertentu. Dengan maksud agar terus menjadi agenda yang dibiayai oleh satuan perangkat daerah dimaksud. Atatu jangan dibuatjadipersoalanproyekuntukmengurusi tanah di satuan kerjanya. Bagaimana pemerintah daerah menangani persoalan danataumenyelesaikanpermasalahtanah dimaksud?Memangtidaksemudahmembalikkan tangan. Karena ini menyangkut tanah. Mungkin bagi satuan kerja daerah ini dapat menyangkut aset, mungkin menyangkut kepemilikan dan bukti kepemilikan yang tidak tegas, mungkin menyangkutsengketatataletak,ataumungkin kekaburan penggunaan atau selama ini dilakukan pembiaran sehingga diduduki secara liar oleh pihak lain. Sekalipun begitu berat persoalannya. Itu memang masih saja sangat mudah jika kemauan semua manusia yang memiliki persoalantanahadadanmauuntukdiselesaikan dengan secara ikhlas untuk menerima diselesaikan sampai selesai tanpa ada embel-embel lain lagi di belakangnya. Makadisinilahyangdimaksudpenyelesainya dengan menggunakan logika agraria mampu menggunakan aturan yang ada tersebut. Dikatkan dengan filosofi dan hukumagrariainactionsehinggatuntaslah persoalan tanah dimaksud. Peroalan tanah harus dipetakan Untukmenyelesaikanpersoalantanah di daerah, tetap memang harus punya langkah-langkah yang terukur dan dapat dilaksanakan. Bila tidak dibuat dengan perhitungan dan sosialisasi yang baik pasti akan mengundang kecurigaan bagi pemiliknya. Artinya dapat menyelesaiakan sesaattetapimenimbulkanpersoalanbaru untuk saat tertentu selanjutnya. Sehingga pemilik tanah kurang nyaman jika Pemko akan dapat menyelesaikan persoalan tanahnya. Dia takut kehilangan haknya di atas tanah dan takut kehilangan tanahnya bila tidaksecaratepatdanbenardibuat,bahkan takut dipungut pajaknya lebih dari yang dibayar sebelumnya. Langkahnya dalam penyelesaian tanah bila hendak menggunakanhukumagrariasebagaidasarpenyelesaian. Maka harus menuruti langkahlangkah yang berbasis hukum agraria. Dimaksudkan adalah apakah akan menuntaskan persoalan hak-nya kah, persoalan letak bataskah, persoalan penggarapan liaryangterjadidiatasnyakahataupersoalan pembagian siapakah yang prioritas atas tanah sebagai objek landreformkah atau apa? Persoalan tanah itu dipetakan terlebih dahulu.Bilapetapermasalahsudahterdata danmakaperludilihatsecarasosialapakah eskalasi pengaruhnya dalam kehidupan

ekonomi, sosial atau politiknya. Sehingga dengan demikian mudah diblokir dan tidaksampaimeluaskedaerahataukeranah lain baik dalam eskalasi budaya, etnis dan religiusitasnya, yang dapat mengancam persatuan dan kesatuan bangsa Untuk mudah memetakan persoalan tanah bagi daerah kabupaten/Kota, maka pelaksana lapangan harus mampu mencari tahu lewat perangkat desa atau kelurahan, perangkatadatatautetuadesayangmemangmengetahui persoalan tanah di tempat tersebut. Pemburu data atau pelaksana lapangan ini tidak bekerja atas dasar kontrak kerja tetapibekerjaatashasilataukinerja.Artinya bila sipemburu data berhasil mencari tahu dimanasajadanapasajaakarpermasalahan tanah di suatu lokasi maka sipemburu harus mampu memberi solusi alternatifnya. Dengan penemuan ini sebesar itu pulalah di bayar honor lapangannya dengan kordinasi lapangan yang terarah dan terukur tadi. Jalan keluar yang baik sampai di level ini sebaiknya para perangkat kelurahan ditraining lebih dahulu untuk mengetahui hukum agraria dan persoalan agraria itu menyangkut apa saja. Bila para perangkat desa atau kelurahan sudah mengerti persoalan maka si pencari data di sampingtidakmendapattekananmencari data di kelurahan itu lagi mereka akan mudah memasuki lapangan tanpa dicurigailagiolehrakyatdesayangmenghadapi persoalan tanahnya tersebut.

(Bersambung ke hal B 9)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Akbar Tanjung: Eskalasi politik makin tinggi - Harga beras dan cabai pun ikut tinggi * Jamwas: Persoalan korupsi jadi komoditas politik - Maklum, korupsi tetap menjadi primadona * Warga akan ganti beras dengan ubi - Kayak kembali ke jaman penjajahan


D Wak


WASPADA Selasa 25 Januari 2011


Kemitraan Pembangunan Kesehatan Saatnya menyatukan Langkah Membangun Sibolga Sebagaiputradaerah,yangdilahirkandandibesarkandikotaSibolgadansekarangberdomisili di Kota Medan, saya merasa prihatin bercampur sedih melihat ekses Pemilukada pada enam bulan yang lalu masih membekas dan terasa saat ini. Ada keluarga yang “bateges” (bhs. pesisir; tidak bertegoran) satu sama lainnya, ada yang memutuskan tali persahabatan yang selama ini sangat akrab kini menjadi saling benci. Pesta demokrasi Pemilukada sudah lama usai, pemenang Pemilukada, Drs. H.M. Syarfi (Hutauruk/ Marudut Situmorang, telah dilantik sebagai Walikota dan Wakil Walikota Sibolga periode tahun 2010-2015 oleh Gubsu H.Syamsul Arifin, SE, pada tanggal 26 Agustus 2010. Mari kita terima hasil Pemilukada dengan legowo.Pendukung yang menang jangan terus busung dada, sebaliknya pendukung yang kalah jangan terus berkecil hati, karena semuanya itu adalah kehendak Allah SWT, TuhanYang Maha Kuasa. Masih banyak tugas dan pekerjaan yang harus dikerjakan dalam upaya membangun Kota Sibolga tercinta yang berorientasi kepada peningkatan kesejahteraan rakyat dan pemberdayaan masyarakat Sibolga. Karenanya,sudah saatnya kita berpegangan tangan, bergandengan jalan dan menyatukan langkah untuk membangun Kota Sibolga, Kota yang kita cintai bersama. Kitabukanhanyasekedarmenatapmasadepan,tapimenyatukansatutekaduntukbersamasamamewujudkanpembangunanKotaSibolgayangberdampakkepadakesejahteraankehidupan rakyat dan bersatu padu melawan setiap perbuatan perbuatan korupsi yang merugikan negara dan menghancurkan kehidupan rakyat. Pantai Binasi sungguh indah Banyak dikunjungi para wisata. Mari kita satukan tekad dan langkah Membangun Kota Sibolga tercinta Rusli (Puli) Siburian Medan

Bazisdasu Supaya Transparan Diawal tahun 2011 ini Pemprovsu mulai berbenah diri khususnya dibidang Pembinaan Mental keagamaan untuk melatih menanamkan nilai-nilai ke Ikhlasan dan pengorbanan baik material maupun in material. Gagasan ber Infaq bagi PNS Pemprovsu khususnya yang ber agama Islam merupakan perbuatan yang mulia sekalipun rasanya bulan-bulan pertama agak terpaksa karena langsung dipotong melalui Bendahara/Juru bayar setempat, tapi itu hanya sebentar oleh karena tidak pernah dilakukan sejak zaman kolonial Belanda yang muaranya nanti akan terbiasa menjadi PNS yang Mukhlisin dan Muttaqin, perbuatan yang baik tidak semudah membalik telapak tangan. Melalui kolom surat pembaca menulis HarianWaspada ini kami harapkan kepada Ketua/ PengurusBazisdaSUsupayabenar-benarmenyalurkannyakepadayangberHakdanTransparan. Program Ketua Bazisda SU yang memberikan sebahagian ZIS kepada Mahasiswa S2 dan S3 menurut hukum akal tidak Patut atau tidak pada tempatnya karena mereka mahasiswa tersebut adalah orang-orang yang mampu hal ini bertentangan dengan Hukum Akal, dan akan lebih baik disalurkan kepada PNS yang mengambil S1 atau anak seorang PNS Non Eselon khususnya Gol. III baik itu anak nya SLTA maupun mahasiswa akan lebih tepat dan berhasil guna. Besaran pemotongan gaji PNS untuk ZIS yang dimulai Januari 2011 ini rasanya kurang berkeadilan dimana Gol. I dipotong Rp. 5.000,- Gol. II dpotong Rp. 10.000,- Gol. III dipotong Rp.15.000,- dan Gol.IV dipotong Rp.20.000,- sebaiknya menurut hemat kami harus diklasifikasi adalah sbb: 1. PNS Non Eselon a. Gol. I dipotong Rp. 3.000,b. Gol. II dipotong Rp. 5.000,c. Gol. III dipotong Rp. 10.000,d. Gol. IV dipotong Rp. 15.000,2, PNS Pejabat Eselon/Fungsional a. Eselon IV dipotong Rp. 15.000,b. Eselon III di potong Rp. 20.000,c. Fungsional dipotong Rp. 20.000,d. Eselon II dipotong Rp. 25.000,Untuk menguraikan besaran pemotongan kenapa PNS Non Eselon agak rendah karena penghasilannya tergantung kebaikan pemberian atasannya, tapi kalau pejabat struktural (Eselon) penghasilannya akan lebih besar dari Non Eselon terutama Tunjangan penghasilan Pegawai (TPP) dan SPPD ke Daerah. Kiranyamasukaninidapatdiakomodirsebagaibahanpertimbanganuntukmengumpulkan Bazis di Lingkungan Pemprovsu. Niat baik BapakWagubsu sebagai penggagas Pengumpulan Zis tersebut mendapat sambutan positif dikalangan PNS Pemprovsu yang akhirnya nanti akan mengikis terjadinya Korupsi dan Merk Up menuju Good Govermen. Demikian dan atas kerjasama yang baik dimuatnya tulisan ini terlebih dahulu saya ucapkan terimakasih. Hormat saya Pemerhati Bina Mental Pemprovsu Drs. Syafri Nasution MM.

“PelayananRS.HajiMengecewakan” Pada hari Selas tanggal 18 Januari 2011, berdasarkan rujukan dari dokter, orang tua saya harus di rawat inap di Rumah Sakit. Akhirnya orang tua saya memilih RS.Haji karena orang tua saya pikir RS Haji sangat sesuai dengan kebutuhan pengobatan penyakitnya. Kemudian saya mengurus persyaratan administrasi untuk rawat inap. Karena orang tua saya adalah peserta Askes pensiunan PNS Gol III maka orang tua saya hanya mendapatkan pelayanan rawat inap kelas II.Untuk mendapatkan pelayanan dan kenyamanan yang lebih baik,akhirnya saya memutuskan untuk naik kelas ke kamarVIP.Saya pun menambah biaya tambahan untuk kamarVIP.Setelah semua administrasi untuk rawat inap selesai,akhirnya jam 12.30WIB orang tua saya sudah berada di kamar.Jam demi jam berganti,saya menunggu pelayanan dari perawat untuk memeriksa dan merawat orang tua saya. Di pergantian shift kerja jam 15.00, orang tua saya sempat menanyakan ke perawat, kapan saya di infus? Perawat mengatakan,“nanti pak”! Tetapi apa yang di dapat oleh orang tua saya, sampai jam 18.30, orang tua saya belum mendapatkan perawatan apapun.Baik itu pengecekan tekanan darah,di suntik atau di infus. Padahal sudah jelas bahwa ada Surat Perintah dari dokter yang merawat di Poli RS Haji,bahwa orang tua saya harus mendapatkan pewatan segera yaitu di infus, injeksi dll. Jujur saya katakan, saya dan orang tua saya sangat kecewa sekali dengan pelayanan ini. Kalau hanya untuk dibiarkan saja di RS, orang tua saya lebih baik istirahat di rumah saja. Maksud hati ingin berobat agar penyakit orang tua saya cepat sembuh, malah kekecewaan yang didapat. Maksud hati ingin mendapatkan kenyamanan dan pelayanan yang lebih baik dengan menambah biaya ke kamarVIP tapi apa yang di dapat? Malah ketidak nyamanan yangdidapat.Sayasendirisempatberpikir,pelayananuntukkamarVIPsajasepertiini.Bagaimana pelayanandikelaslain.Mudah mudahan sajatidakterjadipelayananyanglebihburuk.Akhirnya, untuk tidak menambah sakit orang tua saya bertambah parah dan menambah kekecewaan yang mendalam, orang tua saya memutuskan untuk pulang dari RS hari itu juga. Demikian keluhan saya tentang pelayanan RS Haji Medan, semoga hal ini bisa menjadi bahan introspeksi bagi manajemen RS untuk konsisten memberikan yang terbaik buat pasien. Semoga manajemen bisa memberikan pelatihan yang berkesinambungan kepada para perawat tentang betapa pentingnya kepedulian dan pelayanan kepada pasien. Rumah Sakit bagus, tapijikatidakdidukungolehSDMyangbagusmakaRStersebutakanditinggalkanolehpasiennya. Wassalam, Erwansyah-Keluarga H.M.Basuki Rachmat Medan

Kesejahteraan Guru Memprihatinkan Kesejahteraan guru di Deli Serdang memprihatinkan sebagai contoh uang makan tidak ada, uang lebaran juga demikian. Kemudian uang sebesar Rp. 250.000,-/bulan dari dana APBN 2010 tiga bulan belum dibayarkan. Seharusnya paling lambat tanggal 31 Desember 2010 sudah cair. Mengapa hak guru ditahan-tahan? Cairkanlah hak guru tersebut, sebab uang tersebut sangat dibutuhkannya. Kemudian uang bantuan dari Gubernur Sumatera Utara sebesar Rp. 60.000,-/bulan, juga mengalami masalah, yakni enam bulan belum dicairkan melalui rekening bank lain (bukan Bank Sumut). Kesejahteraan guru tidak sesuai dengan konsep Cerdas. Demikian juga banyak guru yang hampir pensiun belum disertifikasi. Kasihan mereka. Padahal ini juga berkaitan dengan kesejahteraan guru. Dengan surat pembaca ini semoga pejabat yang menyalurkan uang terbuka hatinya. Sebab guru sangat mengharapkan dana tersebut. Guru Deli Serdang

Oleh dr Candra Syafei, SpOG Semua sektor pembangunan dalam mengeluarkan kebijakan harus berorientasi kepada kesehatan


ndonesia Sehat 2010 sudah berlalu, apakah hasilnya? Semua orang tahu hasilnya belum seperti yang diharapkan. Program yang dicanangkan Kementrian Kesehatan, mempunyai visi sangat ideal, yakni masyarakat Indonesia yang penduduknya falam lingkungan dan perilaku sehat, mampu menjangkau pelayanan kesehatan yang merata, bermutu, adil serta memiliki derajadkesehatanyangsetinggi-tingginya. Darivisitersebutada3prakondisiyang perlu dilakukan untuk mencapai derajat kesehatan yang setinggi-tingginya, yakni lingkungan sehat, perilaku sehat dan pelayanan kesehatan yang bermutu dan terjangkau oleh masyarakat. Lingkungan sehat adalah lingkungan yang kondusif untukhidupsehat.misalnya:bebaspolusi, tersedianya air bersih, sanitasi lingkungan yang memadai, perumahan dan pemukiman sehat, dan sebagainya. Perilaku sehat adalah perilaku masyarakat yang proaktif untuk memelihara dan meningkatkan kesehatannnya, mencegah resiko terjadinya penyakit, melindungi diri dari penyakit, serta berperan aktif dalam gerakan atau kegiatan–kegiatan kesehatan masyarakat. Sedangkan pelayanan kesehatan yang bermutu dan terjangkau oleh masyarakat diartikan masyarakat memperoleh pelayanan dengan mudah dari tenaga kesehatan yang profesional. Untuk mewujudkan visi Indonesia Sehattelahditetapkan 4 misi pembangunan kesehatan : a.Menggerakan pembangunan nasional berwawasan kesehatan. b.Mendorong kemandirian masyarakat untuk hidup sehat. c.Memelihara dan meningkatkan pelayanan kesehatan yang bermutu dan terjangkau. d.Memelihara dan meningkatkan kesehatan uindividu keluargadanmasyarakatbesertalingkungannya. Selanjutnyauntukmerealisasikanmisi ini jelas tidak mungkin hanya dibebankan padasektorkesehatansaja,karenamasalah kesehatan adalah merupakan dampak dari semua sektor pembangunan dalam mengeluarkan kebijakan pembangunan. Olehkarenaitusemuasektorpembangunan dalam mengeluarkan kebijakan harus berorientasi kepada kesehatan. Misalnya untuk mewujudkan misi yang pertama

(menggerakan pembangunan berwawasan kesehatan). Maka semua sektor pembangunan harus memasukan pertimbangan kesehatan dalam semua kebijakan pembangunannya (Health Public Policy). Hal ini berarti bahwa semua kegiatan sektor pembangunan. lebih-lebih yang berdampak negatif terhadap kesehatan harus berkontribusi terhadap kesehatan. Pertimbangan lain, perlu keterlibatan sektorlaindalampembangunankesehatan adalah bahwa kesehatan itu sesuatu yang kompleks, yang dipengaruhi oleh banyak faktor, yakni faktor international dan eksternal. faktor internal yang menentukan kesehatan seseorang, kelompok atau masyarakat adalah perilaku dan herediter. Sedangkan faktor eksternal adalah lingkungan, baik fisik maupun non fisik sosial budaya, ekonomi, politik dan sebagainya). Sepertitelahdisebutkandiatasbahwasanya masalah kesehatan masyarakat dalam komunitas atau negara dihasilkan oleh berbagai sektor pembangunan. Hampir semua sektor pembangunan (lingkungan fisik) seperti : industri, transportasi, pertanian, kehutanan, perdagangan, dan sebagainya mempunyai dampak terhadap kesehatan masyarakat. Sebagaimana di Sumatera Utara derajat kesehatan yang optimal akan dilihat dariunsurkualitashidupsertaunsur-unsur mortalitas dan yang mempengaruhinya, yaitu morbiditas dan status gizi.Untuk kualitas hiduo, yang digunakan sebagai indikator adalah angka harapan hidup waktu lahir. Sedangkan untuk mortalitas telah disepakati tiga indikator yaitu angka kematian bayi oper 1000 kelahiran hidup, angka kematian balita per 1000 kelahiran hidup, dan angka kematian ibu Maternal per-100.000 kelahiran hidup. Untuk morbiditasdisepakati14(empatbelasindikator) yaitu : angka acute flaccid Paralysis (AFP) padaanakusia<15tahunper-100.000anak. Angka kesembuhan penderitaTB Paru BTA +, persentase balita dengan pneumonia ditangani, persentase HIV / AIDS ditangani, Prevalensi HIV (Persentase kasus terhadap Penduduk Beresiko), persentase infeksimenularseksual(IMS)diobati,angka kesakitanDemamberdarahDengue(DBD) per 100.000 penduduk, persentase DBD

ditangani, Angka Kesakitan Malaria per 1000 penduduk, persentase penderita malariadiobati,persentasependeritakusta selesai berobat, kasus penyakit filaria ditangani, jumlah kasus dan angka kesakitan penyalit menular yang dapat dicegahdenganimunisasi,yaitupersentase kunjungan neonatus, persentase kunjungan bayi, persentase BBLR ditangani, persentase balita dengan Gizi Buruk dan persentase kecamatan bebas rawan gizi. Beban kesehatan masyarakat di Sumatera Utara tidaklah ringan selain faktor geografi yang cukup luas dengan berbagai kondisi topografi, sebaran penduduk yang melebar,denganvariasietnis,multibahasa, ragam adat istiadat, situasi iklim, adanya daerah rawan bencana, adanya variasi tingkatpendidikan,sosialekonomi,adanya daerah perbatasan serta masih adanya kawasan daerah tetinggal. Selain itu masih belum kondusifnya situasi kebijakan antara pusat dan daerah, hal ini dikarenakan dalam tahap proses pembelajaran dalam penerapan kebijakan otonomi daerah, lebih-lebih lagi perkembangan kemitraan di Sumatera Utara selama memang sudah ada tetapi masih perlu pengembangan yang lebih signifikan. Prinsip kemitraan Istilah kemitraan masih relatif baru, namun demikian dalam prakteknya di masyarakat sebenarnya adalah sudah terjadi sejak jaman dahulu kala, misalnya, sejak nenejk moyang kita telah mengenalnya dengan istilah gotong royong yang sebenarnya adalah kemitraan. Sebab, melaluikerjasamadariberbagaipihak,baik secara individual mupun kelompok, merekamembangunjalan,jembatan,balai desa, sarana pengairan, posyandu dan sebagainya. Dalam dunia bisnis, kata kemitraan seringdiartikansebagaijointventure.dalam kemitraan, masing-masing anggota atau mitra harus mengambil bagaian dan tangggung jawab terhadap pencapaian tujuan namun yang disepakati bersama. Ada 3 (tiga) kunci dalam kemitraan : a).Kerjasama antara kelompok, organisasi, individu.b).Bersama sama mencapai tujuan tertentu (yang disepakati bersama).c).saling menangggung resiko dan keuntungan. Mengingat kemitraan adalah bentuk kerjasama atau aliansi, maka setiap pihak yang terlihat didalamnya harus ada kerelaan diri untuk bekerja sama, dan melepaskan kepentingan masing-masing, kemudian membangun kepentingan

bersama. Oleh sebab itu, membangun sebuah kemitraan harus didasarkan pada hal-hal sebagai berikut: 1.Persyaratan kemitraan yang terdiri dari : a). Adanya kesamaan perhatian. b).Saling mempercayai dan saling menghormati. c).Saling menyadari pentingnya kemitraan.d).Ada kesepakatan visi, misi, tujuan dan nilai yang sama. e).berpihak padalandasanyangsama.f).Adakesedeian berkorban. 2 Landasan kemitraan yang terdiri dari : a).Saling memahami keduidukan, tugas dan fungsi masing-masing. b).saling memahami kemampuan masing-masing anggota. c).saling menhubungi. d).Saling mendekati.e).Salingterbuka.f).salingmendorong dan saling mendukung. g). Saling menghargai. 3. Prinsip-prinsip kemitraan yang terdiri dari : a). Adanya kesetaraan. b).Adanya keterbukaan. c). Ada saling menguntungkan. Tujuan kemitraan Secara implisit tujuan kemitraan dalam program kesehatan adalah untuk : 1. Meningkatkan kooordinasi 2. Meningkatkan komunikasi. 3. Meningkatkan kemampuan bersama. 4. Meningkatkan apa yang menjadi komitmen bersama. 5. Tercapainya upaya kesehatan yang efisien. Untuk mencapai tujuan-tujuan kemitraan tersebut, maka diperlukan langkah-langkahyangstrategissebagaiberikut: a. Penjajajakan. b. Penyamaan persepsi. c.Pengaturanperan.d.Komunikasiintensif. e.Melaksanakan kegiatan. g.Pemantauan dan penilaian. Dalam rangka untuk meningkatkan hasil-hasil pembangunan kesehatan masyarakatkedepanniscayadanmustahil program kesehatan akan berhasiljika tidak dilaksanakan dengan mengembangkan metode kemitraan. Untuk itu diharapkan disemua lini jajaran kesehatan baik ditingkat propinsi, kabupaten / Kota dan rumah sakit hingga puskesmas perlu dengan benar dapat melaksanakan metode kemitraandalambekerja.bagiyangbelum paham dengan kemitraan dapat melakukankonsultasidanrujukansertapelatihan. Sudah saatnya pemerintah dapat membentuk Tim Pemantau untuk menilai indikatorkemitraandalamberkerjasehingga dapat lebih mempercepat terlaksananya program kemitraan dimasa depan. Semoga! Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara

Jawab Dengan Tindakan, Pak Presiden ! Oleh Hari Murti, S. Sos

ari persfektif komunikasi politik, saya melihat bahwa kelemahan komunikasipolitikpemerintahan SBY adalah agak sempit dalam melihat komunikasi politik sebagai didominasi olehaktifitas-akifitasverbalsemata,apakah lisan atau tulis. Hal inilah yang mengakibatkan Presiden SBY sering dikritik sebagai presiden yang berwacana-wacana, normatif-normatif, high context, dan tidak mengacu kepada realita. Permintaanpresidenagartokohlintasagama mengklarifikasi tudingan mereka bahwa pemerintah telah berbohong adalah contoh paling aktual. Kalau saya penasihat komunikasi politik sang presiden, saya akan jelaskan bahwa saat ini komunikasi politik yang mengedepankan aspek verbal tidak akan memberi hasil positif bagi pihak presiden kecuali hanya menambah tingkat stres di semua pihak. Sebab, semua akan kembali terjebak pada persoalan semantik kata-kata yang berarti bersifat verbal lagi. Jika terjebak pada persoalan ini, kerugian ada di pihak presiden lagikarenakembalipresidenakandituding berwacana-wacana lagi. Justru dalam menanggapi pernyataan para tokoh agama ini, sebaiknya presiden diam secara verbal. Dalam konteks komunikasipolitik,yangharusdilancarkan presiden adalah berkomunikasi politik dengantindakan.Sayayakinpresidentahu akan hal ini. Buktinya, presiden langsung melakukan 12 instruksi tentang kasus GayusTambunan dan 4 instruksi tentang kasus Bank Century. Hanya saja, saya tidak yakin ada penasihat komunikasi politik presiden yang menekankan akan pentingnya presiden melakukan komunikasi politiknya secara dominan tindakan dalam merespon tudingan-tudingan terhadapnya. Kalau penasihat presiden cerdas dalam menyusun strategi komunikasi politik, mereka akan menekankan kepada presiden bahwa sekarang saatnya Anda beraksi nyata menindak pelaku kejahatan dan akhirnya mematahkan tudingan bahwa Anda hanya berwacana-wacana normatif. Saya tak perlu menerangkan lagi

tentang komunikasi politik nonverbal yang mampu menyampaikan pesan ribuan kali lebih efektif dan efisien untuk membuat audience mengerti. Yang saya perlu terangkan adalah bahwa arus komunikasi politik verbal antara pemerintah dengan pengritiknyasaatinisangattidakseimbang, baik dari aspek frekuensinya, aspek kredibiltasnya, maupun dari aspek sumbernya. Tampak sekali bahwa kali ini pemerintah yang seharusnya sebagai komunikatorpolitiksekarangmalahtersudut menjadi pihak yang harus menjadi pihak pendengar. Di “medan perang” komunikasipolitik,struktur formal tak banyak berperan menentukan siapa yang di posisi komunikator (pembicara) dan siapa pula yang di posisi komunikan (pendengar). Yang berperan adalah sejauh mana para“prajurit” itu mampu memengaruhi opini publik bahwa kamilah yang pantas untuk menjadi pihak yang didengar. Karena pemerintah sudah terlalu lama didengar selama ini, publik akan mencoba mendegar lawannya. Inilah yang terjadi saat ini, yaitu pengritik pemerintah tampak mendominasi arus komunikasi politik Indonesia. Saya tidak mengatakan bahwa komunikasi politik verbal pemerintah sudah mati langkah. Hanya saja perlu ada reposisi dimanakomunikasitindakanharusberada di depan untuk menjadi pembuka jalan bagi mengalirnya komunikasi verbal pemerintah setelahnya. Ini mungkin bahasa yang terlalu analogis. Maka, saya akan menggunakan bahasa yang konseptual, yaitu pemerintah harus memenuhi keinginan rakyat dengan sedikit bicara agar aksi-aksi nyatanya dalam memenuhi keinginan rakyat menjadi lebih terlihat. Komunikasi dengan tindakan dalam menjawab berbagai kritik perlu cepat dilakukan pemerintah sebelum ada anggapan bahwa pemerintah memang tidak mau

bertindak. Ini disebut dalam komunikasi politiksebagaikomunikasidengankonteks happy ending, yaitu kata-kata yang diklimaks-kan dengan tindakan nyata di saatsaat terakhir rakyat sudah akan menjatuhkan simpati kepada pihak lain. Ibarat main bola kaki, gol yang paling berkesan adalah di menit-menit terakhir, bukan ? Manajemen konteks komunikasilah yang menyebabkan orang lebih suka kepada gadis yangpelit,tetapicantikdaripadagadisyang cantik, tetapi pelit. Padahal, gadisnya ya itu-itu juga orangnya. Negara berkembang Tapi, tunggu dulu. Saya menunjukkan kurangstrategisnyapemerintahdalammemanage komunikasi politiknya dengan menggunakan komunikasi juga, yang berarti komunikasi saya juga bisa salah. Saya mengatakan agar pemerintah menjawab kritik dengan tindakan.Tapibisasajaperkataan ini diartikan bahwa saya mendorong pemerintah untukmenindakparapengritiknya.Maksudsayayang sebenarnya adalah agarpemerintahberaksi nyata mewujudkan apa yang menjadi keinginan rakyat dan pengritiknya, yaitu tegaknya rasa keadilan dan kesejahteraan di Indonesia. Di banyak negara, terutama di negara-negara berkembang, stabilitas politik banyak dipengaruhi oleh kemampuan pemerintahnya menjaga eksistensi dan kredibilitasnya sebagai komunikator utama dalam politik. Seringkali pemerintah-pemerintah di negara ini merebut dan mempertahankan posisinya sebagai komunikator itu dengan menjadikan tindakan yang tidak biasa-biasa saja sebagai caranya. Ada yang menyiapkan 1 dari 100 peti mati yang ada untuk dirinya sendiri, ada yang berani menantang kekuatan negara super power, ada juga yang mengekang kebebasan pers, dan banyak lagi. Di Indonesia, pemerintah tidak harus melakukan tindakan seluar biasa itu untuk bertahan sebagai komunikator politik yang kredibel.Tuntutanpadapemerintahmasih standar-standar saja, seperti memberantas korupsi, menciptakan kesejahteraan, lapangankerja,keadilan,menangsepakbola,


dak untuk akan dimiliki atau diguna-kan. Pemrintah daerah dapat mengajukan permohonan untuk ditetap-kan menjadi tanahHakPengelolaan(HPL)–nyaPemko/ Pemkab. Mereka yang tadinya sudah berada di atas tanah itu ditata terus oleh Pemkonya, dengan dibuat perjanjian akan diberikan kepada mereka haknya nanti di atas HPL baik dengan HGB atau Hak Pakai tau bisa Hak Milik tentu dengan memenuhi persayaratannya. Seperti jika mereka sudah 10tahunakandiberikanhaknyadandalam masa 10 tahun masyarakat yang menggarap tadi tidak boleh mengalihkannya ke pihak ketiga jika dialihkan Pemko melaranynya.

Jika terjadi juga jangan dimohonkan menjadi hak apapun dan tetap menjadi HPL Pemko/Pemkab tadi. Di sini Pemko akanterusmenjagatanahitumenjadiHPLnya dan rakyat yang tadi berada di atas tanah tadi dapat memperoleh tanah di atas HPL Pemko tersebur (versi PMNA/KBPN 9 tahun 1999). Dan Pemko/Pemkab yang punya HPL tidak putus putus lagi dari tanahnya dan tiap tahun dapat menerima uang pemasukan yang dibayar oleh pemunya hak di atas tanah HPL tersebut. Jika pemunya hak di atas HPL tidak sang-gup membayar kewajibannya Pemko ha-rus mengingatkan mereka, karena nanti haknya yang di atas HPL tidak diperpajang lagi pada saat hak Pakai atau HGBnya yang

Perlu ada reposisi di mana komunikasi tindakan harus berada di depan untuk menjadi pembuka jalan bagi mengalirnya komunikasi verbal pemerintah setelahnya


(Lanjutan dari hal B 8) Contoh yang paling jelas dalam menyelesaikan tanah garapan misalnya Pemerintah daerah cukup mendata siapa saja yang berada di atas tanah tersebut dan untuk apa mereka menduduki tanah garapan tersebut. Apakah bermaksud untuk memiliknya atau hanya bermaksud untuk menanaminya sekedar dapat bertahan hidupdiatasnya.Bilamemangkedua-duanya, lalu pemerintah gak usah melakukan pembiaran lagi atasnya. Tetapi mereka di data berapa luas tanah yang akan mereka cita-citakan atau angan-angankan atau hen-

humoris,dansebagainya.Tapikalauhanya untuk mengungkap kasus Gayus saja terlihat begitu rumit di tengah pers begitu kritis, saya khawatir pemerintah benarbenar kehilangan mekanisme utama untuk melaksanakan kekuasaannya, yaitu komunikasi yang berpengaruh. Kini, pemerintah harus sadar bahwa terus mengandalkan komunikasi politik verbal dalam menghadapi kritik tak lagi cukupuntukmengatasipersoalanketidakpuasan berbagai kalangan pada pemerintah. Sebab, arus komunikasi politik antara pemerintah versus para pengritiknya saat ini sangat tidak seimbang, baik dari sisi kuantitas maupun dari sisi dukungan dari publik. Agar seimbang, pemerintah perlu memanfaatkanefektifitaskomunikasinonverbal yang ribuan kali lebih efektif itu. Sekali saja rakyat melihat presiden bertindak keras kepada koruptor, presiden akan benar-benar menjadi komunikator politik yang andal. Para penasihat presiden pastilah tahu bahwa salahsatu tugas utama mereka adalahmembuatkomunikasipolitikpresidentetapberpengaruhluasdimatarakyatnya. Untuk itu, harus ada perobahan strategi mendasar dalam komunikasi politiknya, yaitu terlihat lebih koperatif dengan keinginan publik luas atas berbagai masalah yang dihadapi bangsa ini. Saya tahu bahwa terkadang ada risiko besar bagi republikinijikasuararakyattentanghukum dan keadilan benar-benar dilaksanakan. Hanya saja, tampaknya pemerintah tak punya pilihan lain. Sebab, republik ini akan menghadapi risiko yang jauh lebih besar jika pemerintah-pemerintahnya tidak menjadi komunikator politik utama di negeri ini. Dalam komunikasi politik, semua bisa terjadi dan malah bisa berbalik. Kalau kita ingat tentang konteks komunikasi politik happy ending itu, Gayus yang selama ini begitu dibenci bisa saja tiba-tiba berbalik menjadi “pahlawan” jika ia lebih dulu membongkar jaringan mafia pajak dibanding penegak hukum. Andai Gayus melakukan itu saat ini, ia akan menjadi komunikator politik yang sangat berpengaruh di negeri ini. kalau sudah begitu, bukankah pemerintah dan penegak hukum mendapat pesaing sangat potensial dalam komunikasi politik. Jadi, komunikasikan dengan tindakan, ‘Pak.

ada di atas HPL itu akan berakhir. Legalitas kepemilikan seperti inilah yang harus tetap dipertahankan Pemko agar dapat mengelola tanah dan masyarakat yang di atas tanah tersebut. Kelak ini akan terus menguntungkan Pemko dan masyarakat tadinya penggarap akan menjadi pemilik di atas HPL, dan jika kewajibannya tidak dipenuhinya lagi mereka tidak lagi dapat memeperpanjang haknya jika kelak dia tidak memperpanjang maka dia akan keluar dari tanah HPL tersebut karenatidaklagimemenuhisebagaisubjek haknya.

Penulis adalah Pemerhati Komunikasi Politik, Alumnus Sekolah Tinggi Ilmu Komunikasi “Pembangunan” Medan.

Penulis adalah Guru Besar Hukum Agraria FH USU, Ketua Program Magister Kenotaritan USU



WASPADA Selasa 25 Januari 2011

DPR Akan Buat Standarisasi Gaji Pejabat Negara

DPR Setuju BI Masuk IILM JAKARTA (Waspada): Komisi XI DPR RI membidangi keuangan memberikan persetujuan kepada Bank Indonesia untuk masuk keanggotaan International Islamic Liquidity Management (IILM). “Keikutsertaan BI di IILM dapat menjadi faktor penyeimbang pasar keuangan konvensional, karena selama ini yang selalu berorientasi ke negara barat. Ini penting, sebab selama ini kita orientasinya ke negara neolib terus, “kata Ketua Komisi XI DPR RI Emir Moeis pada rapat kerja dengan Gubernur BI Darmin Nasution, di Gedung DPR RI, Jakarta, Senin (24/1). Sebelumnya Gubernur BI Darmin Nasution mengatakan, IILM merupakan wadah berkumpulnya bank sentral yang memiliki perbankan syariah di negaranya. “Ini merupakan inisiatif dari 12 bank sentral dan lembaga multinasional yang bermaksud mendirikan lembaga pengelolaan likuiditas keuangan syariah internasional,”katanya di hadapan anggota Komisi XI DPR. Disebutkan yang kini menjadi anggota IILM diantaranya Iran, Malaysia, Kuwait, Luxemburg, Mauritius, Qatar, Sudan, Uni Emirat Arab, serta Islamic Development Bank (IDB). Sementara, status Indonesia masih conditional party di mana harus menunggu persetujuan DPR untuk bergabung. “Industri perbankan syariah

di Indonesia bertumbuh sangat pesat dalam 10 tahun terakhir, sementara aset perbankan syariah telah tumbuh 53 kali lipat di mana total aset per Desember 2010 mencapai Rp 100,2 triliun,”ungkapnya. Darmin menambahkan, pangsa pasar untuk Bank Syariah masih relatif rendah hanya sebesar 3,2% dari total perbankan nasional. Oleh karena itu pengelolaan likuditas keuangan secara efisien menjadi salah satu permasalahan penting. “Kita membutuhkan dana minimal untuk penyertaan modal dalam bentuk saham sebesar US$ 5 juta untuk bergabung bersama lembaga tersebut, dimana minimalnya itu 5 lembar saham yang per sahamnya dihargai US$ 1 juta,” katanya. Menurutnya, apabila BI masuk, ada beberapa manfaat yang bisa diambil, antara lain memperluas alternatif sumber pendanaan pemerintah dan memperluas investasi. BI meminta persetujuan Komisi XI DPR untuk Antara melakukan penyertaan pendanaan sebesar US$ Gubernur Bank Indonesia Darmin Nasution memberikan 5 juta guna bergabung dalam ILM. (aya) penjelasan saat rapat kerja dengan Komisi XI DPR di

Jawaban Kapolri Tak Beri Kejelasan Prospek Penanganan Mafia Pajak JAKARTA (Waspada): Anggota Komisi III DPR RI dari Fraksi Partai Amanat Nasional (FPDN) Yahdil Abdi Harahap, SH, MH menilai jawaban yang disampaikan Kepala Polri Jenderal (Pol) Timur Pradopo sama sekali tidak memberi kejelasan mengenai prospek penanganan kasus mafia pajak.


PENJELASAN KASUS GAYUS: Kapolri Jenderal Pol Timur Pradopo menyimak pertanyaan anggota Komisi III DPR saat rapat kerja di Kompleks Parlemen, Jakarta, Senin (24/1). Kapolri menjelaskan meski sejak April 2010, mantan Direktur II Ekonomi Khusus Bareskrim Mabes Polri, Brigjen Raja Erizman dan Brigjen Edmon Ilyas sudah berstatus terperiksa dalam kasus mafia pajak Gayus Tambunan tapi hingga kini keduanya belum dijatuhi hukuman disiplin Polri dengan alasan masih dalam proses pengkajian penjatuan hukuman disiplin atau kode etik profesi Polri.

“ Apa yang disampaikan Kapolri sangat normatif. Belum ada perkembangan yang berarti dalam penanganan kasus mafia pajak yang dilakukan oleh Polri,” ujar Yahdil Abdi Harahap usai rapat dengar pendapat Komisi III DPR RI dengan Kapolri di Gedung DPR RI Jakarta, Senin (24/1). Dalam rapat kerja perdananya, anggota Komisi III menagih janji-janji program 100 hari Ka-

polri. “Secara umum pelaksanaan Program 100 Hari Revitalisasi Polri berjalan lancar dengan jadwal yang telah ditetapkan dan tidak ditemukan adanya hambatan dalam pelaksanaannya,” kata Kapolri. Dikatakannya, hingga minggu ke-11 atau 78 hari melaksanakan tugas Kapolri, telah dicapai hasil yakni target pengungkapan dan penyelesaian kasus menonjol sejumlah 239 kasus dapat diselesaikan sebanyak 155 kasus (65%). Sebanyak 56 berkas perkara dikirim ke jaksa penuntut umum (JPU), 98 berkas perkara, tersangka dan barang bukti telah dilimpahkan ke JPU, dan satu kasus dihentikan karena tak cukup bukti (SP3). Timur menjelaskan, di urutan pertama tindak pidana narkoba adalah kasus yang

paling menonjol. Ada sebanyak 39 kasus dari 54 kasus yang terlesesaikan. Diikuti penyelesaian tindak pidana umum 67 kasus dari 96 kasus. Berikutnya penyelesaian tindak pidana tertentu 19 kasus dari 29 kasus. Penyelesaian kasus korupsi diurutan keempat. Sebanyak 19 kasus dari 37 kasus terselesaikan. Terakhir penyelesaian tindak pidana ekonomi sebanyak 11 kasus dari 23 kasus yang ditargetkan. Sejumlah operasi, jelas Kapolri, juga dilancarkan untuk mendukung program 100 harinya. Misalnya, operasi kewilayahan dengan sandi ‘Pekat-2010’ yang mengkhususkan pengungkapan kejahatan preman, kejahatan jalanan dan perjudian. Operasi kendali pusat dengan sandi ‘Sikat-2010’ dengan

hasil pengungkapan pelaku kejahatan yang meresahkan masyarakat dan menggunakan senjata api, senjata tajam dan bahan peledak. Operasi kewilayahan dengan sandi ‘Antik-2010’ dengan sasaran pelaku kejahatan narkoba. Operasi kendali pusat dengan sandi ‘Jaring-2010’ dengan sasaran pelaku kejahatan illegal fishing. Operasi Mandiri Kewilayahan dengan sandi ‘Peti2011’ dengan sasaran pelaku kejahatan illegal mining. Dikatakan Timur, jumlah kasus menonjol yang jadi target Mabes sebanyak 22 kasus dan Jajaran Polda 217 kasus. Sedang operasi kepolisian tersebut yang ditangani Mabes 38 kasus dan jajaran Polda 1.519 kasus. Timur mengklaim programnya telah berjalan lancar dan tanpa hambatan. (aya)

Hampir Semua Provinsi Tersandera Korupsi JAKARTA (Waspada): Hampir semua provinsi di negeri ini tersandera korupsi karena ada saja kepala daerah yang saat ini berstatus tersangka atau terdakwa. Berdasarkan catatan Kompas, hanya lima dari 33 provinsi di Indonesia yang hingga Minggu (23/1) tak ada kepala daerahnya yang terjerat perkara hukum. Temuan itu seperti membenarkan pernyataan Menteri Dalam Negeri Gamawan Fauzi, Senin lalu. Dalam rapat kerja dengan Dewan Perwakilan Daerah di Jakarta, ia menuturkan, ada 155 kepala daerah yang tersangkut masalah hukum, 17 orang di antaranya adalah gubernur. Hampir setiap pekan, seorang kepala daerah ditetapkan sebagai tersangka. Dari 17 gubernur yang dipaparkan Gamawan itu, tak semuanya kini masih menjabat. Tinggal empat gubernur yang masih menjabat dan tersangkut kasus korupsi. Mereka adalah Gubernur Bengkulu Agusrin M Najamudin (terdakwa korupsi bagi hasil Pajak Bumi dan Bangunan serta bea penerimaan hak atas tanah), Gubernur Sumatera Utara Syamsul Ariffin (terdakwa korupsi proyek pengadaan mobil pemadam kebakaran), Gubernur Kalimantan Timur Awang Faroek Ishak (tersangka korupsi dana pengelolaan dana bagi hasil penjualan saham PT Kaltim Prima Coal), dan Gubernur Kalimantan Selatan Rudy Arifin (tersangka korupsi pengembalian dan pemanfaatan lahan bekas pabrik kertas Martapura). Kini Syamsul Ariffin ditahan. Anggaran untuk golf Direktur Jenderal Keuangan Daerah Kementerian Dalam NegeriYuswandi Temenggung menuturkan, sebagian besar kepala daerah terjerat kasus korupsi yang terkait penyimpangan APBD, terutama pada pelaksanaan pengadaan barang dan jasa serta penyaluran bantuan sosial. Dalam evaluasi APBD provinsi, Kemdagri sebenarnya sering memberikan catatan terhadap anggaran yang tak sesuai dengan aturan. “Kesalahan bisa terjadi dalam pengadaan barang dan jasa yang seharusnya mengikuti Peraturan Pemerintah Nomor 54 Tahun 2010 tentang Pengadaan Barang dan Jasa. Selain itu juga pengelolaan dan pertanggungjawaban dana hibah, perjalanan dinas, dan bantuan sosial,” katanya. Awal 2011, Kemdagri sudah selesai mengevaluasi 30 APBD provinsi. Tiga APBD provinsi lainnya, yaitu Bengkulu, Papua Barat, dan Aceh, masih dalam proses evaluasi. Direktur Anggaran Daerah Kemdagri Hamdani menambahkan, provinsi dan kabupaten/kota mempunyai kewenangan keuangan daerah. Namun, ada beberapa anggaran yang diberi catatan untuk tak dianggarkan lagi di APBD. “Misalnya anggaran untuk hibah kepada persatuan golf. Apa hubungan pemerintah daerah dengan golf? Setelah ditelusuri, ternyata ketuanya gubernur atau sekretaris daerah,” ujarnya. Contoh lain, kendaraan untuk anggota DPRD tidak boleh dianggarkan dalam APBD.


HAK ANGKET PAJAK: Wakil Ketua DPR Priyo Budi Santoso (kanan) menerima berkas berisi 30 tanda tangan anggota DPR yang mengajukan hak angket yang diwakili (dari kiri) politisi PPP Ahmad Yani, politisi Partai Demokrat Soetjipo, politisi partai Golkar Nudirman Munir, dan politisi PKB Bahruddin Nashory di Kompleks Parlemen, Jakarta, Senin (24/1). Hak angket kedua yang diajukan DPR setelah skandal Bank Century itu bertujuan untuk membongkar mafia pajak sehingga penerimaan pajak negara meningkat.


PROTES SATGAS: Sejumlah aktivis membakar poster bergambar anggota Satgas Pemberantasan Mafia Hukum di depan kantor Satgas Pemberantasan Mafia Hukum, di Jakarta, Senin ( 24/1). Mereka berasal dari berbagai organisasi kemasyarakatan, menuntut pembubaran Satgas Pemberantasan Mafia Hukum, kerena sudah dijadikan sebagai alat politik penguasa.

Partai Golkar Minta Satgas PMH Dievaluasi JAKARTA (Waspada): Partai Golkar meminta satuan tugas Pemberantasan Mafia Hukum (Satgas PMH) dievaluasi karena telah memperkeruh penegakan hukum di Indonesia, bahkan satgas diminta untuk tidak mendampingi Wakil Presiden dalam memantau penyelesaian masalah Gayus Tambunan. “Perlu evaluasi total terhadap lembaga non-struktural dan ad hoc seperti Satgas PMH, sebab terbukti selama ini mengebiri lembaga hukum dan bahkan banyak mudharatnya,” kata Sekretaris Jendral Partai Golkar Idrus Marham di Gedung DPR RI, Jakarta, Jumat, (21/1). Menurutnya, Satgas juga terindikasi membuka adanya peluang bagi oknum dan atau kelompok tertentu untuk melakukan politisasi hukum yang bertentangan dengan prinsip penegakan hukum. Idrus pun mencontohkan, Ketua Umum Golkar telah menjadi korban, difitnah, didzolimi, dalam kasus mafia pajak Gayus Tambunan. “Kalau benar apa yang dikatakan Gayus Tambunan seusai vonis pengadilan, maka ketua umum kami telah difitnah dan dizolimi,” katanya. Dia menegaskan, penzoliman itu adalah skenario yang sengaja dikembangkan secara sistematis dengan tujuan membunuh karakter ketua umum

Partai Golkar demi kepentingankepentingan politik tertentu. Namun, apapun yang menimpa Ketua Umum Golkar, baik berupa intrik politik, fitnah dan pendzoliman, menurut Idrus, Partai Golkar tidak akan dendam politik sesama anak bangsa, yang pada gilirannya nanti dapat merusak rasa persatuan dan kesatuan bangsa. Terhadap sepak terjang Satgas, Golkar meminta Presiden agar meninjau keberadaan Satgas dalam mendampingi Wakil Presiden untuk memonitoring penyelesaian kasus mafia pajak Gayus Tambunan. “Penugasan Satgas PHM mendampingi Wapres, bukan saja tidak efektif, tapi juga semakin memperkeruh persoalan, dan menimbulkan masalah baru,” katanya. Pihaknya tidak langsung meminta Satgas dibubarkan, karena evaluasi total merupakan langkah awal yang diperlukan oleh Presiden. Sedangkan untuk pembubaran, itu tentu saja menjadi kebijaksanaan Presiden. Golkar juga meminta Presiden agar merevisi Inpres yang sudah dikeluarkan Presiden, terutama yang menyangkut penanganan kasus Gayus. “Kami meminta Presiden merevisi Inpres itu, dan keberadaan Satgas ditinjau dalam tim yang dipimpin wapres. Sementara itu Pengamat

Politik dari Universitas Indonesia, Bony Hargens menilai pernyataan Golkar tersebut membuktikan bahwa partai tersebut tidak berani frontal dengan presiden SBY. “Walaupun Golkar kelihatannya galak, tapi mereka realistis dan sadar bahwa tidak mungkin melawan SBY saat ini. Sebagai penguasa SBY memiliki perangkat yang bisa digunakannya untuk menghancurkan Golkar dengan cara-cara yang berlandaskan hokum sekalipun. Golkar telah menghitung kekuatan dan mereka tidak siap berhadapan dengan SBY,” jelasnya. Pernyataan bahwa Golkar telah dizolimi, namun mengimbau untuk penyelesaian yang elegan menurut Bony adalah bukti ketidakberdayaan Golkar menghadapi SBY. “Partai politik dimanapun jika memang ketua umumnya didzolimi dan kuat, akan melawan terhadap pendzoliman. Namun ini hanya bersifat sementara, jika Golkar benarbenar kuat, maka yang terjadi kemudian adalah sebaliknya, Golkar kembali akan mendzolimi SBY. Ini hanya permainan politik saja,” katanya. Ketua DPR Marzuki Alie menilai bahwa pernyataan Gayus Tambunan tentang keterlibatan Satgas PMH dan CIA merupakan upaya untuk menga-

lihkan isu. “Gayus ini cerdas, dan dia mencoba mengalihkan perhatian ke persoalan yang lain,” katanya Dia menduga, ada seseorang yang menyusun konsep tertulis yang dibacakan Gayus, sehingga dia bisa berbicara banyak pascavonis dari pengadilan.”Siapa yang mengonsep, siapa yang ngetik surat yang dibacakannya? Dia kan di pejara. Tidak mungkin dia bisa menulis surat. Dia paling hanya membaca tidak tahu kontennya, itu tidak natural,” ungkap Marzuki. Wakil Ketua DPR, Taufik Kurniawan mengatakan, sebaiknya masyarakat tidak berpandangan negatif terkait vonis tujuh tahun penjara untuk Gayus, karena proses hukumnya masih berjalan setelah Kejaksaan memutuskan untuk mengajukan banding. Menurutnya, hal yang perlu ditekankan adalah bagaimana agar kasus ini tidak berhenti sampai vonis Gayus, tetapi penegak hukum harus terus melanjutkan kasusnya dan mengungkap siapa saja yang terlibat. “Terutama pengakuan Gayus yang menyatakan selama ini kasusnya direkayasa dan dia mendapat tekanan dari Satgas PMH.Yang perlu dilakukan adalah pihak Satgas menjelaskan secara gamblang dan mengklarifikasi tudingan Gayus,” tandas Taufik. (aya)

JAKARTA (Waspada): Wakil Ketua DPR Bidang Kesra Taufik kurniawan berpendapat pernyataan Presiden Susilo Bambang Yudhoyono soal gajinya tidak naik selama tujuh tahun, bukan salam konteks mengeluh agar gajinya segera dinaikkan. Namun pernyataan SBY yang disampaikan di hadapan pimpinan TNI/ Polri, dalam rangka memastikan bahwa pemerintah serius memperhatikan kesejahteran prajurit TNI/Polri dengan memberikan remunerasi secara berkala. “Presiden bukan curhat, tapi Presiden menyampaikan hal ituuntukmemberikansemangatdanmemberikanmotivasi,”ujarTaufik Kurniawan di Gedung, DPR RI Jakarta, Senin (24/1). Untuk merespons polemik gaji Presiden yang sudah tujuh tahun tidak naik, Taufik mengatakan, dirinya sebagai unsur Pimpinan DPR menyarankan agar hal ini disikapi dengan membuat standardisasi gaji pejabat negara. Jangan sampai antarpejabat lembaga tinggi terjadi disparitas gaji. Dai mencontohkan yang terjadi sekarang ini menyangkut standardisasi di Kementerian Keuangan yang tertinggi dibandingkan dengan departemen lain, bahkan gaji Direksi BUMN yang melebih gaji presiden, begitu juga dengan Gubernur Bank Indonesia. Sementara Wakil Ketua DPR RI Pramono Anung mengaku telah mendengarkan secara seksama curhat Presiden SBY soal gaji yang sejak tujuh tahun tidak naik. Pramono pun berpendapat, pernyataan itu konteksnya presiden ingin memastikan bahwa pemerintah terus memperhatikan nasib TNI, dengan terus memberikan remunerasi. “Kebetulan saya mendengarkan secara seksama ucapan Presiden. Memang itu bisa diartikan dua hal. Pertama, pemerintah memberikan perhatian khusus terhadap remunerasi TNI/Polri. Kedua, gaji saya (presiden) saja belum naik selama 7 tahun,” ujarnya. Menurut Pramono, sebenarnya jika dalam rangka membangkitkan semangat TNI/Polri, tidak perlu mengungkapkan soal gaji. “Tapi cukup dengan membangkitkan semangat juang mereka saja,” pungkasnya. Dia pun sepakat agar segera dibuat UU untuk standardisasi gaji, tunjangan bagi pejabat pemerintahan. “Harus dibahas secara terbuka sehingga ada standardisasi khusus karena ini adalah tugas sebagai pejabat negara. (aya)

HMI Sumut Tolak Pembangunan Gedung Baru DPR RI MEDAN (Waspada): Mahasiswa termasuk Badko HMI Sumatera Utara menolak keras rencana pembangunan gedung DPR RI karena alasan yang disampaikan dewan dan Badan Anggaran Rumah Tangga dinilai tidak tepat bahkan terkesan mengada-ada. “Apa yang direncanakan pemerintah dan DPR RI untuk membangun gedung baru dengan nilai yang sangat menakjubkan, kami anggap sangat tidak beralasan,’’ papar unsur pengurus Badan Koordinasi Himpunan Mahasiswa Islam Sumatera Utara (Badko HMI Sumut) Ansor Harahap bersama pengurus lainnya kepada Waspada di Medan, Minggu (23/1). Selain alasan yang tidak tepat, kata Ansor, dinilai keputusan tersebut merupakan keputusan yang tidak bermoral. Karena di tengah penderitaan rakyat, dewan dan pemerintah membuat kebijakan yang menghabiskan anggaran negara hanya untuk fasilitas yang ditaksir belum penting. ‘’Diyakini apa yang menjadi alasan pembangunan gedung baru DPR RI untuk meningkatkan efektivitas dan kompetensi kerja sama sekali mimpi kosong bagi rakyat,’’tegas Ansor. Disebutkannya, menurut mahasiswa yang benar pembangunan gedung baru DPR RI hanya bertujuan meningkatkan kenyamanan bagi anggota dewan untuk menambah kemalasan kerja. Sementara, kemewahan yang ditampilkan menunjukkan ketidakberpihakan terhadap prioritas kepentingan rakyat. “Kita tidak yakin sama sekali peningkatan fasilitas akan meningkatkan kinerja dewan, tapi malah sebaliknya, dengan fasilitas tersebut anggota dewan akan semakin malas kerja. Sementara, dalam urusan moral, kemewahan yang ditampilkan bangunan dan fasilitas gedung baru itu menunjukkan DPR tidak bermoral di mata rakyat,” ujarnya. Terselubung Badko HMI Sumut, lanjut Ansor, menduga pembangunan gedung baru mengandung unsur korupsi terselubung, berjamaah, dan massif. Hal ini ditandai dengan anggaran yang ditetapkan tersebut mengalami pembengkakan dari yang direncanakan sebelumnya. Kemudian, katanya lagi, mahasiswa melihat dengan setujunya semua fraksi menandakan ada hal yang menguntungkan semua kepentingan partai politik atau oknum-oknum yang memainkan rencana dengan anggaran yang begitu besar. ‘’Oleh karena itu, Badko HMI Sumut menolak keras rencana pembangunangedung baru DPR RI tersebut,’’tukas Ansor. Ditambahkannya, pembangunan gedung baru DPR RI dengan nilai Rp 1,3 triliun semakin mendekati kepastian, apalagi setelah disainnya rampung sebagaimana telah ditayangkan stasiun televisi swasta, pembangunannya akan mulai awal 2011. Namun, ucap Ansor mengakhiri, sejak awal, rencana ini sudah menuai pro kontra, namun agendanya terus jalan. Kini rencana pembangunan gedung baru tersebut dipersoalkan kembali.(m34). Laporan ke: 8

DOMPET PEDULI BENCANA MENTAWAI & GUNUNG MERAPI Gempa dan Tsunami di Mentawai telah menyebabkan kedukaan yang mendalam bagi ribuan jiwa masyarakat. Meletusnya Gunung Merapi di Yogyakarta juga mengakibatkan Ratusan Ribu orang saat ini hidup didaerah pengungsian disebabkan rumah mereka rusak berat. Banyak korban tewas dan menglami luka parah. Untuk membantu saudara-saudara kita yang mengalami musibah di Mentawai dan Yogyakarta, LAZ Peduli Ummat Waspada membuka Dompet Peduli Bencana Mentawai & Gunung Merapi. Semoga amal kebaikan kita diterima Allah SWT. Tranfer Bank : - Bank Muamalat Cabang Medan No. Rek 211.00002.15 - Bank Syariah Mandiri Cabang Medan No. Rek. 006.000832.1 - Bank Central Asia (BCA) Cabang Medan No. Rek. 022.1750828 - Bank Mandiri Cabang USU No. Rek. 106-0002203803 - BNI Cabang Medan No. Rek. 0057504808 - Bank Sumut Cabang Medan No. Rek. Hubungi Kami : Lembaga Amil Zakat Peduli Ummat Waspada Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 - 4150858 (evi) E-mail : Kota Medan, diatas Rp.300.000 dijemput ( 4511936 - 08126375062)


Rp 93.594,850

86. Pengajian Jami’atul Ikhwan/Jiran Sepakat 87. MTs Perguruan Islamiyah Guppi 88. M. Thoib Hutagalung - Setor BNI 89. MTs Nurul Iman - Tj, Morawa 90. MTs Al-Washliyah -Tj. Morawa 91. Perwiritan/STM Al-Ikhlas Link. I Kel. Gd. Johor 92. PT. Delta Internusa - Setor Bank Mandiri 93 . Hamba Allah - Medan

Jumlah s/d Laporan ke-9

Rp1,600,000 Rp1,422,000 Rp1,000,000 Rp1,516,000 Rp 779,000 Rp 500,000 Rp 412,600 Rp 50,000

Rp 100.874.450

Luar Negeri

WASPADA Selasa 25 Januari 2011


Keamanan Bangkok Diperketat Jelang Demo ‘Kaos Kuning‘ BANGKOK, Thailand (Antara/Xinhua-OANA): Sekitar 3.600 polisi dikerahkan untuk menjaga keamanan di sekitar Wisma Pemerintah dan Parlemen ketika Aliansi Rakyat untuk Demokrasi yang dikenal sebagai kelompok ‘Kaos Kuning’ mengadakan unjukrasa massal hari ini (Selasa 25/1). Jend. Polisi Wichien Pojphosri mengatakan pada Senin bahwa dari 24 kompi polisi, empat kompi akan menjaga Wisma Pemerintah dan dua lainnya akan melindungi gedung Parlemen. Sejumlah tentara juga akan dikerahkan untuk memperkuat polisi, katanya. Dia mengungkapkan penyebaran keamanan dilakukan satu hari sebelum unjuk rasa yang dijadwalkan oleh ‘Kaos Kuning,’ satu gerakan yang tidak puas dengan cara pemerintah menangani masalah perbatasan yang disengketakan dengan Kamboja. Wichien mengatakan pemerintah tidak akan menyatakan keadaan darurat atau memberlakukan Perintah Keamanan Dalam Negeri untuk meminta daerah membatasi pengunjuk rasa, namun aparat keamanan tidak mengizinkan para demonstran untuk mengepung setiap kantor pemerintah. ‘Kaos Kuning’ menyerukan pemerintah agar mencabut nota kesepahaman yang ditan-

datangani oleh Thailand dan Kamboja pada tahun 2000 yang mengatur sengketa perbatasan kedua negara, mengklaim nota itu menempatkan Thailand di posisi yang kurang menguntungkan dalam berurusan dengan Phnom Penh. PAD atau ‘Kaos Kuning,’ sebuah gerakan yang memainkan peran penting dalam pengusiran pemerintah Thaksin Shinawatra pada 2006, juga menginginkan pemerintah mendesak Kamboja dari setiap wilayah sengketa dan untuk membatalkan keanggotaan Thailand pada KomiteWarisan Dunia UNESCO. Seorang anggota tim keamananyangdipimpinolehWakil PM Suthep Thaugsuban Minggu memperkirakan bahwa jumlah yang ikut ambil bagian dalam pemrotes PAD Selasa akan relatif kecil, yaitu antara 3.000 dan 3.500. Aktivis ‘Kaos Merah’ Ribuan aktivis Front Persatuan untuk Demokrasi menentang Kediktatoran (UDD) ‘Kaos Merah’ yang anti-pemerintah

yang melakukan aksi unjukrasa di Monumen Demokrasi Minggu mengakhiri demo mereka dengan damai. Mereka juga menjadwalkan 13 Februari sebagai tanggal untuk melakukan aksi demo lanjutan mereka di Bangkok. Para demonstran menduduki Jalan Rajdamnoen dariJembatanPhan Fah sampai lapangan upacara Sanam Luang, sedangkan pang-

gung demonstrasi utama didirikan di monumen itu sendiri. Titik-titik kumpulan kecil berserak di seluruh di seluruh daerah itu, dan polisi dikerahkan untuk memberikan keamanan dan menjaga ketertiban. Aksi demo dimulai di persimpangan Ratchaprasong dan kemudian pindah ke Monumen Demokrasi pada sekitar pukul 03:00 waktu setempat.

Sementara itu, Kepolisian Thailand menahan 91 orang perahu Rohingya setelah mereka mendarat di pantai selatan negara itu dan berencana akan mendeportasi mereka ke Myanmar, kata mereka Senin (24/1). Rohingya adalah Muslim Myanmar berbahasa Bengali yang disebut oleh Perserikatan Bangsa-Bangsa (PBB) sebagai salah satu minoritas dunia yang

paling dianiaya. Kelompok itu, semua pria dari berbagai usia, ditahan setelah tiba di pantai tersebut pada Sabtu malam dengan perahu mesin yang bermasalah, menurut Kunjungi Tangpong, kepala polisi di distrik Trang propinsi Kantang. Dia mengatakan, dia berpikir kelompok itu dalam perjalanan dari Myanmar ke Malaysia.

Penembakan Di Pusat Perbelanjaan Walmart Di Washington, 2 Tewas PORT ORCHARD, Washington (AP): Tembak menembak terjadi di depan salah satu Walmart di negara bagian Washington yang menyebabkan dua orang tewas dan dua deputi sherif cedera. Salah seorang yang tewas adalah seorang pria yang menembak ke arah para deputi sherif, kata Scott Wilson dari Kantor Sherif Kecamatan Kitsap. Korban lainnya adalah seorang wanita muda yang meninggal dunia setelah dia dibawa ke salah satu RS Tacoma, katanya. Kepolisian Tacoma mengatakan para deputi keduanya tertembak pada bagian pinggulnya dan mereka berada dalam kondisi memuaskan di rumah sakit. Mereka menginap semalaman di salah satu rumah sakit. Rincian mengenai tembak menembak tersebut masih kabur sampai Minggu malam, namun kantor sherif menerima satu panggilan tentang seseorang yang dicurigai di toko tersebut di Port Orchard, kata Wilson. Pria itu berlari dan mulai menembaki ketika tiga deputi sherif berbicara dengannya, katanya. Para deputi, termasuk dua pria yang cedera, melepaskan tembakan balasan, kata Wilson. Destany Droge, 22, dan Emmili Jones, 20, mengatakan kepada suratkabar The Seattle Times bahwa mereka memperhatikan dua deputi sherif berkonfrontasi berat dengan pria di lapangan parkir. Pria itu, kata mereka, melarikan diri ke arah satu kawasan semak-semak. Kemudian, di tengah pelariannya, dia mengeluarkan senjata apinya dan menembak ke arah belakang tanpa memutar badannya. Para petugas keamanan yang berada kira-kira 10 sampai 13 meter di belakang tersangka ketika dia mulai menembak, kata saksi Ray Bourge kepada KOMO-TV. “Lima atau enam tembakan terdengar ditembakkan... saya mencari tempat berlindung,” katanya. (m10)

BERLIN, Jerman (Antara/IRNA-OANA): Seorang pria tersangka pembakaran telah mengaku dirinya terlibat dalam 13 serangan terhadap tempat-tempat Muslim di Berlin, menurut harian Bild dalam laporannya. Pria itu, 30 tahun, yang tak disebutkan identitasnya semula dituduh hanya berperan dalam tujuh serangan pembakaran terhadap sejumlah masjid di ibukota Jerman. Sabtu, seorang hakim mengeluarkan surat perintah penangkapan terhadap tersangka yang menghadapi suatu evaluasi psikologis dalam upaya mengetahui motif kejahatannya itu. Menurut Bild Minggu (23/1) Masjid Berlin telah menjadi tempat setidaknya tujuh kali pemboman sejak Juni 2010. Bulan lalu, gedung Pusat Kebudayaan Islam Iran mendapat serangan bom, yang memicu kecaman kuat oleh Walikota Berlin Klaus Wowereit. Pembakaran Masjid Sehitlik, mesjid terbesar di Berlin, telah diserang empat kali selama beberapa bulan terakhir. Para pemimpin Muslim Jerman telah berulang kali menyuarakan keprihatinan kuat atas pengeboman yang berkelanjutan terhadap mesjid-mesjid, dan menyerukan tindakan-tindakan keamanan ditingkatkan. Pemerintah tengah-kanan Kanselir Angela Merkel berusaha untuk mengecilkan serangkaian kejahatan anti-Muslim dan membenci Muslim terbaru di balik makin mendalamnya kebencian terhadap Islam di Jerman.

AS Dukung Perundingan Timteng Meski Ada Laporan Al-Jazeera WASHINGTON, AS (Antara/AFP): Departemen luar negeri Amerika Serikat mengatakan, pihaknya akan terus mendesak untuk terwujudnya solusi dua-negara dalam konflik Israel-Palestina meski inti dokumen rahasia telah disiarkan oleh jaringan televisi Al-Jazeera. “Pemerintah AS sedang mengkaji dokumen Palestina yang diduga dirilis oleh Al-Jazeera. Kami tidak dapat menjamin kejujuran mereka,” kata jurubicara Philip Crowley menulis di laman Twitter micro-blogging-nya. “AS tetap fokus pada solusi dua-negara dan akan terus bekerja dengan pihak-pihak untuk mempersempit perbedaan tentang isu-isu inti,” tambahnya. Pernyataan itu disampaikan setelah saluran satelit pan-Arab Al-Jazeera mengatakan telah memperoleh satu hal yang sangat berharga dari ‘dokumen-dokumen rahasia’ dari kegagalan perundingan perdamaian 10 tahun terakhir yang mengungkapkan konsesi utama oleh kepimpinan Palestina yang didukung AS, termasuk tentang status masa depan Jerusalem yang sensitif. Ketua perunding Palestina Saeb Erakat, dikutip dalam beberapa dokumen, membantah sebagian laporan sebagai “kebohongan” dan bersikeras agar Pemerintah (Otoritas) Pales-tina “tidak menyembunyikan apa pun.”

Gempa Bumi Guncang 3 Negara ISLAMABAD, Pakistan (Antara/IRNA-OANA): Gempa bumi berkekuatan sedang mengguncang tiga negara Senin (24/1), pertama getaran berkekuatan 6,3 skala Richter mengguncang Pakistan, namun tidak ada peringatan bahaya tsunami. Guncangan gempa dengan kekuatan 6,3 skala Richter melanda Islamabad, ibukota Pakistan, Senin dan juga bagian baratlaut dan timur negara itu, kata Departemen Seismologi. Tidak ada laporan mengenai kerusakan atau korban jiwa. Peristiwa itu terjadi pada pukul 07:50 waktu setempat (sekitar pukul 12:50 WIB) dengan pusat gempa berada dengan kedalaman 200 km dari kota sebelah utara Chitral di Tajikistan, kata pejabat seismologi. Gempa tersebut memaksa warga untuk keluar dari rumah mereka dengan panik dan beberapa pengumuman diumumkan dari masjid-masjid untuk meminta penduduk pergi ke jalanan. Gempa lainnya tercatat berkekuatan 6,1 skala Richter Senin pagi mengguncang daerah pegunungan di Tajikistan Timur, menurut laporan Survei Geologi Amerika Serikat (USGS). Pusat gempa yang terjadi pada pukul 07:45 waktu setempat itu berlokasi di 106 km di sebelah baratdaya kota Karakul, di dekat perbatasan negara dengan China, katanya menambahkan. Belum ada laporan-laporan mengenai kerusakan atau jatuhnya korban akibat gempa itu. Gempa bumi yang berkekuatan 5,8 skala Richter mengguncang kawasan Fiji, Senin, kata Badan Gempa AS USGS, namun tidak ada peringatan mengenai bahaya tsunami. Gempa bawah laut itu berada sekitar 138 km sebelah baratlaut Nuku Alofa di kedalaman 202 km dan terjadi pada pukul 07:15 waktu setempat (pukul 02:15 WIB), kata USGS. Pusat Peringatan Tsunami Pasifik yang memantau kawasan itu tidak mengeluarkan peringatan tsunami setelah gempa tersebut. Kawasan itu terletak di ‘Cincin Api Pasifik,’ di mana lempenganlempengan benua bertumbukan dan seringkali menimbulkan kegiatan vulkanik dan seismik.

Seorang Pria Mengaku Serang 13 Tempat Muslim Di Berlin

The Associated Press

BOM MOBIL DI TENGAH JAMAAH SYIAH. Warga Irak berkumpul di lokasi kejadian di mana satu serangan bom mobil di Baghdad, Irak, Senin (24/1). Kekerasan telah menurun secara drastis di Irak sejak puncak perang tiga tahun lalu. Namun pengeboman berskala kecil dan penembakan dari mobil yang meluncur masih terus terjadi hampir setiap hari.

2 Bom Mobil Di Irak Ditujukan Pada Jamaah Syiah, 18 Tewas BAGHDAD, Irak (AP): Dua bom mobil menghantam para jamaah Syiah Senin (24/1) di salah satu kota suci Irak, yang menewaskan sekurang-kurangnya 18 orang pada saat kerumunan massamelaksanakanibadahyang menandai berakhirnya masa berkabung 40 hari kematian tokoh paling dimuliakan oleh sekte itu. Ledakan di Karbala merupakan yang terakhir dalam waktu hampir dua pekan serangan yang ditujukan pada jamaah Syiah yang menewaskan sekurang-kurangnya 159 orang. Gelombang kekerasan itu telah mengusik periode tenang yang cukup panjang dan meningkatkan kecemasan baru menge-nai kesiapan pasukan Irak untuk mengambil alih penanganan keamanannya sendiri sebelum penarikan penuh militer AS. Sebuah bom mobil menewaskan enam orang diluar kota Karbala pada Senin, demikian menurut seorang pejabat kementerian dalam negeri Irak, dalam serangan terbaru dari serangkaian pengeboman bermotif intoleransi beragama. “Enam orang terbunuh dan 10 orang terluka akibat sebuah bom mobil, semua korban merupakan orang Syiah,” kata pejabat itu. Bom tersebut meledak di sebuah terminal bus di wilayah Al-Ibrahimi, yang berlokasi 20 km di timur Karbala, kata wakil kepala provinsi Nusayef Jassem. Satu ledakan merupakan serangan bom bunuhdiri di pintu masuk utara kota, kemudian diikuti dengan ledakan dua mobil van berisikan bahan peledak di 15 kilometer dari selatan Karbala. Ratusan ribu peziarah Syiah turun ke kota untuk upacara Arbaeen, sebuah upacara menandai 40 hari peringatan wafatnya

cucu Nabi Muhammad SAW Imam Hussein, yang mencapai puncaknya pada Selasa. Kepolisian Irak Jumat mengatakan mereka menangkap seorang pemimpin milisi Sunni anti al Qaida dan ajudannya terkait tiga ledakan di Karbala itu. Kedua pria yang tidak disebutkan identitasnya, berhasil ditangkap pada malam hari di sebuah desa Al-Hamiyah di provinsi Babil yang terletak di selatan Baghdad, kata seorang jenderal. Serangan pertama terjadi kira-kira pukul 07:00 pagi di satu halaman parkir dekat bus yang

berpenumpang penuh warga Syiah di pinggiran sebelah timur Karbala, 90 km di selatan Baghdad. Polisi dan kalangan rumah sakit mengatakan enam jamaah tewas dan 34 lainnya cedera dalam serangan tersebut. Serangan kedua terjadi ketika ditemukan bahan peledak di dekat ledakan pertama dan dijinakkansebelummeledak,kata polisi. Lebih dari empat jam kemudian, satu bom mobil lainnya meledak menghantam para jamaahSyiahdiujungselatankota tersebut, yang menewaskan 12 orang, termasuk 10 jamaah dan

dua tentara serta melukai 21 lainnya, kata para pejabat. Serangan itu terjadi pada saat di Karbala ada larangan membawa kendaraan selama masa bersuci bagi para jamaah tersebut. Para jamaah hanya diturunkan di halaman parkir dan selanjutnya mereka berjalan menuju tempat-tempat ibadah atau hotel mereka. Belum ada kelompok yang menyatakan bertanggungjawab atas serangan Senin itu, namun bom mobil dan serangan bunuhdiri merupakan ciri aksi al Qaida di Iran dan kaum ekstrimis Sunni.(m10)

Shandong Hadapi Kemarau Terparah Dalam Abad Ini BEIJING, China (Antara/ Reuters): Provinsi Shandong di China Timur menghadapi musim kemarau terburuk dalam abad ini, dengan hampir seperempat juta penduduknya mengalami kekurangan air minum, sementara itu lebih banyak salju diharapkan muncul di bagian selatan, kata media pemerintah, Senin (24/1). Di kota-kota Provinsi Shandong, yaitu Linyi, Rizhao dan Weifang, musim kemarau telah menurunkan kapasitas air waduk secara dramatis dan pihak berwenang mulai menggunakan truk pemadam kebakaran untuk memberikan pasokan air minum sehari-hari kepada para penduduk, menurut China Daily. Markas pihak berwenang pengendalian banjir dan kekeringan Provinsi Shandong telah memperingatkan bahwa jum-

lah orang yang terkena dampak musim kemarau bisa meningkat menjadi 300 ribu dari lebih dari 240 ribu saat ini kecuali terjadi hujan di beberapa wilayah segera. PM Wen Jiabao mengunjungi wilayah yang dilanda kekeringan di Henan tengah pada akhir pekan dan berjanji bahwa pemerintah akan membangun fasilitas lebih untuk menghemat air tahun ini, menurut keterangan dari Partai Komunis menurut China Daily. Sejumlah bagian di China utara, tengah dan timur telah dicekam kekeringan selama lebih dari tiga bulan terakhir, dengan kondisi yang terus memburuk di sejumlah daerah musim dingin penghasil gandum utama. Kekeringan telah mempengaruhi tanaman gandum musim dingin di 17 persen kawasan utama di ‘keranjang roti’ utara

dan cuaca kering diperkirakan akan diperpanjang sampai musim semi, kata pemerintah bulan lalu. Sebagian dari China Selatan sudah terkena hujan yang dingin membeku dan salju berat, mempengaruhi tanaman dan mengganggu lalu lintas. Udara segar dingin dengan hujan beku dan salju cenderung terjadi baratdaya China di tengah minggu ini, kata People Daily. Cuaca ekstrim terjadi bertepatan dengan kampanye pemerintah untuk melawan kenaikan harga pangan —faktor pendorong utama inflasi China — yang telah terjadi dalam beberapa pekan terakhir. Beijing sepertinya akan memecahkan rekor 60 tahun untuk hari terlama salju pertama musim ini, dengan kecilnya prospek hujan salju minggu depan, menurut People’s Daily.

Ragukan bocoran dokumen Pejabat Otorita Palestina mempertanyakan akurasi bocoran dokumen soal tawaran konsesi kepada Israel. Berkas dokumen yang diperoleh stasiun televisi al-Jazeera tersirat menyatakan Palestina setuju Israel tetap menguasai banyak bagian Jerusalem Timur yang secara ilegal diduduki Israel dan tawaran itu tampaknya ditolak oleh Israel.

PBB: Pasukan Sudan Lakukan Razia, Tangkap 37 Orang Di Kamp Darfur KHARTOUM, Sudan (AP): PBB dan misi Uni Afrika di Darfur mengatakan pasukan Sudan menangkap 37 orang setelah melakukan pencarian dan razia di satu kamp pengungsi do daerah barat negara itu yang bergolak. Satu pernyataan UNAMID Minggu (23/1) malam mengatakan misi itu telah diberitahu tentang tindakan yang berlangsung hampir tiga jam setelah pasukan pemerintah mengepung kamp Zamzam yang menampung puluhan ribu orang yang kehilangan tempat tinggal akibat peperangan yang melanda daerah tersebut. Kamp itu terletak dekat El Fasher, ibukota Darfur Utara. UNAMID mengatakan pihaknya telah diberitahu, tentara dan polisi melakukan pencarian untuk‘menangkap unsur kejahatan, menyita senjata dan barang-barang ilegal’ yang ada di dalam kamp. Misi internasional telah meningkatkan kehadirannya di Zamzam, dan menyerukan kepada pihak berwenang agar menahan diri dalam bertindak dan mengatakan pihaknya akan mencari informasi tentang orang-orang yang ditahan itu. (m10)

Demonstrasi Besar Landa Belgia BRUSSELS, Belgia (Waspada): Puluhanribu warga Belgia turun ke jalan meminta bangsa itu agar bersatu menuntut pembentukan sebuah pemerintahan setelah tujuh bulan terjadi kebuntuan politik. Dalam demo di Brussels itu mereka membentangkan spanduk berisi ‘Memalukan, tidak ada pemerintahan, negara besar.’ Aksi besar ini dijaga oleh 34.000 anggota kepolisian. Meski pemilu telah berlangsung Juni 2010, namun elit politis negara itu gagal membentuk pemerintahan, yang kini dijalankan oleh pejabat pelaksana pemerintahan. Hasil pemilu itu sendiri dimenangkan oleh Partai Aliansi Flemish Baru yang diketuai oleh Bart De Wever. Tetapi partai ini belum berhasil mencapai kesepakatan dengan kaum sosialis untuk membentuk sebuah pemerintahan dan menyebabkan kebuntuan selama 224 hari, sebuah rekor bagi negara di Eropa. Aksi demonstrasi ini berhasil digalang melalui pergerakan di situs jejaring sosial Facebook yang meminta warga Belgia untuk bersatu. “Kami ingin Bir, kentang dan sebuah pemerintahan,’’ isi spanduk lainnya. Salah seorang pengatur aksi massa ini, Thomas Decreus, mengatakan aksi ini bertujuan untuk menunjukan kalau ‘’rakyat bisa bergerak jika politisi gagal walau terbatas oleh rintangan bahasa’’. Belgia adalah negara yang dibagi atas pembicara Flemish di utara dan bahasa Prancis Selatan. Salah satu upaya lain untuk mempromosikan Belgia bersatu ini adalah aktor Benoit Poelvoorde adalah menggelar kampanye tidak mencukur sampai pemerintahan terbentuk. Sejauh ini 653 orang akan turut serta dalam kampanye tersebut termasuk diantaranya adalah seorang perempuan yang berjanji untuk tidak mencukur bulu kakinya. Kebuntuan politik ini juga menyebabkan pasar keuangan terpukul dan menyebabkan hutang Belgia mendekati 100 persen produk domestik bruto.



WASPADA Selasa 25 Januari 2011

Hasil La Liga Sevilla vs Levante Barcelona vs Rac Santander Valencia vs Malaga S Gijon vs Atl Madrid Real Zaragoza vs Deportivo Getafe vs Espanyol Almeria vs Osasuna Real Madrid vs Mallorca Villarreal vs Real Sociedad

4-1 3-0 4-3 1-0 1-0 1-3 3-2 1-0 2-1

Klasemen Barcelona Real Madrid Villarreal Valencia Espanyol Atl Madrid Sevilla Atl Bilbao Mallorca Getafe Real Sociedad Hercules Deportivo Santander Sporting Gijon Zaragoza Osasuna Almeria Malaga Levante

20 20 20 20 20 20 20 19 20 20 20 19 20 20 20 20 20 20 20 20

18 1 1 64-11 55 16 3 1 48-17 51 13 3 4 40-21 42 12 4 4 33-23 40 12 1 7 28-26 37 9 3 8 31-24 30 9 2 9 30-32 29 9 2 8 29-31 29 8 3 9 23-25 27 8 3 9 29-32 27 8 1 11 30-33 25 6 4 9 22-28 22 5 6 9 15-27 21 5 5 10 15-29 20 4 7 9 18-27 19 4 7 9 18-32 19 4 6 10 19-28 18 3 8 9 20-34 17 5 2 13 27-45 17 4 3 13 20-34 15

Karim Benzema (kanan) membuktikan dirinya masih layak menjadi andalan Real Madrid usai menjadi penentu kemenangan atas Real Mallorca di Santiago Bernabeu, Senin (24/1). -AP-

Jawaban Benzema MADRID (Waspada): Karim Benzema menjadi pahlawan buat Real Madrid kala menjamu Real Mallorca dalam lanjutan La Liga Primera di Santiago Bernabeu, Senin (24/1) dinihari WIB. Gol itu sekaligus menipiskan jarak El Real dengan pemimpin klasemen sementara, Barcelona. Madrid kini mengoleksi 51 poin dan Barca unggul empat poin (55). Akibat aksi heroiknya itu, Benzema pun banjir pujian termasuk dari kiper Madrid, Iker Casillas. “Dia (Benzema) akan jadi headline utama di seluruh

berita olahraga. Kami menghargainya karena dia adalah orang mulia yang bahkan tidak akan menyakiti seekor lalat,” kata Casillas dikutip dari situs resmi klub pasca pertandingan. Dalam pertandingan kontra Mallorca, penampilan Madrid memang mengecewakan. Meski menguasai jalannya pertandingan, hampir tidak ada pe-

luang yang mengigit sepanjang pertandingan. Padahal dengan suntikan serangan Cristiano Ronaldo, Madrid seharusnya bisa menang lebih dari satu gol. Masih menurut Casillas, Benzema harusnya berhenti dikritik sebab striker Prancis itu memang tipe pemain yang melakukan segala sesuatunya secara perlahan. Tekanan buat Benzema sendiri hadir karena tuntutan tinggi yang disematkan pada Los Blancos. Bermain di depan puluhan ribu suporter yang memadati Santiago Bernabeu, Madrid

langsung mengambil inisiatif penyerangan. Pergerakan impresif Cristiano Ronaldo yang kerap menyisir dari sayap kerap merepotkan lini belakang Mallorca. Ketidakhadiran Gonzalo Higuain yang biasa menempati lini depan membuat pola penyerangan Madrid terlihat kurang tajam. Benzema yang diplot sebagai pengganti pun awalnya kurang cakap membuka ruang maupun mencari peluang. Tak ingin kecolongan seperti pekan lalu, Madrid terus mengurung pertahanan Mallorca.

Tuan rumah akhirnya memecah kebuntuan di menit 61. Umpan Esteban Granero pada Benzema yang sebelumnya mengecoh dua pemain lawan diteruskannya ke pojok kanan gawang Dudu Auoate. Di laga lainnya, Almeria melakukan pemanasan menjelang semifinal Piala Raja melawan Barcelona, Rabu (26/1) nanti, dengan kemenangan 3-2 atas Osasuna untuk naik dari posisi terbawah klasemen. Sementara itu, posisi juru kunci ditempati oleh Levante. (m33/ini/ap)

PSG Melaju, Lyon Tersingkir PARIS (Waspada): Paris Saint Germain terhindar dari kekalahan memalukan pada kompetisi Piala Prancis, Senin (24/1), setelah sang juara bertahan menundukkan tim Divisi III Agen 3-2 untuk melaju ke putaran 16 besar. Tim dari Divisi I sudah separuhnya tersingkir dari kompetisi dan tinggal tujuh tim yang bertahan setelah Nice menang 1-0 atas Lyon lewat perpanjangan waktu berkat gol yang dihasilkan Francois Clerc. Pimpinan kompetisi Lique I, Lille, selamat lolos ke putaran berikutnya setelah mengandaskan tim Divisi II Nantes yang mengalahkan tim amatir Wasquehal 1-0 d imana pemain Brazil Tulio de Melo menjadi pemain yang mencapai target. Agen, berusaha mengikuti jejak rekannya sesama tim


Bintang Denver Nuggets, Carmelo Anthony (kanan), tetap tampil profesional bagi timnya saat menjamu Indiana Pacers dalam laga NBA di Pepsi Center, Senin (24/1).

Carmelo Cuek Cemoohan Fans DENVER, AS (Waspada): Forward Denver Nuggets, Carmelo Anthony, membuat para pendukung bersuka cita setelah 36 poin cetakannya membantu tuan rumah menang atas Indiana Pacers 121-107 dalam lanjutan kompetisi NBA di Pepsi Center, Senin (24/1). Kemenangan ini sekaligus memperpanjang rekor kekalahan Pacers menjadi lima kali secara berturut-turut. Sebelumnya, Carmelo menjadi sasaran cemoohan pendukung setelah rumor kepindahannya semakin menguat. Namun situasi itu berubah 180 derajat ketika permainan apik Carmelo membuat para pendukung Denver kembali mencintainya, terutama berkat three point yang beberapa kali ia lesakkan sepanjang pertandingan. Pada pertandingan ini pula, Carmelo mencetak enam three point dalam satu laga yang juga torehan terbanyaknya sepanjang karir. Hebatnya, prestasi tersebut ditoreh sang bintang di kuarter ketiga. Catatan itu juga melebihi pencapaiannya saat masih menjadi rookie di musim 2003/2004 dengan lima three point. “Ini adalah perjalanan besar buat kami. Kami butuh terus tampil percaya diri dan menjaga momentum yang kami miliki di kandang. Kami cuma harus fokus dalam memenangi setiap pertandingan,” imbuh Melo. Carmelo sendiri membukukan 36 angka plus delapan rebound, sedangkan Nene menambahkan 15 poin 10 rebound bagi Nuggets sebelum terkena fouled out. Tyler Hansbrough mencetak 27 poin 10 rebound untuk Pacers. Selanjutnya, Nuggets akan menghadapi lima laga away. Dimulai dengan Washington Wizards disusul Detroit Pistons, Cleveland Cavaliers, Philadelphia 76ers dan diakhiri kunjungan ke markas New Jersey Nets di akhir Januari ini. (m33/ap)


Striker AC Milan, Antonio Cassano (kanan), hilang keseimbangan akibat tekal pemain bertahan Cesena dalam lanjutan Serie A di San Siro, Milan, Senin (24/1).

Tiga Poin Milan Terasa Mahal MILAN, Italia (Waspada): Usai dua hasil imbang, Pelatih AC Milan Massimiliano Allegri boleh merasa puas timnya berhasil mengalahkan Cesena 2-0, tetapi mereka harus membayar mahal untuk itu. Pada pertandingan yang berlangsung di San Siro, Senin (24/1) dinihari WIB, Rossoneri kehilangan Alessandro Nesta. Mantan pemain Timnas Italia itu terpaksa ditarik keluar sebelum babak pertama usai karena cedera bahu. Pemeriksaan awal seperti dilansir Sky Sports, menunjukkan cedera Nesta cukup serius dan diperkirakan absen hingga tiga bulan. Meski demikian, tidak ditemukan adanya keretakan pada tulang sekitar terjadinya cedera, sehingga tak perlu menjalani operasi. Cederanya Nesta ini memperburuk keadaan di tim Milan. Hanya beberapa menit jelang laga dimulai, Allegri pun batal menurunkan Gennaro Gattuso karena cedera. “Ini kemenangan yang bagus bagi kami, karena kami tidak kesulitan. Ada beberapa pemain cedera, bisa dibilang gawat, tetapi secara keseluruhan tim bermain dengan baik,” ujar Allegri. “Kemenangan ini layak bagi kami. Kami menciptakan banyak peluang. Ketiga penyerang kami bekerja sama dengan baik, tetapi mereka bisa seperti

itu juga berkat para gelandang yang bisa membuka ruang,” urainya. “Mengenai Nesta, bahunya bergeser dan kami akan mengevaluasi kondisinya dengan lebih detail dalam satu dua hari ini,” terang mantan pelatih Cagliari itu. Milan membuka keunggulan di akhir babak pertama berkat gol bunuh diri Maximiliano Pellegrino. Penyerang Timnas Swedia Zlatan Ibrahimovic menggenapinya lewat gol yang dicetaknya di menit 90. Berkat kemenangan itu, Milan tetap duduk di puncak klasemen dengan raihan 44 poin atau unggul empat angka dari pesaing terdekat mereka, Napoli. Pada kesempatan itu, Allegri juga berbicara mengenai pemain anyar mereka dari Ajax Amsterdam, Urby Emanuelson. “Dia gelandang yang sangat dinamis dan akan sangat berguna bagi kami,” tandasnya. Emanuelson sendiri mengaku sulit mempercayai dirinya telah menjadi bagian klub itu dan tak sabar bergabung bersama rekan-rekan barunya, terutama seniornya di tim nasional Belanda, Clarence Seedorf. “Ini adalah momen ajaib. Sehari setelah (Ajax) melawan Feyenoord, aku duduk semeja dengan manajemen Milan. Aku tidak pulang sampai larut ma-

Hasil Serie A AC Parma vs Catania Palermo vs Brescia AS Roma vs Cagliari Udinese vs Inter Milan Bari vs Napoli Bologna vs Lazio Chievo vs Genoa Fiorentina vs Lecce Sampdoria vs Juventus AC Milan vs Cesena

2-0 1-0 3-0 3-1 0-2 3-1 0-0 1-1 0-0 2-0

Klasemen AC Milan 21 12 5 3 37-18 44 Napoli 21 12 4 5 32-20 40 AS Roma 21 11 5 5 31-24 38 Lazio 21 11 4 6 27-21 37 Inter Milan 20 10 5 5 33-22 35 Juventus 21 9 8 4 35-25 35 Palermo 21 10 4 7 34-25 34 Udinese 21 10 3 8 34-28 33 Sampdoria 20 6 9 5 20-18 27 Cagliari 21 7 5 9 22-24 26 Parma 21 6 7 8 21-25 25 Bologna* 21 7 7 7 23-29 25 Fiorentina 20 6 7 7 21-21 25 Chievo 21 5 9 7 20-22 24 Genoa 20 6 6 8 15-19 24 Catania 21 5 7 9 18-27 22 Cesena 21 5 4 12 15-27 19 Lecce 21 5 5 11 20-38 20 Brescia 21 5 3 13 17-27 18 Bari 21 3 5 13 13-32 14 *Bologna kurang 3 poin karena pajak lam dan tak bisa tidur. Aku bicara dengan Clarence dan ia sudah menungguku di Milan,” ujar Emanuelson. (m33/ini/ap)

Hasil Piala Prancis Nice vs Lyon 1-0, Lille vs Wasquehal 1-0, Agen vs PSG 2-3, Sedan vs Metz 0-1, Vaulx-en-Velin vs Rennes 0-2, Strasbourg vs Evian 1-0, Vendee Fontenay vs Lorient 0-1, Angers vs Bordeaux 1-0, Boulogne vs Jeanne D’Arc Drancy 0-1, Clermont vs Reims 1-3, Chambery vs Brest 4-3, Nantes vs Raon l’Etape 2-1, AS Cherbourg vs Le Mans 0-1, Nimes vs Nancy 1-2, US Quevillaise vs Martigues 3-5 amatir, Chambery yang mengejutkan menang atas Monaco dan kini Brest, berusaha menampilkan pemainan terbaiknya ketika berhadapan dengan PSG. Namun gol Mathieu Bodmer membuat tim tamu tampil semakin keras, kendati Mamoudou Daffe menyamakan kedudukan empat menit sebelum jeda. Tetapi Peguy Luyindula membuat PSG unggul dua menit di awal babak kedua. Bagi Luyindula, gol itu merupakan kebanggaan setelah gagal masuk

tim di Piala Liga melawan Montpellier. Tiga menit kemudian, Guillaume Hoarau mencetak gol yang membuat 12.000 pendukung bersorak sebelum angka berubah lagi melalui Anthony Vandersnick. Meraih tiket ke babak 16 besar, PSG berusaha mengangkat piala untuk kesembilan kalinya sekaligus memperkecil selisih rekor kemenangan dengan Marseille yang memimpin satu angka di atasnya. (m33/ant/afp) AP

Suarez Kian Dekati Anfield

Bek Blackburn, Chris Samba (belakang), duel di udara dengan pemain sayap West Bromwich Albion Peter Odemwingie dalam lanjutan Liga Premier di Ewood Park, Blackburn, Senin (24/ 1) dinihari WIB.

LIVERPOOL, Inggris (Waspada): Upaya Liverpool memboyong striker Luis Suarez (foto) tidak main-main. Kabarnya, Direktur Teknik The Reds, Damien Comolli, terbang ke Belanda, Selasa (24/1). Kepergian Damien yang juga menjabat sebagai penasihat transfer Liverpool itu untuk bertemu dengan perwakilan Ajax Amsterdam. Pertemuan itu nanti akan membicarakan niat Liverpool yang ingin memboyong Suarez ke Inggris. Bahkan, harga yang ditawarkan sudah disiapkan. Liverpool kabarnya bersedia membeli striker berusia 23 tahun itu dengan harga 20 juta euro. Suarez sendiri pernah mengutarakan niatnya untuk bermain di Inggris. “Kompetisi Liga Inggris sangat menarik bagi saya di samping La Liga Spanyol. Menurut saya, Liga Inggris adalah liga terbaik di dunia,” kata Suarez kala itu. Sementara itu, pelatih Ajax Frank de Boer mengatakan siap kehilangan Suarez namun berharap anak asuhnya itu tidak meninggalkan Ajax dalam waktu dekat. “Kami tidak ingin Luis (Suarez) meninggalkan klub pada 31 Januari nanti. Ini adalah kesepakatan antara kami dengan manajer Ajax, Rik van den Boog,” ujar De Boer. Tapi, De Boer tetap mengantisipasi jika benar Suarez meninggalkan Ajax dengan mencari pengganti pemain lain. Sebab, untuk mencari pengganti Suarez dalam waktu sesingkat ini tidaklah mudah. (m33/ini)

Rovers Naik Ke Urutan Tujuh


LONDON ( Waspada): Blackburn Rovers naik ke urutan ketujuh dalam Liga Premier, Senin (24/1) dinihari, setelah meraih kemenangan 2-0 atas West Bromwich Albion di Ewood Park. Gol bunuh diri pada babak pertama dari pemain belakang West Brom Gabriel Tamas dan gol pemain muda asal Kanada, David Hoilett, memastikan kemenangan Rovers yang berada enam poin di bawah tim urutan keenam Sunderland. Kekalahan tersebut mendorong West Brom semakin mendekati posisi rawan degradasi, setelah tim asuhan Roberto Di Matteo itu telah kalah dalam enam dari tujuh pertandingan terakhir. The Baggies tetap hanya tiga poin di atas zona degradasi di posisi 15.

Atas keberhasilan skuadnya, bos Rovers Steve Kean gembira setelah Blackburn menempati posisi tertinggi dalam liga selama dua setengah tahun terakhir. “Saya sangat gembira,” kata Kean kepada Sky Sports. Setelah kekhawatiran pada menit pertama ketika Peter Odemwingie memaksa Paul Robinson melakukan penyelamatan, Blackburn menikmati babak pertama yang lebih baik. West Brom harus berterima kasih kepada kiper Boaz Myhill karena membuat Rovers tidak berdaya. Dengan penampilan berwibawa Myhill, tampaknya Rovers membutuhkan sedikit keberuntungan untuk memecah kebuntuan dan itu terbukti pada menit 41. Saat itu, David Dunn melaju dari lini tengah sebelum mela-

Hasil Liga Premier Arsenal vs Wigan Athletic Aston Villa vs Man City Blackpool vs Sunderland Everton vs West Ham Fulham vs Stoke City Man United vs Birmingham Newcastle vs Tottenham Wolves vs Liverpool

3-0 1-0 1-2 2-2 2-0 5-0 1-1 0-3

yangkan umpan. Tamas tampaknya akan mengatasi bahaya tersebut dengan mengelakkan bola, namun secara tak terduga malah mengarahkan sundulannya menuju gawangnya sendiri. Rovers semakin kuat di awal babak kedua, ketika Hoilett yang baru berusia 20 tahun mencetak gol indah dengan upayanya sendiri. (m33/ant/afp)

Sport Juara Bertahan Putri Tumbang



Selasa 25 Januari 2011

Honda DBL 2011 MEDAN (Waspada): Kejutan langsung terjadi pada hari pertama Honda Development Basketball League (DBL) saat juara bertahan putri SMA Methodist 2 Medan ditaklukkan rival abadinya SMA Sutomo 1 Medan 30-25 di GOR Angsapura Jl Logam Medan, Senin (24/1). Kemenangan Sutomo sekaligus menuntaskan dendam atas kekalahan menyakitkan dari Methodist 2 pada babak penyisihan DBL 2010 silam. “Kini giliran kami melanjutkan perjuangan merebut prestasi terbaik pada even ini dan saya yakin anak-anak mampu untuk

itu,” ujar Manajer Tim Putri SMA Sutomo 1, Handi, usai pertandingan. Menurut Hendi, timnya sudah dipersiapkan lebih baik untuk menghadapi ajang basket pelajar terakbar di tanah air itu. “Kami punya persiapan lebih matang dan kemenangan hari

Jadwal Selasa (25/1) 14.00 Harapan Mandiri vs Methodist Binjai 15.00 SMAN 3 Medan vs Ahmad Yani Binjai 16.00 SMAN 5 Medan vs SMAN 7 Medan 17.00 Sutomo 1 Medan vs Wiyata Dharma Medan 18.00 SMA 4 Medan vs SMAN 2 Medan ini semakin meningkatkan motivasi bertanding anak-anak,” tandasnya. Seperti diketahui, kedua tim sama-sama memiliki rekor bagus pada ajang basket pelajar di Sumut. Duel keduanya yang kerap bertemu di partai final memang selalu dinanti penonton dengan menyuguhkan permainan ketat dan sarat gengsi. Pada pertandingan tersebut, Methodist 2 unggul di

kuarter pertama sebelum keadaan berbalik hingga kuarter ketiga didominasi Sutomo. Pertarungan sengit terjadi di paruh kuarter keempat di mana Methodist yang tertinggal berhasil menyamakan kedudukan lewat sumbangan tujuh angka dari Angeline. Angeline memang praktis menjadi tulang punggung tim, namun center bernomor enam ini tidak didukung pemain lain-

nya. Torehan 21 angka raihannya pun tak mampu membawa kemenangan bagi timnya. Di kubu Sutomo, StephaniYolanda dan Maggie masing-masing menyumbangkan 14 dan 10 poin. Pertandingan lainnya, tim putra SMA Negeri 1 Medan melewati rintangan pertama kala menundukkan SMA Panca Budi Medan 29-25. Runner-up putra Honda DBL 2010, SMA Wahidin Medan, turut melaju ke babak berikutnya usai menang mudah atas SMA Negeri 2 Medan 57-28. (m42)

CEO Bintang Medan Terkesan ‘Cuek’ MEDAN (Waspada): Bintang Medan boleh berbangga setelah sukses mengawali laga perdananya di Liga Primer Indonesia (LPI) dengan poin penuh. Namun dari segi penyelenggaraan pertandingan masih jauh dari kesan baik plus ada beberapa catatan yang harus dibenahi untuk menuju sebuah profesionalitas. Hal itu terlihat dari minimnya penonton yang hadir di Stadion Teladan pada laga Bintang Medan kontra Atjeh United, Sabtu (22/1) lalu. Tidak seperti biasanya stadion dahulu kerap dipakai untuk menggelar laga internasional terlihat sunyi senyap. Tribun terbuka terlihat kosong, begitu juga tribun tertutup yang tidak sampai terisi separuhnya. Hanya tribun VIP yang terlihat penuh didominasi tamu dan wartawan. Beruntung ada kelompok suporter SMeCK Hooligan yang meramaikan suasana dengan nyanyian dan yel-yel, sehingga kesan sunyi seakan bisa tertutupi.

Di sisi lain, kerja kepanitiaan seperti dadakan baik dari pembentukan maupun operasionalnya. Tidak ada persiapan yang betul-betul matang. Jika ditilik panpel tidak bisa disalahkan. Menurut sumber yang enggan namanya disebut, Senin (24/ 1), awalnya pihak Bintang Medan akan menggunakan orangorang dari LPI langsung untuk mengurus pertandingan kandang. Nyatanya menjelang laga perdana, pihak Bintang Medan meminta bantuan pihak PSMS Medan sebagai mitra kepanitiaan. Menyoal minimnya penonton, tentunya faktor promosi berperan. Meski masih tergolong saudara muda PSMS, Bintang Medan tergolong klub baru dan tugas mempromosikan menjadi tanggung jawab Chief Eksekutif Officer (CEO). Dalam hal ini, Dityo Pramono (foto) mengemban jabatan CEO Bintang Medan. Anehnya, sang pemangku amanah terkesan acuh tak acuh. Bahkan untuk launching tim seperti

enggan menggelarnya. “Launching? Belum terpikirkan karena saya lebih tertarik mengundang media-media untuk memperkenalkan Bintang Medan. Nantinya, masyarakat akan tahu lewat berita di media,” tukas Dityo ketika disarankan menggelar launching beberapa waktu lalu. Jika mengandalkan media sebagai ujung tombak promosi, uniknya Dityo juga jarang berkomunikasi dengan wartawan. Meski demikian, perkenalan skuad Bintang Medan akhirnya dihelat di Lapangan Merdeka, Kamis (20/1) silam. Launching tersebut justru merupakan inisiatif Vice President LPI Regional SumateraAceh, Avian Tumengkol. Padahal hal tersebut bukan merupakan tanggung jawabnya. “Akan ada evaluasi tentunya. Ya,m ke depannya akan ada rapat dengan panpel dan langkahlangkah mendatangkan penonton lebih ramai di stadion,” tukas Dityo, Senin (24/1). (m33)

Trio Sumut Siap Bertarung

Politeknik LP3I Tekad Berprestasi

Seleknas Catur SEA Games 2011 BOGOR (Waspada): Tiga pecatur Sumut menyatakan siap mempersembahkan prestasi terbaik di ajang Seleksi Nasional (Seleknas) Catur SEA Games 2011 di Cottage Lebak Pasir Angin Gunung Geulis, Bogor, 24-29 Januari ini. Trio Sumut tersebut adalah MN Hamdani Rudin, MN Pintra Andhika dan MNW Tri Handayani. Ditemui Waspada, Senin (24/1), ketiganya sepakat menampilkan permainan terbaik demi mengangkat nama Sumut di pentas catur nasional. Maklum saja, dari 71 peserta akan ada 11 pecatur yang diambil mengikuti pemusatan latihan jelang tampil di ajang bergengsi pesta olahraga di kawasan Asia Tenggara, November mendatang. “Senang dan bangga bisa mewakili Sumut. Meski saya sendiri berasal dari Jawa Timur, menjadi wakil Sumut merupakan sesuatu yang membangga-

Waspada/Austin Antariksa

Liga Futsal Amatir Indonesia 2011

Waspada/Yuslan Kisra

MNW Tri Handayani, MN Pintra Andhika dan MN Hamdani Rudin pose bersama Wakil Sekum Pengprov Percasi Sumut Suhadi, Senin (24/1). kan. Maklum, karena Sumut terkenal banyak melahirkan pecatur handal,” ujar Tri. Menurutnya, berbekal pengalaman tampil di SEA Games 2005 Filipina dan Olimpiade Catur pada tahun yang sama, dirinya optimis bersaing untuk memperebutkan tiket Seleknas. “Target utama saya adalah

lolos seleksi. Dengan begitu, Sumut bisa meloloskan atletnya ke SEA Games mendatang. Tentunya, saya berharap dua rekan lainnya juga ikut lolos. Mohon doanya saja,” tegas Hamdani sembari memastikan dirinya akan tampil di turnamen catur Waspada Cup, Februari nanti. (yuslan)

MEDAN (Waspada): Tim futsal Politeknik LP3I Jl Gajah Mada Medan bertekad meraih prestasi maksimal pada gelaran Liga Futsal Amatir Indonesia (LFAI) 2011 yang akan berlangsung di Jakarta mulai 31 Januari nanti. “Dengan persiapan matang didukung skill individu pemain, kita optimis dapat berbuat banyak pada LFAI sekaligus menyumbangkan prestasi membanggakan bagi Sumatera Utara,��� ujar Manajer Tim Asri Sanusi SE, Senin (24/1). Tim asuhan pelatih Samsu Rahman berhak tampil di LFAI 2011 setelah menjuarai Liga Futsal Amatir Sumut yang diadakan Badan Futsal Daerah (BFD) Sumut di GOR Serbaguna Universitas Negeri Medan, 16 Januari lalu. Mengandalkan pemain yang semuanya merupakan mahasiswa, LP3I mampu mengejutkan klub-klub kuat termasuk Bank Sumut yang sudah merasakan ketatnya persaingan kompetisi Liga Futsal Indonesia (LFI). LP3I sendiri tampil juara setelah meraih kemenangan fantastis atas DPRD Sumut 4-1. “Saya juga selalu memberikan motivasi dengan mengatakan kepada para pemain untuk senantiasa percaya diri lewat motto ‘Buktikan Kalau Kita Bisa’ dan bermain dengan baik itu adalah ibadah,” ujar pelatih Samsu. Tim Politeknik LP3I Medan akan tampil di LFAI diperkuat Dimas Pranajaya, Eki, Wahab Abdi, Fahrul Rizky, Bagus Pribadi, Apriansyah, Syahidansah Lubis, Yoki, M Azwar, Dwi Angga, M Fadhli Lubis, M Iqbal, Agung, Diego, Ibnu Sasongko, Kepri dan Abdol (B’dol). (m42)

Ustadz/Ulama Harus Miliki Kebugaran Tubuh MEDAN (Waspada): Ketua Umum sekaligus pendiri Majelis Zikir Tazkira Sumut, Buya KH Amiruddin MS, mengatakan seorang ustadz/ulama tidak saja dituntut memiliki kemampuan dalam berorasi atau berpidato dan berceramah dalam berdakwah, tetapi kebugaran fisik sangat penting. “Jika seorang ustadz/ulama berpenyakitan, bagaimana audiens dan jamaahnya mau

mempercayai materi ceramahnya, sedangkan kondisinya tidak prima,” katanya dalam taushiyah pada peresmian Gedung Serbaguna/GOR dan Club House di Kompleks Perumahan Address Cempaka Prima (ACM) Jl Gaperta Ujung/Cempaka Ujung, Minggu (23/1) lalu. Dalam laga eksebisi bulutangkis, pasangan KH Zulfiqar Hajar/Buya KH Amiruddin MS mengalahkan Drs H Amhar Na-

Problem Catur Hitam melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2.

sution/Drs H Agus Thahir Nasution. Pimpinan Amanah Property Drs H Ismed Ismail SH mengatakan gedung berisikan tiga lapangan bulutangkis indoor tidak saja dipergunakan untuk kegiatan bulutangkis, juga sebagai tempat pesta dan resepsi perkawinan, wisuda hingga praktik bimbingan manasik haji, karena mampu menampung sekitar 700 orang. (m43)


Waspada/Dedi Riono

Tim Futsal Politeknik LP3I Medan diabadikan bersama usai menjuarai Liga Futsal Amatir Sumut, 16 Januari lalu. Tim ini kembali dipersiapkan menghadapi LFAI 2011.



5. Warga dari suatu negara atau bangsa. 7. Uang sogok. 8. Bersifat berlawanan dengan tindakan revolusioner atau dengan tindakan kebijakan pemerintah yang sah. 10. Orang yang terkemuka dan kenamaan (dalam bidang politik dsb). 11. Persetujuan penuh dan resmi. 13. Teori yang menyatakan setiap individu dilahirkan dengan jiwa yang putih bersih dan suci (yang akan menjadikannya baik atau buruk adalah lingkungannya). 15. Berkaitan dengan fungsi dan pelaksanaan lembaga peradilan. 16. Faktor keturunan. 18. Berhubungan dengan lembaga hukum atau lembaga yudikatif. 19. Salah satu organisasi kepemudaan (singkatan tenar). 20. Pemimpin pemerintahan (Arab populer). 21. Kerjasama dalam bidang usaha dengan bagi hasil sesuai dengan kesepakatan. 23. Paham suatu negara atau masyarakat terhadap kebudayaan sendiri berupa gerakan menolak pengaruh, gagasan atau kaum pendatang.

Waspada/Austin Antariksa

Gaston Castano (tengah) dan Faisal Azmi bertekad menjadikan PSMS Medan sebagai tim yang juga garang di kandang lawan saat meladeni PSLS Lhokseumawe, Selasa (25/1) ini.

PSMS Ingin Hapus Jago Kandang MEDAN (Waspada): PSMS Medan bertekad menghapus predikat jago kandang di putaran pertama. Bertandang ke Stadion Nusa Bangsa Lhoksumawe, Selasa (25/1) ini, skuad asuhan Suharto bertekad membuktikan PSMS juga garang di kandang lawan. Dari sembilan pertandingan, PSMS tampil lebih baik di hadapan publik dengan hasil empat kemenangan dan sekali kalah, Dari empat kali bertandang, M Affan Lubis cs hanya sekali seri dan selebihnya kalah. Hasil itulah yang diharapkan bisa menjadi motivator saat menghadapi PSLS Lhokseumawe nanti. “ Kami bertekad bisa meraih poin maksimal pada dua laga menghadapi tim dari Laskar Pase. Menghadapi PSSB, tiga poin batal didapat. Jadi target tiga poin berikutnya, bisa diperoleh di Lhokseumawe. Kalau di kandang bisa menang, berarti

di luar kandang juga bisa” ujar Asisten Manajer PSMS, Drs Benny Tomasoa. Belum terpenuhinya target maksimal di laga kandang menurutnya harus segera diakhiri untuk memperbaiki peringkat PSMS di klasemen sementara Grup I Divisi Utama 2010/2011. “Soal peringkat, PSMS belum dibilang aman. Untuk target lolos ke Liga Super, paling tidak PSMS harus masuk empat besar di putaran pertama ini. Untuk itu, tiga laga terakhir ini harus disapu bersih,” sebutnya. Melawan PSLS yang ditukangi Imran Juned itu, Suharto kemungkinan besar kembali menurunkan formasi 4-4-2. Duet Gaston Castano-Kurniawan Dwi Julianto tetap diplot sebagai starter didukung M Affan Lubis bersama Jose Sebastian, Faisal Azmi dan Zulkarnain. Di lini belakang,Vagner Luis diharapkan siap meredam

serangan lawan. “Saya rasa nanti tidak akan berbeda dengan pertandingan sebelumnya (menghadapi PSSB). Tapi yang terpenting, kesiapan pemain membuat kami bebas menentukan siapa yang diturunkan. Kita lihat saja nanti,” paparnya. Suharto pun mengaku tidak terpengaruh kabar kondisi PSLS yang sedang tidak kondusif terkait kondisi finansial “Kami tak mau berspe-kulasi. Yang jelas, kami meminta pemain untuk tampil sepenuh hati,” tegas pria yang telah mencukur habis rambutnya itu. Sementara itu, pelatih PSLS Imran Juned mencoba low profile. Menurutnya, di atas kertas, PSMS lebih unggul dari tim asuhannya yang hanya diisi skuad lokal. Kendati demikian, pulihnya kondisi pemain pasca pembayaran gaji yang terlambat membuat skuadnya siap tempur. (m17)

Medan Tembung Juara Futsal MEDAN (Waspada): Tim Kecamatan Medan Tembung meraih juara turnamen futsal yang diselenggarakan Jaringan Pemuda dan Remaja Mesjid Indonesia (JPRMI) Kota Medan di lapangan Futsal Cemara Medan, Minggu (23/1) lalu. Posisi kedua ditempati Medan Baru Star dan urutan ketiga didapat Medan Denai Star. Ketua Panitia Rahmadsyah PKS mengatakan, 24 tim mengikuti turnamen yang berasal dari 21 kecamatan. Rahmadsyah didampingi Ketua JPRMI Sumut Chandra Syuhada Sinaga SE dan Ketua JPRMI kota Medan Yusfahri Perangin-angin SP dan Sekretaris Muhammad Yusron menambahkan kegiatan ini bertemakan “Revetalisasi Semangat Pemuda dan Remaja Mesjid Dalam Mengusung Perubahan”. Terkait dengan tema terse-

Waspada/Setia Budi Siregar

Panitia Turnamen Futsal JPRMI Kota Medan foto bersama wasit yang memimpin pertandingan, Minggu (23/1). but dijelaskan Yusfahri, melalui kegiatan olahraga futsal ini JPRMI mencoba melakukan pendekatan kepada pemuda dan remaja. Sementara itu, tujuan kegiatan ini untuk menguatkan struktur kelembagaan di level kecamatan.

“Hal ini ditandai dengan keikur sertaan pengurus dalam tim peserta,” ucapYusfahri sambil mengharapkan turnamen ini juga bisa memberi kontribusi berharga membangun cita-cita, mewujudkan kesejahteraan dan keadilan rakyat. (m18)

PBSI Sumut Kunjungi Pelatnas Cipayung MEDAN (Waspada): Sejumlah pengurus Pengprov PBSI Sumut dan Pengcab PBSI se-Sumut mengunjungi Pusat Pelatnas Bulutangkis Cipayung di Jakarta dan Galeri Bulutangkis Indonesia di Cengkareng, Sabtu (22/1) lalu. “Kunjungan para pengurus cabang PBSI Sumut ini agar mereka melihat secara langsung semua fasilitas latihan yang ada di Pelatnas Bulutangkis,” ujar Ketua Umum Pengprov PBSI Sumut Ir H Johannes IW saat memimpin peninjauan di Cipayung, Jakarta Timur. Pada kunjungan itu, rombongan PBSI Sumut melihat lapangan di dalam GOR Pelatnas,


1. Komunikasi verbal; Keseluruhan tutur merupakan suatu kesatuan. 2. Kejam, tidak adil. 3. Peredaran masa atau tahun; Fase yang keadaannya sekarang dapat berulang pada suatu saat. 4. Menurut pikiran dan pertimbangan yang logis. 6. Perusakan milik pemerintah dsb oleh kelompok gerakan perlawanan bawah tanah. 8. Penyerahan suatu masalah kepada orang banyak untuk menentukannnya melalui pemungutan suara umum. 9. Pemerolehan kewarganegaraan pada penduduk asing sesuai persyaratan perundangundangan. 12. Pengesahan dokumen negara oleh parlemen, terutama pengesahan undang-undang dan perjanjian antar negara. 13. Singkatan tertanda. 14. Janji (permintaan) atau ketentuan (peraturan, petunjuk) yang harus dipenuhi dan dilakukan. 17. Nomor Induk Pegawai. 18. Pasti; Tidak salah lagi. Hakim ____ akan kesalahan terdakwa. 19. Golongan; Kelompok. 22. Senjata (Inggris).

ruang audio visual, perpustakaan, ruang fitness, mushala, lintasan atletik dan asrama atlet. Menurutnya, kunjungan tersebut diharapkan para pengurus PBSI di daerah bisa belajar sekaligus memberi pandangan kepada kepala daerah masingmasing akan pentingnya fasilitas latihan dalam upaya pembinaan dan prestasi bulutangkis. Saat kunjungan, beberapa pemain Pelatnas tidak berada di asrama karena sedang mengikuti Malaysia Open dan sebagian istirahat karena baru selesai mengikuti seleksi nasional persiapan SEA Games 2011. Di Cipayung, Johannes didampingi Ketua Dewan Penga-

was HR Sunyoto Yusuf, Wakil Ketua Umum H Muktar Aritonang dan H Ahmad Thamrin SE, Sekum Ir Syari Arwansyah, Bendahara Elly, Arion, dan M Nasir Mahmud. Pengurus PBSl se-Sumut lainnya adalah H Ahmad Thamrin SE (Medan), Parlindungan, Mulyadi (Tebing Tinggi), Azhar Nasution (Pematang Siantar), Matatias Zenrate (Labuhanbatu), Dedy (Langkat), Budi Sumalin SE (Sergai), Haris Yani Tambunan, Fahrudin Nasution (Tapsel), Antonius (Padangsidempuan), Syafaruddin Hasibuan (Palas), Hotman Kusnen (Labura) serta Bantu Banurea dan Ardin Banurea (Pakpak Bharat). (m18)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

2 1 4 3 3 9 5 1 4 4 1 5 8 6 3 1 9 6 8 9 8 6 2 5 3 6 1 2 5 9 9 2 8 6 4 2 3








Selasa 25 Januari 2011

Dolgopolov Tebar Ancaman MELBOURNE, Australia (Waspada): Unggulan keempat Robin Soderling disingkirkan petenis debutan Alexandr Dolgopolov (foto) di babak keempat Australia Terbuka 2011, Senin (24/1).


Clijsters Masih Berpeluang MELBOURNE, Australia (Waspada): Unggulan ketiga tunggal putri Australia Terbuka 2011, Kim Clijsters selangkah lebih dekat menuju gelar juara grand slam awal tahun. Petenis Belgia itu meraih tiket perempatfinal, Senin (24/1), setelah menang 76 (3), 6-2 atas Ekaterina Makarova (Rusia). Clijsters menunjukkan kelasnya sebagai mantan pemain nomor satu dunia yang pantas difavoritkan juara. Menghadapi lawannya yang lebih dulu membuat kejutan dengan mengalahkan unggulan 13 Nadia Petrova, Clijsters bermain tenang. Meskipun mendapat perlawanan gigih, Clijsters mengakhiri set pertama lewat tiebreak. Setelah itu, peraih tiga gelar grand slam ini tak mem-

Desainer Hollywood Ramaikan F1 MADRID (Waspada): Musim 2011 mendatang, mobilmobil Formula 1 akan tampil beda dibanding sebelumnya. Setidaknya hal itu berlaku setelah desainer Holywood Daniel Simon (foto) ambil bagian. Adalah tim kecil Hispania Racing (HRT) yang melakukan gebrakan tersebut. Tim bentukan Jose Ramon Carabante itu melakukan terobosan dengan mengundang desainer kondang Hollywood tersebut dalam rangka membangun mobil untuk musim mendatang. Tim asal Spanyol itu mengaku keputusan ini diambil untuk mengangkat citra perusahaan dan tim pada tahun 2011. Bagi Simon sendiri, hal ini akan menjadi tantangan baru baginya yang terkenal dengan desain futuristiknya. “Tawaran kerjasama dari Hispania Racing untuk membawa unsur-unsur kehidupan ‘Kosmik Motors’ ke dalam tim ini, adalah sesuatu yang tidak bisa saya lewatkan,” ucap Simon, Senin (24/1). “Ini akan menjadi sebuah perjalanan yang mengasyikkan bersama Hispania Racing karena saya telah lama menantikan tantangan untuk menciptakan sebuah pernyataan visual yang kuat bagi sebuah tim,” akunya. Kendati baru kali ini menjajal dunia balap, akan tetapi kiprah Simon di pentas otomotif tidak dapat dianggap sebelah mata hal itu telihat dari sejumlah garapan yang dibuatnya saat ia bekerja sama dengan Volkswagen (VW), Lamborghini dan terakhir ikut dalam pembuatan motor untuk film Tron Legacy keluaran Disney. (m33/auto)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:

berikan kesempatan k-pada Makarova untuk mengembangkan permainannya. Dengan demikian, Clijsters terus memelihara asa untuk minimal menyamai prestasi tahun 2004 ketika menjadi runner-up di Melbourne Park. Tetapi juara AS Terbuka ini harus bisa melewati rintangan unggulan 12 Agnieszka Radwanska. Petenis Polandia itu dipaksa bekerja keras sebelum melangkah ke babak delapan besar. Melawan petenis China

Peng Shuai, Radwanska beruntung meraih keunggulan 75, 3-6, 7-5. Di lain pihak, petenis Rusia Vera Zvonareva melaju ke perempatfinal dengan mudah. Zvonareva berhasil memesan tiket delaapan besar dengan mengalahkan petenis Republik Ceko Iveta Benesova 6-4, 6-1. Berikutnya, unggulan kedua ini akan berhadapan dengan Petra Kvitova. Petenis kelahiran Ceko ini menyingkirkan petenis Italia Flavia Pennetta 3-6, 6-3, 6-3. (m33/ap)

Dolgopolov, petenis peringkat 46 dunia asal Ukraina, menyingkirkan Soderling dalam pertandingan yang berlangsung lima set 1-6, 6-3, 6-1, 4-6, 6-2. Petenis berambut gondrong ini bangkit dari keterpukurukan di set pertama dan lolos ke perempatfinal. Padahal Soderling mengawali pertandingan dengan perkasa. Ia merebut set pertama 6-1 hanya dalam 21 menit, namun Dolgopolov yang baru berusia 21 tahun ini mampu membalik keadaan sekaligus mengejutkan Soderling. Di set kedua, petenis Swedia itu dibuat kebingungan oleh permainan agresif lawan. Hasilnya, Dolgopolov berhasil merebut dua set berikutnya. Soderling pun langsung menyelamatkan harapan di set keempat.

Dolgopolov pun tidak mau menyerah begitu saja. Petenis berusia 23 tahun tersebut mencoba bermain lebih tenang. Alhasil. servis kerasnya membuat Soderling tidak berdaya. Selain itu, beberapa unforced errors memaksa Soderling tertinggal dan harus menyerah di set kelima. Pada perempatfinal nanti, Dolgopolov akan berhadapan dengan petenis Inggris Andy Murray. Sebelumnya, Murray tampil sempurna untuk menyingkirkan petenis Austria Jurgen Melzer 6-3, 6-1, 6-1 di Rod Laver Arena. Unggulan teratas Rafael Nadal pun tak mengalami masalah saat menyingkirkan petenis Kroasia Marian Cilic untuk menembus perempatfinal. Jagoan asal Spanyol itu menang 6-2, 6-4, 6-3. Atas kemenangan

ini, Nadal berpeluang menjadi orang ketiga sejak 1969 untuk merebut empat titel grand slam dalam semusim. Di perempatfinal, Nadal akan menghadapi sesama petenis Spanyol, David Ferrer.

Kepastian itu didapat setelah Ferrer menumbangkan si pembunuh raksasa Milos Raonic 4-6, 6-2,6-3, 6-4. Alhasil, sepak terjang petenis Kanada itu berakhir di babak keempat. Adapun Raonic

mendapatkan julukan Si Pembunuh Raksasa setelah menyingkirkan dua petenis berpengalaman, yakni Michael Llodra (Prancis) dan Mikhail Youzhny (Rusia) di babak sebelumnya. (m33/ap)

Sumatera Utara

WASPADA Selasa 25 Januari 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:37 12:50 12:38 12:45 12:45 12:41 12:38 12:34 12:40 12:40

‘Ashar 16:01 16:13 16:01 16:08 16:07 16:05 16:01 15:57 16:04 16:03

Magrib 18:36 18:46 18:37 18:41 18:42 18:44 18:37 18:33 18:39 18:37



Shubuh Syuruq


19:49 19:59 19:49 19:54 19:54 19:56 19:50 19:46 19:52 19:50

05:09 05:24 05:08 05:18 05:16 05:08 05:07 05:03 05:10 05:11

05:18 05:34 05:18 05:28 05:26 05:18 05:17 05:13 05:20 05:21

L.Seumawe 12:43 L. Pakam 12:36 Sei Rampah12:36 Meulaboh 12:47 P.Sidimpuan12:35 P. Siantar 12:36 Balige 12:36 R. Prapat 12:32 Sabang 12:50 Pandan 12:37

06:37 06:53 06:37 06:47 06:46 06:37 06:37 06:32 06:40 06:41

Zhuhur ‘Ashar 16:06 16:00 15:59 16:10 15:59 15:59 15:59 15:56 15:13 16:01




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:40 18:35 18:34 18:45 18:37 18:35 18:36 18:33 18:46 18:38

19:52 19:48 19:47 19:58 19:50 19:48 19:49 19:46 19:58 19:51

05:16 05:07 05:06 05:18 05:02 05:05 05:04 05:00 05:24 05:04

05:26 05:17 05:16 05:26 05:12 05:15 05:14 05:10 05:34 05:14

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:37 12:38 12:48 12:41 12:38 12:44 12:33 12:43 12:36 12:35

18:38 18:38 18:44 18:42 18:36 18:42 18:33 18:42 18:37 18:34

19:51 19:51 19:57 19:54 19:49 19:55 19:45 19:55 19:50 19:47

05:04 05:07 05:21 05:09 05:08 05:16 05:02 05:13 05:04 05:05

05:14 05:17 05:31 05:19 05:18 05:26 05:12 05:23 05:14 05:15

Panyabungan 12:34 Teluk Dalam12:41 Salak 12:38 Limapuluh 12:34 Parapat 12:36 GunungTua 12:33 Sibuhuan 12:33 Lhoksukon 12:43 D.Sanggul 12:37 Kotapinang 12:31 AekKanopan 12:33

06:45 06:36 06:35 06:48 06:31 06:34 06:33 06:30 06:53 06:33

16:01 16:02 16:11 16:05 16:01 16:07 15:56 16:07 16:00 15:59

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Ratusan Karyawan Perkebunan Langkat Mogok Kerja STABAT (Waspada) : Ratusan karyawan PT Langkat Nusantara Kepong (LNK) yang berasal dari sembilan kebun dan pabrik kelapa sawit mogok kerja, Senin (24/1). Mogok yang dirangkai dengan unjukrasa itu, menuntut kejelasan status ribuan karyawan pasca kerjasama operasi (KSO) antara PTPN II dengan PT LNK yang merupakan perusahaan asal Malaysia.

Unjukrasa di Kantor Manajer Gohor Lama di Kec. Wampu berlangsung tertib. Koordinator aksi yang jugaWakil Ketua Serikat Pekerja Perkebunan (SP BUN)

NurdinTurnip mengaku prihatin dan meminta pemerintah memfasilitasipermasalahanpengalihan status karyawan dari PTPN II ke PT LNK.

Pengalihan status itu, menurutnya, selain bakal merugikan pekerja harian lepas, juga status pensiunan karyawan bakal tidak jelas. Kekhawatiran lain bagi ribuan karyawan, adanya kabar pengalihanstatuskeanakPTLNK yakni Kepong Plantation Holdings. “Kamitidakmauinvestorasal Malaysia mengobok- obok negeri ini. Kami mau kejelasan sebelum bataswaktuJuli2011,”kataperwakilan dari ratusan karyawan sambil membentangkan bendera

merah putih sepanjang 20 meter dan sejumlah poster di depan Kantor Manajer PT LNK Gohor Lama, Kec.Wampu. Diakui beberapa karyawan, pasca KSO PTPN II dengan PT LNK , karyawan merasahubungantidakharmonis dengan masyarakat setempat, sebab banyak jalan yang diputus untuk pembangunan parit besar sebagai batas wilayah. Jaminansosialkaryawanjuga tidak jelas setelah kebun beralih dikuasaiPTLNK.Kemudian,status kenaikan golongan dan gaji juga

tidak jelas serta penghasilan bulanan diklaim karyawan menurun. Mereka belum mengetahui kapan berakhirnya masa kontrak dan kepemilikan saham PT LNK. Menyikapi tuntutan karyawan, Manajer PT LNK Gohor Lama Iwan Poli mengatakan, pihaknya tidak dapat sembarangan mengambil keputusan atas tuntutan status karyawan, sebab harus dimusyawarahkan lebih lanjut. (a38/a01)

STABAT (Waspada): Julia, 32, warga Jalan M. Nawi Harahap Stabat kehilangan sepeda motornya dalam rumah, Minggu (23/ 1). Saat kejadian korban tidak berada di rumah, melainkan sedang belanja ke Binjai dan meninggalkan rumah dalam keadaan kosong. Sementara sepeda motor Honda Beat BK 2083 PAD miliknya diparkir dalam rumah. Setelah kembali pulang sore hari, korban melihat pintu belakang rumahnya dalam keadaan terbuka. Lemari pakaiannya terlihat bekas diobrak-abrik dan sepeda motornya raib. Setelah berusaha mencari dan menanyakan kepada para tetangga walau tidak berhasil menemukan sepeda motor warna merahitu,JuliamembuatpengaduankePolsekStabatataskejadian. Korban menderita kerugian belasan juta. (a38)

BINJAI (Waspada) : Polsek Binjai Utara dipimpin Kanit Res, AKP Lintas Pasaribu, Minggu (23/1) pukul 04:00 meringkus dua pria pesta ganja masing-masing DNS, 24, kernet chainsaw kayu dan MB, 24, pekerja bengkel, keduanya warga Jalan Anggrek, Kelurahan Pahlawan, Kecamatan Binjai Utara. Kedua pria itu diringkus ketika mengisap ganja di pembibitan ikan jalan Perintis Kemerdekaan, Kecamatan Binjai Utara. Selain mengamankan kedua pria itu, sebagai barang bukti, satu bungkus ganja, satu bungkus biji ganja, 2 lembar kertas tiktak dan 1 bungkus rokok putih. Kapolres Binjai, AKBP Dra Rina Sari Ginting melalui Kapolsek Binjai Utara Kompol Kuasa Purba ketika dikonfirmasi membenarkan. Penyidik Polsek Binjai Kota masih memeriksa keduanya dari mana diperoleh mereka ganja yang diisapnya, untuk memudahkan meringkus pengedar mau pun bandar besarnya ujarnya. Keterangan lain diperoleh, kedua pria pernah mendekam pengapnya Lembaga Permasyarakatan (LP) Binjai, terkait kasus penganiayaan pada tahun 2007 lalu. (a04)


MOU: Pj Walikota Tebingtinggi Drs H Eddi Syofian, MAP disaksikan Rektor Unimed Prof Dr Syawal Gultom, MPd, Ketua Dewan Pendidikan Tebingtinggi Prof. Darmono, Kadis Pendidikan Tebingtinggi Drs H Pardamean Siregar, Pembantu Rektor IV Prof Berlin Sibarani, MPd, Dekan FMIPA Unimed Prof Manihar Situmorang, MSc, PhD, di ruang rapat rektor menandatangani perjanjian kerjasama bidang pendidikan dengan Unimed di ruang rapat Biro Rektor Unimed, Jl.Willem Iskandar Medan Estate, Senin (24/1).

T. Tinggi Menuju Kota Pendidikan Pemko Tebingtinggi-Unimed Jalin Kerjasama

DIANIAYA: Tahanan Polsek Stabat kasus pencurian, KA, 26, memperlihatkan bekas penganiayaan yang dilakukan oknum Polsek Stabat, Senin (24/1).

MEDAN (Waspada): Untuk menciptakan Kota Tebingtinggi sebagai Kota Pendidikan, Pj WalikotaTebingtinggi Drs H Eddy Syofian, MAP melakukan perjanjiankerjasamadenganUniversitas Negeri Medan untuk membangun pendidikan dan peningkatan mutu pendidikan di kota itu. Penandatanganankerjasama (MoU) langsung dilakukan Pj. WalikotaTebingtinggi Eddy Syofian dan Rektor Unimed Prof Dr SyawalGultom,MPdyangdisaksikan Ketua Dewan Pendidikan Tebingtinggi Prof. Darmono, Kadis Pendidikan Tebingtinggi Drs H Pardamean Siregar, Pembantu Rektor IV Prof Berlin Sibarani,MPd,DekanFMIPAUnimed Prof Manihar Situmorang, MSc, PhD, di ruang rapat rektor, Senin (24/1). Eddy Syofian menyebutkan, kerjasama ini merupakan untuk melanjutkan komitmen Pemko Tebingtinggi yang telah dilakukan walikota terdahulu, terutama untuk meningkatkan mutu dan kualitas pendidikan di Tebingtinggi dimulai dari meningkatkan kualitas guru dalam melaksanakan pendidikan, peningkatan kualitas kurikulum, proses belajar mengajar. Kemudian bagaimana merancang grand design pendidikan yang diawali dari TK, SD, SMP, SMA dan SMK dan bagaimana semua guru-guru yang terlibat terutama pimpinan-pimpinan di sekolah memahami bagai-

Tahanan Polsek Stabat Mengaku Dianiaya Polisi

Warga Ultimatum Pengelola Usaha Hiburan

STABAT (Waspada): KA, 26, tahanan Polsek Stabat kasus pencurian mengaku dianiaya polisi dalam sel dan di ruangan juru periksa. Dia mengatakan, polisi menjepit kedua telinganya dengan jepitan besar, menghekter tangan dan punggungnya serta memukul dengan tangan langsung di dalam sel. ’’Semua itu terjadi sekitar sepekan silam, saya masih tanda oknum Polsek yang menganiaya saya,’’ ujarnya seraya memperlihatkan bekas pukulan, Senin (24/1). Meski sebagian bekas penganiayaan telah hilang, KA mengaku sewaktu oknum Polsek memukulnya dalam sel tahanan, dua tahanan lain melihat langsung.Tersangka kasus pencurian emas itu tidak dapat mengadukan langsung penganiayaan yang dialami dirinya karena pihak keluarga tidak ada membesuk di sel. Akhirnya beberapa hari kemudian dia menghubungi orangtuanya via telefon dan mengadukan perilaku oknum Polsek terhadap dirinya. Sementara orangtua tersangka, Leo, telah membuat pengaduan ke Unit Propam Polres Langkat terkait penganiayaan yang dilakukan oknum Polsek Stabat, Senin (24/1) sore. Wakapolsek Stabat Iptu Abdul Samad ketika dimintai konfirmasinya, mengaku belum mengetahui adanya tahanan yang mengaku telah dianiaya bawahannya. ’’Kemarin saya bersenda gurau dengan mereka, tidak ada yang mengeluh. Namun nanti tetap akan saya cek kebenarannya,’’ ujar Wakapolsek. Pengakuan tersangka dianiaya oknum Polsek itu langsung didengar abangnya yang sedang menjenguk, juga disaksikan dua wartawan cetak. (a38)

LIMAPULUH (Waspada) : Kalangan tokoh masyarakat memberikan ultimatum kepada pemilik usaha hiburan berkedok warung di pinggir Jalinsum di Desa Petatal dan Sei Muka, Kec. Talawi, Kab. Batubara, jika tidak mengindahkan kesepakatan yang telah dibuat bersama. Hal itu dikemukan Asbi, salah seorang tokoh pemuda di Batubara didampingi ustadz Kaharuddin Damanik, Bambang Sugito, Ismail Yahya, Syafri Nainggolan, H Zulhamdi Ambarita, M.Yakub,NaharuddindanKadus Endi Sriwibowo, Senin (24/1). Sedangkan kesimpulan pertemuan itu, menurut CamatTalawi Luthfi, membuahkan enam poinkesepakatanantaralaintidak membunyikan musik yang keras, tidak kondisi remang-remang. Apalagi menjual minuman keras dan menyediakan wanita penghibur. Sedangkan bagi pelayan ditekankanberpakaiansopandan

Waspada/Abdul Hakim

06:33 06:36 06:50 06:38 06:37 06:45 06:31 06:42 06:33 06:34

Zhuhur ‘Ashar 15:58 16:05 16:02 15:58 16:00 15:57 15:57 16:05 16:01 15:55 15:57




Shubuh Syuruq

18:37 18:44 18:39 18:33 18:36 18:35 18:36 18:39 18:38 18:33 18:34

19:49 19:57 19:52 19:46 19:49 19:48 19:48 19:52 19:50 19:46 19:46

05:00 05:06 05:07 05:04 05:05 05:00 04:59 05:15 05:05 04:59 05:02

05:10 05:16 05:17 05:14 05:15 05:10 05:09 05:25 05:15 05:09 05:12

06:29 06:35 06:36 06:33 06:34 06:30 06:29 06:44 06:34 06:28 06:31

Drs H Lukmanul Hakim Siregar Kembali Pimpin MUI DS LUBUK PAKAM (Waspada): Drs H Lukmanul Hakim Siregar dipercayakan kembali memimpin Majelis Ulama Indonesia (MUI) Kabupaten Deliserdang periode 2011-2016 melalui Musyawarah Daerah (Musda) MUI-III yang dibuka bupati Deliserdang melaluiWabup H Zainuddin Mars di Aula Cendana kantor bupati Deliserdang, Lubuk Pakam, Sabtu (22/1). DrsHLukmanulHakimSiregarsebagaiKetua Umum dalam kepengurusan ini didampingi Sekretaris Umum Drs H Ahmad Zainuddin Sinaga, Bendahara H Hanafi, S.Sos dibantu 10 orang Wakil Ketua, 10 Wakil Sekretaris, 2 Wakil Bendahra dan 10 Ketua Komisi. Bupati Deliserdang Drs H Amri Tambunan dalam sambutan tertulis disampaikan Wabup H Zainuddin Mars mengatakan, ke depan kita akan menghadapi berbagai tantangan yang sama-sama kita ketahui adanya penurunan pemahaman dan pengamalan ajaran agama di tengah-tengah masyarakat.

Hal ini jelas merupakan salah satu faktor yang berdampak pada tandusnya akhlak, budi pekerti umat khususnya di kalangan generasi muda yang kita harapkan akan tampil menjadi generasi penerus pejuang cita-cita bangsa. Wakil Ketua MUI Sumut H Maratua Simanjuntak menyampaikan terimakasih kepada PemkabDeliserdangyangtelahmendukungperjalanan organisasi MUI di daerah ini. Karena peran MUI sangat diharapkan bagi terciptanya negeri yang baik serta mendapat lindungan dari Allah SWT Tuhan Yang Maha Kuasa. Hadir pada pembukaan Musda MUI III Deliserdang, unsur Muspida, Dandim 0204/DS Letkol ArhWawik Dwinanto, S.Sos, Kapolres AKBP Pranyoto, SIK, Ketua KPU Drs Mohd Yusri, MSi, Kepala Kantor Kementerian Agama (Kakankemenag) Deliserdang Drs H Dur Berutu, MA, Asisten I Setdakab Drs HM Iqbal Nasution, sejumlah pejabat Pemkab Deliserdang serta undangan lainnya.(a05)

Dua Pencari Kerja Tertipu Calo

Ditinggal Belanja, Sepeda Motor Hilang

Polsek Binjai Utara Ringkus Dua Pria Pesta Ganja


mana merancang dan membangun program-program pendidikan ke depan. “Oleh karena itu, workshop bagaimana cara membuat visimissi, membuat program-program terhadap mutu pendidikan itumenjadiskalaprioritasutama,” ujarnya. Selain itu, lanjutnya, membangunbudayakompetitif,menghargaioranglain,mengakuikualitas dan semangat budaya ini yang harus ditumbuhkembangkan agar anak didik bangsa ini akhirnya secara global bisa mengakui persamaan-persamaan. “Karena kita tidak bisa lagi hidup seperti katak di bawah tempurung, tetapi kita sudah hidup di dunia global. Oleh karena itu bagaimana kehidupan global dan aturan mainnya harus disesuaikan dan itu tidak ada jalan lain kecuali melalui pendidikan, sehingga apa yang sudah dirintis menjadikan Kota Tebingtinggi menjadi kota pendidikan harus segera diwujudkan,” ujarnya. Membangun Budaya Sementara itu Rektor Unimed, Syawal Gultom menyebutkan, apa yang sudah dilakukan di Tebingtinggi selama ini sudah bagus,karenaitusebenarnyaUnimed hanya mengawal agar pendidikandiTebingtinggiuntuklebih baik lagi. Syawal Gultom berpesan, pendidikan itu warisan terbesarnya adalah membangun bu-

melaporkan diri ke Kadus maupun Kades. ‘’Ini kesimpulan dari pertemuan masyarakat dengan pengusahayangdihadiriinstansiterkait dan Muspika selain membuat pernyataan,’’ katanya. Bagi yang melanggar maupuntidakmengindahkankesepakatan ditindak tegas dengan menutup warung usaha/cafe oleh instansi terkait. Tindakan Serius Menanggapi maraknya warung yang diduga tempat maksiat di berbagai tempat di Batubara menjadi persoalan sendiri bagi masyarakat. ‘’Di sini dibutuhkan ada tindakan serius dari berkempoten karena dampaknya begitu masif terutama moral bagi anakanak remaja,’’ kata anggota F PPP DPRD Batubara Al-As’ari. Dia mengaku persoalan itu bukanhanyamenjaditanggungjawab perseorangan tapi seluruh elementerutamadinasterkait.(a11)

daya, membangun karakter, oleh sebab itu perlu dilakukan bagaimana mengubah paradigma sekolah menjadi pusat budaya, pusat peradaban, karena produknya itu adalah lulusan atau orang-orang yang memiliki karakter sesuai dengan cita-cita luhur dari negeri ini. Meski ilmu pengetahuan diberikan pada bidang studi apa pun, lanjutnya, tetapi muaranya harus menjadikan orang yang berkarakter. Di Kementerian Pendidikan Nasional, sekolah targetnya adalah melahirkan insan cerdas dan konfrehensif. “Artinya budaya saingnya itu baik dinasionalmaupuninternasional bisa layak tanding. Itu alasan saya, bagaimana kita konsisten dan fokus untuk mengawal orientasi pendidikan kita itu orientasi insan cerdas yang konfrehensif,” tegasnya. Ketua Dewan PendidikanTebingtinggi,Prof.Darmonomenilai kerjasama tersebut merupakan kegiatan yang sangat baik dalam membangun Kota Tebingtinggi menjadi Kota Pendidikan ke depan sebagaimana yang dicitacitakan walikota sebelumnya. “Nah sekarang dengan MoU antara Unimed-Tebingtinggi merupakan action yang akan ditekankan dalam membangun pendidikandiTebingtinggidalammeningkatkan mutu pendidikan ke depan lebih baik,” ujarnya. (m41)

SEI RAMPAH(Waspada): Sempitnya peluang kerja di instansi pemerintahan ataupun BUMN mengakibatkan semakin banyaknya pengangguran. Setiap adanya pengumuman penerimaan tenaga kerja baik itu di pemerintahan maupun perusahaan swasta ribuan orang yang mencoba untuk melamar. Namun dalam pelamaran itu hanya sedikit sekali yang berhasil lolos dan itupun orang orang yang punya uang dan backing. Kondisi itu menjadi peluang “usaha” bagi JS, 43, warga Jl Sei Berantas, No 8 Medan. Dengan kemampuan lobbi dan mengaku banyak relasi di perusahaan perkebunan milik BUMN itu, pria yang mengaku sebagai kontraktor tersebut bisa meluluskan para korbannya untuk bekerja di PTPN III dan anak perusahaannya. Tetapi itu hanya janji manis pelaku sewaktu merayu para korban untuk menyerahkan uang kepadanya, sebagai dana stimulus bagi pejabat yang akan dilobbinya nanti agar korban mudah

menjadi karyawan plat merah tersebut. Kebohongan pelaku semakin kentara, ketika awal diserahkannya uang pada Aprill 2009 oleh korban yang bernama Mi’in, 50, warga Desa Simpang Empat, Kec. Sei Rampah, Kab. Serdang Bedagai, serta Marni, 46, warga Lingkungan III, Kel. Karya Jaya, Medan. Kedua korban secara cicil telah meyerahkan uangnya kepada pelaku melalui kaki tangannya sebesar Rp200 juta. “Korban melalui rekannya menemuipelakudanmenyerahkanuangtersebut untuk biaya menjadi karyawan PTPN III dan RS Pamela secara angsur yang nilainya mencapai Rp 200 juta,” kata sumber. Ternyata, semua janji pelaku tidak ditepati sehingga kedua korban mencari JS kerumahnya. Karena dikhawatirkan terjadi hal-hal yang tidak di inginkan Polsek Delitua menyerahkan pelaku dan korban ke Polres Serdang Bedagai untuk di proses secara hukum. Pelaku masih dalam proses pemeriksaan penyidik Polres Serdang Bedagai.(a07)

Tarif PDAM Tirta Kualo Berpotensi Rugikan Konsumen TANJUNGBALAI (Waspada) : Sekretaris Komisi B DPRD Tanjungbalai Hakim Tjoa Kian Lie menilai tata cara penetapan tarif air PDAM Tirta Kualo KotaTanjungbalai selama ini membingungkan, sehingga berpotensi merugikan konsumen. Maka itu, tegasnya, Direktur PDAM diingatkan agar mengelola manajemen perusahaan secara profesional dengan mengutamakan pelayanan maksimal kepada para pelanggan. “Menurut laporan konsumen, pelanggan kategori R2 memakai air 30 meter kubik dengan biaya tagihan Rp60 ribu. Sementara, tarif dasar air ditetapkan PDAM pasca kenaikan, hanya Rp1.200 per meter kubik,” ujar Hakim di kantor DPRD Kota Tanjungbalai, Senin (24/1). Seharusnya, jika merujuk pada tarif dasar air PDAMTirta Kualo itu, kata Hakim, biaya yang dikenakan kepada konsumen tersebut hanya Rp36 ribu. “Kalikan saja 30 meter kubik dengan Rp1.200, hasilnya Rp36 ribu bukan Rp60 ribu,” ujar Hakim. Untukitu,politisiPDIPinimendesakDirektur PDAM Ismed Daulay serius mengelola perusa-

haan daerah itu demi kepentingan masyarakat. Selain itu, Hakim mengimbau Badan Pengawas PDAMmampumenjalankantugassesuaitupoksi. Sedangkan aktivis LSM Kota Tanjungbalai HA Sibarani menduga, pengelola PDAM tidak proporsional menghitung pemakaian para konsumen,sehinggatagihanairtidaksesuaidengan tarif dasar. “Dikhawatirkan, petugas jarang meninjau meteran konsumen, sehingga tagihan yang diberikan ke pelanggan hanya di reka-reka saja. Ini masih dugaan ya, memang meteran air di rumah pun jarang dicatat petugas PDAM,” tutur Sibarani. PDAMTirta Kualo KotaTanjungbalai menaikkan tarif dasar air dari Rp600 menjadi Rp1.200 per meter kubik terhitung sejak Februari 2010. Kenaikan tarif itu untuk menyesuaikan harga jual air terhadap harga pokok air dengan mempertimbangkan biaya operasi secara rutin guna tercapainya kecukupan finansial (BEP) maupun profit. Selain itu, juga untuk melindungi kepentingan konsumen atau pelanggan serta menjaga kepentingan para stakeholder lainnya. (a37)

Nelayan Diminta Sabar Tunggu Kapal Patroli DKP LIMAPULUH (Waspada): Kadis Kelautan dan Perikanan Kab Batubara Azwar Hamid meminta nelayan bersabar soal rencana kedatangan kapal Patroli DKP. “Kapal patroli yang dibuat di Jakarta itu sudah siap, tetapi tak bisa berlayar karena cuaca yang buruk. Nama kapal ‘Singo Laut’,” ujar Azwar, pekan lalu. Selama ini, kata Azwar, pihaknya melakukan pengawasan dan patroli di laut memakai kapal nelayan, sehingga dituding melanggar peraturan

dan kurang berhasil. Diakuinya selama ini pihaknya sesekali melakukan patroli karena tidak memiliki kapal, namun bila terjadi masalah seperti pencemaran laut dan di sungai pihaknya harus turun ke laut Menyinggungadanyapengutipandilautpakai tangguk, Azwar menyatakan, kalau ada pegawainya yang bertugas di laut melakukan pungli di laut agar dilaporkan. “Saya akan tindak pegawai DKP terlibat pungli pakai tangguk di laut. Yang terlibat akan diusulkan dipecat,” jelas Azwar. (a30)

Waspada/Muhammad Zeini Zen

PEMBEKALAN: Sebanyak 25 camat se Kabupaten Asahan, Senin (24/1) berangkat ke Jakarta mengikuti pembekalan dan peningkatan kapasitas camat di Diklat Departemen Dalam Negeri (DDN) Kalibata Jakarta Selatan hingga akhir pekan ini. Pembekalan ini dimaksudkan untuk lebih meningkat kualitas kinerja para camat yang baru dilantik beberapa waktu yang lalu. Sebelum berangkat ke Jakarta yang di antaranya Camat Kisaran Timur Rahmat Hidayat Siregar dan Camat Teluk Dalam Ajim Manik dilepas Bupati Taufan Gama Simatupang yang dalam sambutannya mengingatkan para camat untuk sungguh-sungguh dalam mengikuti kegiatan itu sehingga dapat mengaplikasikan ilmunya sepulang dari Jakarta.


Sumatera Utara

Pantai Batubara Perlu Direhabilitasi


Alihfungsi Hutan Melanggar Hukum

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

Waspada/Rahmad F Siregar

BELUM TERJADWAL : Pelantikan Drs H Thamrin Munte,M.Hum-Rolel Harahap,SE sebagaiWalikota dan Wakil Walikota terpilih Kota Tanjungbalai, belum ada kepastian. Penyebabnya, sampai Senin (24/1), Mendagri tak kunjung mengeluarkan surat keputusan pengesahan pengangkatan pasangan itu.

Pelantikan Walikota T. Balai Terpilih Belum Terjadwal TANJUNGBALAI (Waspada) : Pelantikan Walikota dan Wakil Walikota Tanjungbalai terpilih belum dapat dipastikan. Penyebabnya, Surat Keputusan Mendagri tak kunjung keluar, kendati pelaksanaan Pilkada dan putusan Mahkamah Konstitusi atas sengketa Pilkada Tanjungbalai rampung pada 17 Desember 2010 lalu. “ Belum ada agenda pelantikan, sebab SK Mendagri belum selesai,” kata Sekretaris Dewan Abdi Nusa menjawab Waspada Senin (24/1).Menurut Abdi, sampai hari ini, permohonan penge-

sahanpengangkatanWalikotadan WakilWalikota terpilih, Thamrin Munthe-Rolel Harahap, sebagai Kepala Daerah KotaTanjungbalai periode 2010-2015, masih berada di Mendagri. “ Agenda pelantikan tergantung pada SK, jika sudah turun barulah kita segera agendakan,” ujar Abdi. Dijelaskan Abdi, jika SK turun, maka pihaknya akan kordinasi dengan Ketua DPRD, dan selanjutnya ke Gubernur Sumut untuk menjadwalkan pelantikan. Di tempat terpisah, Divisi Humas KPU Kota Tanjungbalai Amrizal mengakui pihaknya belum menerima pemberitahuan pelantikanWalikota danWakil Walikota terpilih. “ Sampai hari ini KPU memang belum menerima pemberitahuan yang sifatnya undangan,” kata Amrizal.

Dia menjelaskan, untuk prosesi pelantikan, selaku pihak terkait,KPUhanyaterlibatsebagai kepantiaan. Sementara untuk urusan permohonan SK pelantikan, menurut Amrizal, itu adalah wewenang DPRD.“ Secara teknis, tugas kita hanya sampai pada merekomendasikan usulan pengesahanpengangkatanWalikota danWakilWalikota Tanjungbalai terpilih ke DPRD Kota Tanjungbalai,” jelas Amrizal. Berdasarkan putusan Mahkamah Konstitusi No. 166/ PHPU.D-VIII/2010, pasangan calon nomor urut 1 Drs H Thamrin Munthe,M.Hum dan Rolel Harahap, ditetapkan sebagai pemenang Pilkada Kota Tanjungbalai karena meraih suara tertinggi yakni 23.736 suara atau 35 persen. (a37)

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Akses Jalan Rusunawa Rusak Parah Akibat Pembangunan

Hubungi kami

TANJUNGBALAI (Waspada) :Aksesjalanmenujurumahsusun sederhana sewa (Rusunawa) rusak parah akibat proyek pembangunanrumahsusunyangketiga di Kel. Seiraja, Kec. Seitualang Raso, Kota Tanjungbalai. Pantauan di lapangan, untuk melintasi jalan rusak tersebut, pengguna jalan harus ekstra hatihati karena dikhawatirkan menyebabkanterjadinyakecelakaan, sebab badan jalan hanya dilapisi tanah merah dan bebatuan besar. “Sering pengendara sepeda motor terjatuh, bahkan nyaris tidak dapat dilalui saat hujan turun,” ujar Ibrahim Tarigan, Senin (24/ 1). Dikatakan, pemilik becak bermotor yang sehari-hari mangkal di depan rusunawa tersebut mengaku masuknya truk pengangkut material bangunan yang melebihi muatan penyebab utamakerusakan,sementaradaya tahan jalan tidak memadai. Menurutnya, kerusakan bermula sejak proyek pembangunan itu dimulai tiga bulan lalu, padahal sebelumnya jalan tersebut mulus tanpa kerusakan dengan lapisan hotmix dan menjadi akses utama warga menuju rusunawa. Seorang pekerja bongkar muat proyek Jefri Nasution mengatakan, selama proyek pembangunan berjalan, diperkirakan

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Korem 022/PT Tes Urine Prajurit Dan PNS P. SIANTAR (Waspada): Korem 022/PT melaksanakan tes urine bagi prajurit dan PNS Korem 022/PT sebagai salah satu tindakan preventif terhadap penyalahgunaan narkotika terkait maraknya peredaran barang terlarang itu. Danrem 022/PT Kolonel Inf Karsiyanto selesai menjadi Irup saat upacara bendera gabungan, langsung melaksanakan jam komandan sekaligus melaksanakan tes urine itu di aula Makorem 022/PT, Jalan Asahan, Km 3,5, Pematangsiantar, Senin (24/1). Saat jam komandan, Danrem menyampaikan hak dan kewajiban sebagai prajurit dan operasi penegakan Gaktib, Jumat (21/1) bertujuan menekan terjadinya pelanggaran prajurit. Terkait maraknya peredaran narkotika, sebut Danrem, Korem 022/PT tes urine terhadap seluruh personel Makorem 022/PT dan dinas jawatan. Dan tes urine serta darah akan dilaksanakan berlanjut maupun mendadak di satuan-satuan jajaran Korem 022/PT. SedangkanKapenrem022/PTMayorCajDrs.Prinaldimenambahkan, tes urine oleh Rumkit TNI di bawah koordinator Dandenkesyah 01-04-01 Pematangsiantar Letkol Ckm dr. Bestari Hutagalung, SpB. “Tes urine 347 prajurit dan PNS Makorem 022/PT serta dinas jawatan jajaran Korem 022/PT. Bila terindikasi narkotika akan ditindak dan diproses secara hukum yang berlaku. Tes urine ini akan dilaksanakan sampai ke seluruh Kodim jajaran Korem 022/PT dan ini baru pertama kali dilaksanakan di wilayah Kodam I/BB,” terang Kapenrem.(a14)

WASPADA Selasa 25 Januari 2011

LIMAPULUH (Waspada) : Kawasan pantai Batubara perlu direhabilitasi secara dini dengan menanam kembali bibit Mangrove (bakau) mengingat kondisi hutan telah punah. Kondisi itu akibat dirambah dan dialihfungsikan menjadi perkebunan kelapa sawit baik dikuasai secara peroranganmaupunkelompokdanbadanusaha (PT). ‘’Ini perlu dilakukan oleh Dinas Kehutanan selakuyangbertanggungjawabdemimenghindari terjadinya tingkat abrasi yang lebih tinggi menghantam daratan pantai yang berakses menimbulkan bencana bagi penduduk seperti banjir pasang,’’ kata Koordinator LBH Publiek Asahan, Batubara danTanjungbalai Zasnis Sulung, Senin (24/1) terkait hampir 70 persen terjadi kerusakan hutan Mangrove di sepanjang pantai Batubara. Menurut aktivis lingkungan hidup itu, program rehabilitasi hutan tidak semata dilakukan pemerintah, namun lebih berarti lagi melibatkan atau mengikutsertakan masyarakat agar mereka lebih merasa memiliki untuk memelihara kawasan pantai. ‘’Di sini mereka tidak semata terlibat dalam menanam, namun bisa mengawasi dan memelihara kawasan yang direhabilitasi dari kepunahan perbuatan tangan jahil, sehingga terlihat

adil masyarakat cukup besar dalam memelihara lingkungan,’’ ujarnya. Apalagi bila ditelusuri, Pemkab Batubara dipimpin OK Arya Zulkarnain saat ini terfokus untuk membangun wilayah pantai ditandai dengan berdirinya kantor pemerintah di Desa Perupuk dan Gambus Laut, Kec. Limapuluh. ‘’Ini suatu terobosan yang baru dapat didukung dengan melestarikan kawasan pantai agar tingkat abrasiyangterjadidapatteratasi,’‘ujarnya.Disamping fungsi hutan juga dapat melindungi habitat laut danberkembangbiakakhirnyanantibisamenambah sumber pendapatan nelayan. Diancam hukuman Dirinya mengaku alihfungsi hutan pantai di Bantubara sudah terjadi sejak lama sebelum Batubara dimekarkan menjadi kabupaten defenitif sekaligus dapat menindaklanjuti ke jalur hukum sepanjang kawasan yang dialihfungsi melanggar batas ditentukan sebagaimana paraturan UU No 41 Tahun 1999 tentang hutan. Di dalamnya secara tegas dikatakan pelakunya dapatdiancamhukumankurungandanmembayar denda Rp5 miliar. Meskipun mereka telah melakukan pemulihan kembali kawasan dialihfugsikan itu. ‘’Karena mereka sudah terlanjur berbuat melakukan itu,’’ katanya. (a11)

Menaikkan Harga Raskin Di Batubara Minta Diusut LIMAPULUH (Waspada) :Tindakan seorang oknum kepala desa maupun staf desa yang sengaja mengambil kesempatan mengaut keuntungan atas penderitaan warga miskin (gakin) di Batubara perlu diusut tuntas “Tindakan naif yang dilakukan oknum Kades/staf desa dengan menaikkan harga raskin sebesar 25 persen tidak dapat ditolerir. Karena itu warga meminta pihak berwenang mengusut tuntas,” harap warga Desa Bagandalam, Tanjungtiram, Senin (24/1). Apalagi warga cukup patuh mem bayar lebih dulu baru dapat raskin. Ternyata kepatuhan warga dimanfaatkan mencari keuntungan tanpa kasihan atas nasib warga miskin setempat.

Menanggapi harga raskin dinaikkan melebihi ketentuan,menurutKetuaKomisiADPRDBatubara Sakroni sungguh disesalkan. Karena saat ini impitan ekonomi dirasakan warga paling pahit, apalagi bagi warga tak mampu Ditambahkan, tindakan oknum Kades dan staf Desa Bagandalam menaikkan harga raskin jelas melanggar ketentuan pemerintah. Masalah‘raskin’ merupakan program pemerintah secara nasional dan tidak siapapun bisa menaikkan harga yang sudah ditetapkan Rp1.600 per kg, walaupun ada keputusan 8PD menyetujui harga raskin tambah Rp200 yang naik menjadi Rp1.800 per kg. (a30)

APBD P. Siantar 2011 Belum Jelas P. SIANTAR (Waspada): APBD Kota Pematangsiantar 2011 belum jelas hingga akan berakhirnya awal TA 2011, karena DPRD masih akan membahas enam Ranperda yang diajukan Pemko dan belum masuknya laporan keuangan Pemko Triwulan IV APBD TA 2010. “Bagaimana mungkin RAPBD dibahas, sementara Pemko baru menyerahkan enam Ranperda yang berkaitan dengan penggunaan anggaran dan laporan keuangan Pemko triwulan IV belum masuk ke DPRD,” cetus Ketua DPRD Marulitua Hutapea, SE didampingi Ketua Komisi II Kennedy Parapat, SE dan anggota DPRD lainnya di ruang kerja Ketua DPRD, Senin (24/1). Parapat menambahkan Rencana Pembangunan Jangka Menengah (RPJM) lima tahun ke depan sesuai visi dan misiWalikota Hulman Sitorus, SE dan Wakil Walikota Drs. Koni Ismail Siregar periode 2010-2015 sampai saat ini belum diserahkan Pemko hingga arah pembangunan Pematangsiantar lima tahun ke depan belum diketahui secara pasti. Menurut Hutapea, enam Ranperda yang disampaikan Pemko terdiri Ranperda retribusi daerah,pajakdaerah,pembentukanBadanPenanggulanganBencanaDaerah(BPBD),perubahan pertama atas Perda No. 3/2010Tentang Susunan Organisasi dan Tata Kerja Dinas-Dinas, perubahan pertama atas Perda No. 4/2010 Tentang Susunan Organisasi dan Tata Kerja Lembaga Teknis Daerah serta Penyelenggaraan Administrasi Kependudukan dan Catatan Sipil, saat ini masih dibahas di Badan Legislasi DPRD.

“Sesudah enam Ranperda itu masuk ke DPRD, kamilangsungmengadakanrapatgabungankomisi dansependapatmerekomendasikanenamRanperda itu dibahas di Badan Legislasi DPRD sebelum akhirnya dibahas dalam rapat paripurna DPRD,” terang Hutapea. Menurut Hutapea, sesuai informasi dari Badan Legislasi, Pemko belum menyerahkan seluruhnya bahan pembanding yang diminta Badan Legislasi sepertiPerdasebelumnyahinggamembuatpembahasan di Badan Legislasi cukup lama. Menyinggung rencana Pemko membentuk BPBD, Hutapea dengan tegas menolaknya dan akan dipertimbangkan secara matang apakah Ranperda tentang BPBD itu akan diterima atau tidak. “Topografi Pematangsiantar bukan rawan banjir,longsordangempabumi.BPBDitucocoknya ada di provinsi dan kalau pun ada daerah lain membutuhkan bantuan akibat bencana, sudah ada Dinas Sosial yang menanganinya.” Tentang pembentukan Dinas Pasar, Hutapea menyatakanakandibawakerapatgabungankomisi dan Badan Legislasi, karena sesuai hasil kunjungan kerja DPRD ke daerah lain baru-baru ini, DPRD berpendapat pasar sebaiknya dikelola Badan Usaha Milik Daerah (BUMD). “Pembentukan Dinas Pasar itu pun nantinya akan kami pertimbangkan dan akan dibawa ke rapat gabungan komisi.” Menjawab pertanyaan, Hutapea menegaskan tidakakanmembahasRAPBDmeskisudahdiserahkan Pemko sebelum enam Ranperda selesai dibahasdanditetapkansertalaporankeuanganTriwulan IV APBD TA 2010 belum diserahkan. (a14)

Penjara Bantu Warga T. Balai Bidang Hukum

Waspada/Rasudin Sihotang

TERJATUH : Pengendara sepeda motor berupaya bangkit dengan kendaraannya yang terjatuh saat melintas di ruas jalan di depan proyek Rusunawa, Kota Tanjungbalai, Senin (24/1). Tiga bulan sebelumnya jalan tersebut masih mulus dilapis hotmix, namun sejak pembangunan Rusunawa menjadi rusak parah dan sering menyebabkan kecelakaan. ratusan ton material bangunan seperti semen, pasir, batu, besi, diangkut menggunakan truk gandeng dan trailer melintas. Padahal,jalantersebuttidakmampu dilalui truk roda dua puluh dua dan mobil berat lainnya. “Beberapa waktu lalu, material sempat dilansir dari jalan besar ke proyek menggunakan truk kecil, namun entah kenapa sekarang truk besar langsung

masuk,” ujar Jefri. Seorang pelajar salah satu SMP Nisa, mengaku kesulitan sejak rusaknya jalan di depan sekolahnya, padahal ratusan bahkan ribuan siswa dari beberapa sekolah di sekitar rumah susun melintasi jalan tersebut. Menurutnya, pemerintah harus bertanggungjawab dan segera mengupayakan perbaikan seperti sediakala. (crs)

TANJUNGBALAI (Waspada) : Lembaga Swadaya Masyarakat (LSM) Pemantau Kinerja Aparatur Negara (Penjara) siap membantu masyarakat KotaTanjungbalai yang membutuhkan bantuan. Demikian dikatakan Ketua LSM Penjara Tanjungbalai Ayong Susanto didampingi Dewan Penasehat Wira Karti, Kabid Koperasi dan Ekonomi Ariadi Zein dan dan Kabid Agama dan Kerohanian Ajon Sitorus di Sekretariat Jalan Makam Pahlawan, Kota Tanjungbalai, Senin (24/1), saat peresmian kantor lembaga itu. Menurut Ayong, Penjara berkomitmen membantu masyarakat teraniaya terutama yang

mengalamikesulitandibidanghukumdankeadilan dimana selama ini hanya menjadi bulan-bulanan aparatur penegak hukum. Dengan hadirnya LSM Penjara, masyarakat dapat terbantu mengingat masih banyak warga yang belum mengerti tentang hukum. Selain itu, kata Ayong, Penjara juga akan mengawasi penggunaan dana APBD dan menjaga agar tidak terjadi praktik korupsi oleh aparatur pemerintah yang merugikan masyarakat sebab uang tersebut adalah milik rakyat. “Lembaga ini bekerja demi kemajuan masyarakat Kota Tanjungbalai, terutama membantu rakyat kecil,” jelas Ayong. (crs)

2 Km Jalan Di Labuhanruku Rusak LABUHANRUKU (Waspada) : Jalan sepanjang 2 km di Lingkungan VI, VII, VIII Kelurahan Labuhanruku, Talawi, Batubara rusak dan berlubang. Menurut warga, Senin (24/1), kondisi jalan di Tanjung Putus, Kp.Kedah, Pandau Asam (Kelurahan Labuhanruku), Kp. Embacang (Pahang) lebih 2 Km rusak berlubang. Penyebabnya angkutan membawa bahan bangunan melebihi tonase untuk pembangunan pesantren dan komplek perumahan.

Warga menambahkan, saat ini sedang dilaksanakan perbaikan ruas jalan dan memasang turap/ riol.Namun warga tidak jelas volume pekerjaan, kontraktor, asal dana karena tidak ter lihat plang proyek. “Disangsikan hasil pekerjaan tidak maksimal cepathancurdisebabkanprahmengangkutmaterial bangun an lalulalang di jalan tersebut. Percuma saja jalan diperbaiki kalau dibebaskan prah mengangkut bahan bangunan melebihi tonase,“ ujar warga. (a30)

Kapolres: Kita Tetap Komit Berantas Judi Dan Anggota Terlibat Akan Ditindak Tegas “ JAJARAN Polres Serdang Bedagai tetap komit untuk memberantas semua bentuk judi dan akan terus berupaya mengungkap siapa bandar judi togel, kim. Setelah mengetahuinya akan menangkap para bandarnya. Bagi anggota kepolisian Sergai yang terlibat ikut melakukan backing terhadap praktek judi tersebut akan diberikan sanksi yang tegas.” Hal itu ditegaskan Kapolres Sergai AKBP Drs Eri Safari usai

menghadirisidangparipurnahari jadi ke-7 Sergai di gedung DPRD Sergai Desa Firdaus belum lama ini. Selain menangkap terhadap pelaku judi, kata Kapolres, pihaknya juga telah menyampaikan berupa imbauan kepada seluruh kepala desa, tokoh masyarakat dan agama,agar menginformasikan kepada masyarakat untuk tidak ikut bermain judi, sehingga dengan sendirinya praktek judi ituakanmengalamibangkrutdan tutup, karena tidak ada pembeli dan peminatnya,jelas Kapolres. Untuk memberantas praktek judi itu, Eri Safari mengharapkan semua kalangan masyarakat dapat menyampaikan informasi

kepada polisi, jika ada dan mengetahui lokasi pelaksanaan praktik judi sekaligus keberadaan bandaryangselamainimembiaya kegiatan haram di Sergai. Pihaknya tidak main-main dalam hal inidanakanmelakukanpengembangan hingga keluar daerah, jika sudah mengetahui secara pasti keberadaan bandar judi togel dan kim itu, kata Kapolres. Menanggapi komitmen dari Polres Sergai, Ketua Fraksi PPP DPRD Sergai yang juga tokoh agama H Usman Effendi Sitorus, SAgmengutarakandukungannya untuk memberantas terhadap segala bentuk praktik judi, terutama judi togel dan kim yang sangat marak di Kabupaten

Serdang Bedagai. Kegiatan haram itu sudah tidakrahasiaumumlagiprakteknya dibuka pada setiap warung kopi di desa-desa dengan duduk bersama membahas nomor tebakan dan kode alam dengan membuka buku tafsir 1001 mimpi sebagai acuan tebakan nomor dengan harapan bisa kaya mendadak, jika tebakan empat angka dipasang benar. DiasalutdenganPolresSergai yang cukup respon dengan aspirasi yang disampaikan masyarakat tentang judi. Apalagi polisi Sergai telah membuktikan keseriusannya memerangi judi, walaupun saat ini hanya sebatas juru tulis yang ditangkap dan

dimasukan ke bui. Tetapi kata Usman, dia tetap meyakini aparat kepolisian Sergai memiliki kemampuan untuk memberantas praktik judi togel dan kim di 17 Kecamatan, terutama di Kecamatan Tanjung Beringin, Sei Rampah, Sei Bamban, Teluk Mengkudu, Perbaungan, Pegajahan, Pantai Cermin dan DolokMasihul,sekaligusmenangkap para bandarnya yang masih bebas membuka kegiatan judi di Sergai, seperti menumpas kelompok orang bersenjata di Kecamatan Dolok Maishul beberapa bulan lalu. “Praktik judi togel dan kim di Sergai dapat dituntaskan hinggakeakar-akarnya,jikaaparat

kepolisian memiliki ketegasan dankeseriusan.Contohnya,ketika praktik judi togel, kim yang bebas beroperasi, secara mendadak tutupdantidakadasatupuncukong judi yang berani membuka usaha haram itu di Sumut. Gebrakan itudilakukankepolisianSumatera Utaradibawahpimpinanmantan Kapolri Jenderal Pol. Susanto,” kata Usman. Menurutnya, sikap mantan Kapolri itu dapat ditiru oleh petinggi kepolisian di Sumut, khususnya di Sergai dalam hal membrantas praktik judi. Karena mantan Kapoldasu itu berhasil menumpas praktik judi hingga ke akar-akarnya. (a07)

Sumatera Utara

WASPADA Selasa 25 Januari 2011

Tenaga Harian Lepas DPRD Paluta Tidak Gajian 9 Bulan GUNUNGTUA (Waspada) : 26 Tenaga Harian Lepas (THL) yang bekerjadikantorDewanPerwakilanRakyatDaerah(DPRD)Kabupaten Padanglawas Utara mengeluh. Pasalnya, selama Sembilan bulan gaji mereka tidak dibayarkan. Demikian disebutkan sejumlah tenaga harian lepas DPRD Paluta yang enggan disiarkan namanya. Diakui mereka, mulai akhir bulan April 2010 sampai sekarang gaji mereka belum dibayarkan. biasanya pembayaran gaji mereka akan dibayarkan tiap tiga bulan sekali. “Kami tidak tahu penyebabnya apa. Biasanya tiga bulan sekali kami sudah menerima gaji. ini tidak, malah kami tidak dianggap lagi Tenaga Harian Lepas dikantor ini”, sebut mereka. Sebelumnya, pembayaran gaji THL yang diterima mereka tiap per bulannya seberasar Rp 750.000 masih lancar. Namun, sejak bulan April setelah sekwan lama digantikan H.Hasan Basri mereka tidak pernah menerima gaji lagi, melainkan mereka sudah di anggap tidak bekerja dikantor itu. Ketua DPRD Padanglawas Utara, Muklis Harahap SHi yang dimintai keterangannya mengenai menunggaknya pembayaran gaji THL di kantor DPRD Paluta mengatakan, tolong konfirmasi dulu Sekretaris Dewan, apa penyebabnya gaji THL tidak di bayarkan, karena itu bidangnya Sekwan, kata Muklis Harahap. Sementara, Sekretaris Dewan Perwakilan Rakyat Daerah Kabupaten Padanglawas Utara, H Hasan Basri yang dihubungi melalui via selular tidak diangkat, ketika dijumpai di ruangannya masih ada rapat. (csp)

Laka Lantas Di Simalungun Dan P. Siantar, Dua Tewas P. SIANTAR (Waspada): Kecelakaan lalu lintas di wilayah hukum Polres Simalungun dan Polres Pematangsiantar mengakibatkan korban tewas, luka berat dan luka ringan. Seperti di Jalinsum Km 14-15, jurusan Pematangsiantar-Parapat, Simpang Kasindir, Nagori Dolok Marlawan, Kec Jorlang Hataran, Kab Simalungun, Minggu (23/1) pukul 03:30, mobil Kijang kapsul plat hitam dijadikan mobil penumpang umum bertubrukan dengan truk mengakibatkan satu korban tewas, tiga luka berat dan tiga luka ringan serta kerugian material Rp 20 juta. Korban tewas yakni sopir Toyota Kijang Kapsul BK 1772 FU Hotman Pardamosan Sirait, 40, warga JalanTuri, Gang Rumah Panjang, Sidorejo, Kota Medan, korban luka berat Sehat, 27, warga Jalan Pasar Belakang, Kota Sibolga, Josua Simanjuntak, 43, warga Desa Silimbat, Kec Sigumpar, Kab Toba Samosir dan Yohannes Duha, 45, warga Jalan Ahmad Yani, Teluk Dalam, Kab Nias. Sedangkan luka ringan Endang Hutagalung, 30, warga Kampung Baru III, Kota Sibolga dan putranya Khanza Hutasoit, 2, serta Edward Simanjuntak, 43, warga Desa Silimbat, Kec Sigumpar, Toba Samosir. Hotman tewas akibat terjepit kemudi mobil dan luka berat di kepala, sedangkan tiga korban luka berat pada bagian kepala. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Ipda Alsem Sinaga, SIP serta Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dihubungi melalui Kasubbag Humas Iptu Altur Pasaribu, Kasat Lantas AKP Hendrik Situmorang dan Kanit Laka Ipda David Sinaga, Senin (24/1) senada menyebutkan laka lantas itu masih dalam penyelidikandandugaansementara,lakalantasterjadiakibatkekurang hati-hatian para pengemudi. Sedang kenderaan diamankan guna penyelidikan.(a14)

DPRD Tobasa: Museum Batak Harus Luruskan Sejarah BALIGE (Waspada) : Kalangan anggota DPRD Toba Samosir menilai berdirinya Museum Batak yang diresmikan Presiden SBY pada 18 Januari 2011 mempunyai tanggungjawab harus meluruskan sejarah leluhur suku Batak. “Salah satu pelurusan sejarah yang diemban Museum Batak seperti makan orang atau disebut suku barbar perlu dinetralisir karena sifatnya hanya oknum saja (kasustik-red),” kata anggota DPRD Tobasa Monang Naipospos yang juga termasuk budayawan Batak saat bertemu dengan KetuaYayasanTB Silalahi Center Masrina Silalahi, Senin (24/1). Mungkin caranya tentu dengan menggali adat istiadat yang dilakukan para lelulur suku Batak. “Karena tidak ada diajarkan ataupun dalam acara adat untuk makan orang,” kata Monang. Istilah Dahlian Natolu = somba marhula-hula, elek marboru, manat mardongan tubu “ mengandung arti saling menghargai sesama umat manusia yang merupakan acuan hukum dianut leluhur suku Batak. Jadi tidak mungkin suku Batak sampai tega makan orang dan kalaupun ada terjadi zaman dulu ada melakukan makan orang bukan berarti mengklaim suku Batak. KetuaYayasan TB Silalahi Center Masrina Silalahi mengatakan, Museum Batak memang mempunyai tugas berat dalam menggali sejarah-sejarah budaya suku Batak dan kesulitannya hampir sebagian besar keseluruhan benda-benda purbakala suku Batak berada di luar negeri. (a33)

Pemkab Tobasa Teken Nota Kesepakatan Dengan PT Bajradaya Sentranusa BALIGE (Waspada) : Pemkab Tobasa menandatangani nota kesepakatan dengan PT Bajradaya Sentranusa pada 17 Januari 2011, perusahaan yang bertanggungjawab dalam pengelolaan Pembangkit Listrik Tenaga Air (PLTA) Asahan 1 untuk memberikan kontribusi 1 persen hasil penjualan listriknya. Hal ini dikatakan Asisten Pemerintahan Setdakab Toba Samosir Rudolf Manurung didampingi Kabag Humas dan Protokol Setdakab Tobasa Arwanto H Ginting, Senin (24/1) . Beberapa hal yang telah disepakati dalam nota kesepakatan ini, di antaranya PT Bajradaya Sentranusa memberikan kontribusi dalam rangka percepatan pembangunan di KabupatenToba Samosir 1 persen dari penjualan energi listrik PLTA Asahan 1 kepada PT PLN (Persero) dan bersifat tetap setiap tahun, juga akan memprioritaskan sumber daya manusia setempat sesuai standard profesi dan akan melaksanakan CSR (Corporate Social Responsibility) kepada masyarakat di sekitar PLTA, melalui program yang mencakup bidang fasilitasi saranapendidikan,kesehatan,penghijauandanpelestarianlingkungan hidup dan program lainnya yang dibutuhkan masyarakat. (a33)

DPW PPP Sumut Kunjungi KKM

Waspada/Sarmin Harahap

KUNJUNGAN: Pengurus DPW PPP Sumut dan rombongan saat mengunjungi pusat kerajinan Kampoeng Kaos Madina, Minggu (23/1) di Jalan Lintas Timur, Panyabungan.

Peredaran Miras Di P. Sidimpuan Marak, Warga Mengeluh P.SIDIMPUAN (Waspada) : Dugaan maraknya peredaran miras di kafe-kafe dan hotel yang ada di Kota Padangsidimpuan membuat Ketua FP Demokrat H Khoiruddin Nasution berang. ‘’Laporan masyarakat terhadap kita (Fraksi Demokrat) sudah sering dikeluhkan warga Kota Padangsidimpuan baik secara lisan dan telepoan, hal ini cenderung lemahnya pengawasan dari pihak terkait untuk pengawasan dugaan peredaran minuman keras (miras) di salah satu hotel di pusat kota,’’ ungkap Khoi-

ruddin Nasution kepada Waspada, Senin (24/1) sore. Menurut Khoir Nasution, selain lemahnya pengawasan peredaran miras di kota Serambi Makkahnya Tapanuli, akan berakibat buruk nantinya di tengahtengahmasyarakat,kitaharapkan kepada petugas aparat hukum untuk menindak dugaan peredaran miras. Bila ini dibiarkan, ditakuti ada nantinya masyarakat yang kehilangan kontrol seperti yang terjadi baru-baru ini di kecamatan Angkola Timur, Kabupaten Tapanuli selatan, beberapa waktu yang lalu, mari kita menjaga hati para umat yang mayoritas. ‘’Khususnya kepada pemko Padangsidimpuan,melaluiSatpol

PP, agar razia penertiban dugaan peredaran miras dalam waktu dekat diberlakukan,mau jadi kota apa nantinya Sidimpuan ini, bila dugaan demikian terus dibiarkan menjamur, harapan itu harus diwujudkan oleh Satuan Polisi Pamong Praja’’, tegas Khoir Nasution. Tuan Guru Syekh Mahmud Fauzy Siregar juga mendukung penuh upaya dari FP Demokrat DPRD Padangsidimpuan untuk menghindarkan kota itu dari kota mesum. ‘’Kami mendukung penuh upayadariFPDemokrat,harapan kami Pemko Harus tegas menyikapi dugaan peredaran miras di Kota Padangsidimpuan,’’ tegas ulama kharismatik itu. (crm)

Bagikan Proyek Bencana Alam Sebelum Pelelangan

Rekanan Laporkan Pejabat Paluta Ke KPK MEDAN (Waspada) : Pejabat teras Pemkab Padanglawas Utara dilaporkan rekanan ke Komisi Pemberantasan Korupsi (KPK) di Jakarta terkait permainan proyek bencana alam yang dibagibagikan oknum pejabat kepada rekanan sebelum dilakukan pelelangan. “Saya yang langsung mengadu ke KPK, karena kalau ke polisi atau kejaksaan pejabat Paluta ini mempunyaibanyakbacking,”ujar Hariman Siregar yang siap masuk penjara untuk membongkar kasus ini kepada wartawan, Minggu (23/1). Dijelaskan Hariman Siregar, kasus ini berawal 10 Mei 2010, ketika itu oknum pejabat PU Paluta menghubunginya melalui telefon menawarkan proyek bencana alam dari pusat untuk Paluta senilai Rp46 miliar. Setelah itu pada 15 Mei 2010, mereka bertemu di Hotel Pardede Medan untuk membicarakan proyek ini. “Dalam pembicaraan itu, oknum itu menawarkan proyek senilai Rp9 miliar. Untuk pengurusan proyek ini oknum itu meminta uang Rp500 juta sebagai panjar,” jelas Hariman Siregar. Seminggukemudian,jelasnya, mereka bertemu di Hotel Sumatera di Jalan SM. Raja Medan. “Dalampertemuanitusayamemberikan uang kontan Rp350 juta dan cek senilai Rp150 juta kepada oknum itu disaksikan kakak saya sertastafKadisPU,”kataHariman Siregar. Waktu itu, lanjutnya, oknum

itu mengatakan, uang yang baru diterimanya akan ditransfer kepada oknum pejabat Paluta yang saat itu berada di Jakarta.“Waktu itu, saya sempat bertelefon dengan oknum itu di Jakarta. Sedangkan yang mencairkan chek senilai Rp150 juta atas nama Amirul,” kata Siregar. Satubulankemudian,oknum Kepala PU Paluta dinonaktifkan. “Selaku rekanan, saya menemui BupatiPalutauntukmemperjelas status uang kami dan mendapat jawaban uang telah diurus ke proyek bencana alam Paluta. Kalau gagal uang dikembalikan,” jelas Siregar. Pada 17 Januari 2010, pengumuman pelelangan sebanyak 14 paket bernilai Rp10,5 miliar. Kemudian pada 18 Januari 2010,

Wakil Bupati dan Kepala Bapelda Paluta menanyakan proyek itu. “Ternyata proyek yang diberikan kepadakamisenilaiRp1.550miliar tidak sesuai dengan yang dijanjikan pejabat Paluta yakni Rp9 miliar,” jelasnya. Menurutnya,permasalahkan proyek yang diberikan pejabat Paluta ini dan siap membongkar permainan proyek bencana alam inikepenegakhukumKPKkarena dinilai telah membagi-bagikan proyek bencana alam kepada rekanan sebelum pelelangan. “Untuk membongkar kasus ini,sayasudahmenyiapkanbuktibukti untuk dilaporkan ke KPK. Kita segera berangkat ke Jakarta melapor ke KPK,” ujar Hariman Siregar. (m39)

Tahun Ini, Dana CSR PTPN III Ke Tapsel Capai Rp 8 M P.SIDIMPUAN (Waspada): Tahun ini, PT Perkebunan Nusantara III (PTPN-III) akan mengeluarkan dana sekira Rp8 miliar sebagai Corporate Social Responsibility (CSR) atau tanggung jawab sosial perusahaan kepada masyarakat Tapanuli Selatan. Bupati Tapsel, Syahrul M Pasaribu, didampingi Wakil Bupati, Aldinz Rapolo Siregar, Asisten II, Saulian Sabbih, dan Manajer Kebun Hapesong PTPN III Distrik Tapsel, Edi Giri, mengungkapkan itu kepada wartawan pekan lalu. “Dana CSR PTPN III ini telah kita cantumkan dalam APBDTapsel tahun anggaran 2011 sebagai dana bantuan,” ujar Bupati sembari menegaskan bahwa pada tahun-tahun sebelumnya dana ini tidak dimasukkan dalam APBD. Perolehan dana CSR itu baru pertama kalinya dicantumkan di APBD. Jumlah Rp 8 M itu diketahui setelah terjalin komunikasi dan komitmen kebersamaan membangun daerah antara Pemkab Tapsel dan PTPN III. (a20)

Saat Rumah Warga Miskin Mulai Dapat Perbaikan KONDISI rumah warga miskin di Lingkungan I, Kel. Pekan Besitang sungguh memprihatinkan. Rumah yang hanya berukuran 4x4 meter dengan konstruksi dinding tepas, atap nipah dan berlantaikan tanah itu dihuni, Andy Wijaya, bersama istri dan empat orang anak termasuk kedua mertuanya. Faktor ketidaan memaksa keluargamiskinitutetapbertahan meski hanya tidur beralas tikas diataslantaitanah.Sebagaiburuh kasar di perkebunan dengan gaji bersih yang hanya Rp300 ribu per bulan,ayahdariempatoranganak itu mengaku tak mampu untuk membangun rumah yang layak huni. Yang memprihatinkan, pada

saat hujan, air leluasa mengalir dari celah lubang-lubang atap yang sudah banyak bocor. Tetesan air hujan tentunya membuat lantai tanah menjadi becek sehingga dirasakan sangat menggangu kenyamanan. Tak hanya atap, dinding tepas yang sudah lapuk dan bolong memudahkan angin malam menerobos masuk. Kondisi yang tidak mengenakaninitelahdialamikeluargamiskin itu selama bertahun-tahun. “Takusahkanuntukmemperbaiki rumah, untuk memenuhi kebutuhan hidup keluarga saja sangat sulit,” ucap Wijaya saat ditemui Waspada, Senin (24/1) di kediamannya. Keinginan buruh kebun itu untuk memperbaiki kondisi rumahnya yang sudah lapuk dimakan usia itu sudah lama, tapi apa daya kemampuan dana tidak mendukung.“Takusahkanmembangun atau merehab, untuk menyemen lantai saja saya tidak punya uang,” imbuhnya.


Kini, Andi Wijaya, merasa sangat bersyukur. Rumahnya yang sudah reot tanpa ada kamar itu dibangun pemerintah lewat Program Pengembangan Sistem Pembangunan Partisipatif (P2SPP). Senin (24/1) pagi, di tengah curah hujan gerimis, Camat Besitang, Nuriadi, S.Sos, meletakan batu pertama pembanguna rumah. Kegiatan sosial bedah RTM ini dihadiri sejumlah tokoh masyarakat, tokoh agama, pengurus LPMK, Tim Pelaksana Kegiatan (TPK), Unit Pngelola Kegiatan (UPK), dan Polsek Besitang. Dikatakan, P2SPP ini merupakan program perdana yang dilaksanakan Pemkab Langkat dan khusus di Besitang ada 5 unit rumah yang dibangun/rehab. Kegiatan ini untuk mendorong upaya penyatupaduan sitem pembangunan partisipatif pola PNPM mandiri perdesaan. Dengan kegiatan ini diharapkan dapat meningkatkan kapasitas

PANYABUNGAN (Waspada) : Pengurus DPW PPP Sumut mengunjungi pusat kerajinan Kampoeng Kaos Madina (KKM), Minggu (23/1) di Jalan Jambu Lintas Timur, Kelurahan Sipolupolu, Kecamatan Panyabungan, Kabupaten Mandailing Natal. Mereka yang berkunjung antara lain, Ketua DPW PPP Sumut Fadly Nurzal didampingiYurizal P Lubis, keluarga, serta beberapa kader yang ingin melihat langsung pembuatan kerajinan baju kaos dengan motif budaya dan panorama alam Mandailing. Kunjungan DPW PPP Sumut langsung disambut Inisiator KKM Sobir Lubis dan Direktur Utama Amaluddin, serta karyawan KKM. Pada kesempatan itu, Fadly Nurzal memuji hasil kerajinan generasi muda Madina, yang kwalitas maupun motifnya bisa dibawa bersaing dipasaran nasional maupun internasional. Ia berharap, kerajinan KKM ini menjadi motivasibagipemudayanglaindiMadinamaupun luar Madina. Karena kerajinan KKM merupakan salah satu simbol implementasi dari keinginan pemerintah untuk mewujudkan pemuda yang mandiri. “Generasi muda jangan hanya focus ingin jadi PNS, tapi berwiraswasta dengan kerajinan

keterampilan juga memberikan jaminan masa depan yang lebih baik di tengah arus gelobalisasi,” ucap Fadly sambil memilih kaos KKM kesukaannya. Yurizal mengatkan, kerajinan KKM ini harus menjadi perhatian pemerintah daerah, karena merupakan aset usaha kerajinan yang bisa langsung mempertahankan dan mempromosikan budaya dan wisata daerah ke kancah nasional dan internasional. Ia juga berjanji menggiring pengembangan kerajinan KKM ke tingkat provinsi. Karena dinilai memiliki prospek menjanjikan untuk lapangan kerja baru guna mengurangi tingkat angka pengangguran. Di KKM banyak tersedia jenis kerajinan bermotif budaya dan panorama alam antara lain, kaos,cangkir,piring,bingkaifoto,kipas,tas,gordang sambilan mini, pakaian adapt dan mainan kunci. Bagi pengunjung yang suka motif border bisa dipesan, begitu juga dengan kaos untuk olahraga, lambang organisasi, kaos dengan motif pilihan pribadi, badge nama, serta kerajinan lainnya asal anda suka dan punya inspirasi bisa terwujud melalui tangan-tangan terampil di KKM. (csh)

Rekrutmen CPNS Bagian Reformasi Birokrasi SIBUHUAN (Waspada) : Rekrutmen Calon Pegawai Negeri Sipil (CPNS) merupakan bagian dari reformasi birokrasi, bahkan pintu yang tepat melakukan reformasi birokrasi. Tetapi persoalan yang selama ini terjadi di lingkungan birokrasi tidak terlepas dari proses rekrutmen birokrat yang menyalahi prinsip perbaikan. Demikian Ketua Umum Gerakan Mahasiswa Padanglawas (Gema Padanglawas) Ansor Harahap, Senin (24/1). Dikatakan, penyakit birokrasi tak kunjung berujung, karena membuka peluang penyakititutumbuhberkembangdalambirokrasi. Hal itu berdampak luas, kata Ansor, termasuk prosespembangunantidakberjalansebagaimana mestinya, bahkan semakin mematikan potensi demokrasidalambirokrasiitusendiri.“Bilapotensi demokrasi hanyut, maka yang terjadi adalah penyalahgunaan wewenang akan menyeruak,” katanya. Dalam pemerintahan Padanglawas adalah salah satu contoh yang terus- menerus mengalami penyakit kronis birokrasi. Karena sangat mengabaikan penerimaan CPNS sebagai pintu

reformasi birokrasi. Dampak dari penerimaan CPNS itu tergambar dalam perjalanan pemerintahan. Menurutnya, selama penerimaan CPNS dikelabui, selama itu pula penyakit birokrasi mengelabui rakyat. Karena setiap yang salah dari prilaku atau kebijakan penguasa di pemerintah, yang menjadi korban sesungguhnya rakyat dan masa depan daerah serta generasinya sendiri. Karenaitu,ujarAnsor,dugaanindikasiKorupsi Kolusi dan Nepotisme (KKN) dalam penerimaan CPNSPalastahun2010harussegeraditindaklanjuti penegak hukum. Kejaksaan dan Kepolisian diminta mendalami dan mengusut indikasi tersebut agar semua terang. Penegak hukum jangan membiarkan kemungkaran yang menjadi rahasia umum ini terus berlanjut. RakyatSumut,khususnyaPadanglawasmenaruh harapan kepada Kapoldasu yang dikenal apresiatif terhadap pengaduan hukum masyarakat untuk penegakan amar ma’ruf nahi munkar. Diharapkan kepada Kapolda agar tidak mengecawakan rakyat dalam hal penegakan hukum. (a32)

LSM Kuasai Pintu Masuk Taman Simalem Resort MEREK (Waspada): Pasca demo DPD LSM Lira Kabupaten Karo di kantor bupati awal pekan tentang izin PT. Merek Indah Lestari (MIL) dalam membangun fasilitas di Taman Simalem Resort (TSR), berbuntut penutupan jalan masuk lokasi taman oleh LSM, Sabtu (22/1). Penutupan paksa ini, berlangsung 4 jam dimulai pukul 11:00 – 14:00. Sementara, Perda terkesan dikangkangi investor. Sebab, menurut sejumlah petinggi Pemkab Karo Pekan lalu, di antaranya Kepala Bagian Perizinan, Kepala Bagian Pemerintahan dan Asisten I, TM Tarigan dan Kakan Satpol PP Tarigan menyebutkan, pembangunan sejumlah fasilitas di TSR sejak pembangunanya tahun 2000, belum memiliki IMB dari Pemkab Karo. Meskipun sejak saat itu izinnya masih tahap proses tetapi hingga saat ini masih diberikan tenggang waktu agar izin yang dimaksud di peroleh. Menurut mereka, dalam waktu dekat akan dirembukkandenganPlhBupatiKaro merangkap Sekda Ir. Makmur Ginting. Tuntutan lain LSM Lira, jika tenggang waktu yang diberikan kepada TSR belum juga terpenuhi, maka Pemda melalui Satpol PP diminta bertindak menyegel tempat tersebut dan memberhentikan aktivitas pembangunan. Penutupan jalan oleh LSM Lira sekitar 30 meter sebelum loket pengutipan karcis, ditolak keras oleh Polres Karo. Juru bicaranya, Kasat Intel Polres Karo AKP Heri S, dan Kasat Reskrim AKP Hery Siregar meminta kepada demonstran, supaya pintu masuk tidak ditutup, sebab telah menghalangi jalan umum dan perbuatan ini menyalahi aturan perundang-undangan. Untuk menyelesaikan hal ini, hendaknya LSM Lira mendesak Pemkab Karo, menuntaskan masalah ini, sebab bagaimanapun juga yang bertanggungjawab dalam masalah penyegelan dan penutupan jalan di TSR adalah Pemda Karo, jelasnya. Sementara, juru bicara LSM Lira Julianus Sembing SPd dan Aditya Sebayang, SE menyebutkan, Pemkab belum bisa menjawab apakah TSR merupakan fasilitas umum, terkait penutupan pintu masuk yang disebutkan Polres menggangu ketertiban umum. Artinya, dalam UU No.09/1998 jelas disebutkan, para demonstran dalam hal ini menutup fasilitas dalam kepentingan umum itu dilarang dan wajib dibubarkan dan kalau ini memang benar, kami akui dan bukan secara defacto tetapi harus disebutkan secara yuridis. Argumentasi LSM Lira dengan Pejabat Polres Karo juga menyinggung mengenai pengutipan

uangyangdilakukanTSR.Padahal,katajurubicara Lira Julianus, belum tentu ada persetujuan Pemkab dengan TSR dalam hal penjualan tiket masuk. Hal ini terkesan ada kriminalnya yakni praktik pengutipan illegal, jadi dalam item ini, Polres harus bertindak, kata Lira. Pernyataan ini ditanggapai Kasat Reskim seraya menyebutkan, jika masyarakat atau LSM Lira mempunyai bukti ada pengutipan uang dan penjualan tiket, maka disampakikan ke Mapolres Karo agar ditindaklanjuti, katanya. Namun kenyataanya di lapangan, usai lebih kurang satu jam berlangsung adu argumentasi tersebut, sejumlah kendaraan pribadi masuk ke lokasiTSR.Terlihat sejumlah petugasTSR yang berseragan biru tua, menerima uang Rp100 ribu dari pengunjung dan kembali memberikan kertas atau sejenisnya kepada pengunjung. Tidak diketahui secara pasti, kertas apa yang diberikan oleh TSR, sebab mereka ketika ditanyai memilih tutup mulut namun tetap melakukan aktivitas, meskipun Kapolres Karo dan Kasat Reskrim berada di dekat pintu masuk dan sejumlah anggota Lira. Meskipun ditunjukkan rekaman video ada pengunjung masuk naik mobil Avanza warna hitam BK 1565 JR dan pihak TSR menerima uang Rp100 ribu dua lembar yang disaksikan anggota Lira dan sejumlah jurnalis, tetapi Kasat Reskrim tetap pada pernyataanya, dan jika keberatan bawa bukti dan laporkan, katanya. Sementara, Kapolres Tanah Karo, AKBP Ig. Agung P, yang dikonfirmasi wartawan di lokasi, Sabtu (22/1), sesuai tembusan surat yang sampai kepadanya (Polres Karo pada surat tahun 2006), beberapa unit bangunan di TSR telah ada izinnya. Namun, saat ditanyakan, secara pasti berapa unit bangunan yang telah memiliki izin di TSR sesuaisurattembusanyangditerimanya,Kapolres Karo hanya berkata: “Saya lupa berapa persis jumlahnya”. Sedangkan menurut Pembantu Dekan III Fakultas Pertanian Univ. Amir Hamzah J. Purba di pintu masuk TSR, hendaknya ada konfirmasi Pemda dengan kepolisian sebagai pengamanan diTSRadademodantidakdiperkenankanmasuk. Namun,kenyataannyamerekatidakberkordinasi. Buktinya, kata dia, kami dari Fakultas Pertanian Univ. Amir Hamzah Medan sangat kecewa tidak bisa masuk TSR, padahal telah menunggu dua jam lamanya. Sebab begitu mau masuk, langsung dicegat LSM Lira. Kalau di Medan, pemerintahan dan kepolisian serta pengusaha dapat mengatasinya, tapi di sini tidak sehingga pengunjung pulang dengan rasa kecewa. (cdb/a17)

13 Truk Dolomit Dikeluarkan Dari Mapolres Karo Malam Hari


BATU PERTAMA: Camat Besitang, Nuariadi, S.Sos, meletakan batu pertama pembanguna rumah tangga miskin (RTM) sebagai implementasi Program Pengembangan Sistem Pembangunan Partisipatif (P2SPP) di Lingk I, Kel. Pekan Besitang, Senin (24/1). lembaga kemasyarakatan dan pemerintahan desa/kelurahan

dalam pengelolaan pembangunan partisipasif. (a02)

KABANJAHE (Waspada) : 13 truk bermuatan dolomit, ke luar dari Mapolres Tanah Karo, Sabtu (22/1) malam, setelah dua pekan lebih ditahan untuk pemeriksaan,sementarapolisi menyatakan hal tersebut dilakukan untuk mengurangi risiko kerusakan kenderaan. “Kasus ini berkasnya terus dilanjutkan ke Kejaksaan. Ada pertimbangan khusus, kalau terus ditahan, tentunya pengusaha akomodasi akan mengalami kerugian. Barang bukti (BB), akan di simpan di gudang penyimpanan,” ujar Kasat Reskrim Polres Karo AKP Harry Azhar. Namun, ketika ditanyakan perihal barang bukti, Kasat Reskrim tidak mengutarakan lebih spesifik. “Barang bukti itu akan dihadirkan, ketika diperlukan pada proses selanjutnya. Lebih lanjut dia menjelaskan, truk bermuatan dolomit hanya sebatas pinjam pakai oleh pengusaha. Sedangkan sebelum truk ke luar dari Mapolres, sejumlah oknum terlibat dalam usaha Galian C dolomit, mendatangi Mapolres Tanah Karo. (cdb/a17)

Waspada/Dede Basri

KELUAR: Truk bermuatan dolomit ke luar Mapolres Tanah Karo Sabtu (22/1) malam hari, setelah sepekan ditahan polisi.

Sumatera Utara


Kenaikan Harga Beras Tak Dinikmati Petani Simalungun SIMALUNGUN (Waspada): Kalangan petani di Kab. Simalungun ini tidak menikmati kenaikan harga beras disaat musim paceklik. Kalangan petani di Kec. Bandar, Pematangbandar, Bandar Huluan, Bandar Masilam, GunungMaligasdanGunungMalela, kepada Waspada Senin (24/1) mengakui kenaikan harga beras tidak dinikmati oleh petani. Bahkan, kenaikan harga beras ini membuat petani mulai kehilangan gairah sebagai petani sawah, karena mereka beranggapan dengan naiknya harga beras akandisusulnaiknyahargapupuk dan obat-obatan. Pengakuan Amin Sinaga, petaniBandarHuluan,kehidupan petani sawah semakin sulit akibat mahalnyabiayaproduksi.Seperti, naiknya harga pupuk dan obatobatan. Sementara, kenaikan harga beras tidak dapat dinikmati petani karena kenaikannya justru saat petani mulai turun ke sawah (musim paceklik), sedangkan musim panen, harga beras atau gabah selalu stabil bahkan cenderung turun. “ Kenaikan harga beras sama

sekali tidak dinikmati oleh petani, karena saat panen kami sudah menjual habis hasil panen gabah danmenjadipembeliberas,”tukas Amin. Dia juga menyatakan, hidup sebagai petani tidak ada enaknya, karena saat musim panen harga gabah cenderung turun dan musim tanam (paceklik) harga beras bergeraknaikyangdisusulnaiknya harga pupuk dan obat-obatan. Dikatakannya, sejak pengolahan lahan, penanaman benih,

perawatan hingga memasuki masa panen, petani membutuhkan biaya besar. Jika petani bermodal cukup, tidak ada masalah.Tetapi, jika tidak punya modal terpaksameminjamdaninisering terjadi di tengah kehidupan petani. Keluhan sama juga dikemukakankan, M Sitorus, petani di Bandar Manis. Dikatakannya, setiap musim tanam tiba, dia terpaksa meminjam modal dari tetangga. Dengan harapan pada

Proyek JUT Bantu Petani Pakpak Bharat SALAK (Waspada): Proyek Jalan Usaha Tani (JUT) 2010 berbiaya Rp300 juta lebih bersumber dari Dana Alokasi Khusus (DAK) meliputi kegiatan pembukaan jalan adalah membantu masyarakat khususnya petani di Kab Pakpak Bharat. Hal itu diungkapkan Chairul Pane selaku Pejabat PelaksanaTeknis Kegiatan (PPTK) Dinas Pertanian Pemkab Pakpak Bharat, Senin (24/1) saat ditemui Waspada. Kata dia, para petani tidak lagi susah mengangkut pupuk ataupun hasil pertaniannya. Hal itu juga dikemukakan Erliana br Siregar, salah seorang warga Salak saat ditemui Waspada ladangannya.”Sebelum ada proyek JUT, jalan yang ada jalan setapak. Saat ke ladang tak jarang harus menjinjing dan memikul pupuk ataupun hasil pertanian.” Kini, katanya, sangat terbantu karena jalan tersebut telah bisa dilalui oleh kendaraan bermotor untuk mengangkut hasil pertanian dan pupuk meskipun hanya pada waktu musin kemarau.(c08)

Sambut Milad Ke-44

Yaspendhar Gelar Harapan Expo 2011 GEDUNG JOHOR, Deliserdang (Waspada): Sebagai wujud terima kasih kepada masyarakat, Yayasan Pendidikan Harapan (Yaspendhar) Medan menyambut HUT miladnya ke-44 akan mengelar Harapan Expo di Kampus Johor Jalan Karya Wisata Ujung,GedungJohor,Deliserdang pada 3 hingga 6 Februari 2011 mendatang. Demikian Ketua III Yaspendhar Drs Awaluddin Sibarani, MSi didampingi Sekretaris I Drs H Syarifuddin Alinafiah, MPd, Sekretaris II Drs. H Syaiful Nahar, SE, MM, Bendahara Ramadhan SE, Wakil Bendahara Drs Edi Zulfikar, Senin (24/1). Menurut Awaluddin, Harapan Expo ini dilaksanakan untuk memperingati miladYaspendar yang ke-44 yang jatuh pada tanggal 4 Februari 2011. Sebagai sekolah yang telah berkiprah 44 tahun di dunia pendidikan nasional, Yaspendhar yang didirikan oleh tokoh masyarakat Sumatera Utara telah memberikan kontribusi yang nyata, khususnya di Sumatera Utara. Atas kiprahnya itu, ratusan ribu alumni dari jenjang TK, SD, SMP dan SMA dan sekolah tinggi telah dihasilkanYaspendhar Me-

dan, bahkan banyak para ilmuan, tenagamedis,sastrawan,politikus, para petinggi negara dan profesi lainnya yang dihasilkan melalui sekolah ini. Apalagi Yaspendhar Medan telah memiliki 3 kampus, yakni Kampus Induk Imam Bonjol, Kampus HM. Jhoni dan Kampus Johor. “Sebagai wujud terima kasih kepada siswa, orangtua siswa dan masyarakat yang telah membesarkan Yaspendhar Medan, kita memberi ucapan terima kasih melalui even Harapan Expo 2011. Hal itu dilakukan di samping memberikan wadah bagi para siswa yang ingin berkreasi, hiburan,sehinggaterjalinhubungan baik antara Yaspendhar Medan dengan para siswa, orangtua, staf, karyawan, mitra usaha dan masyarakat,” sebut Awaluddin lagi. Ketua Panitia Suryahadi Marwan, SPd didampingi Ketua II Drs. Anwar, Sekretaris I Abdul Jalil, SPd. MS, Sekretaris II Hj Rosniar dan Bendhara Budiono, SE menjelaskan, Harapan Expo 2011 ini diisi dengan kegiatan bazar dan pameran meliputi; properti, automotif, elektronik, handphone, UMKM, makanan, stand profil sekolah, stand kreativitas siswa dan lain-lain.

“Lomba yang digelar meliputi, mewarnai, menggambar, try out UASBN dan UN, busana muslim, tari kreasi daerah, festival band, olahraga serta hiburan meliputi, flying fox, gerak jalan keluarga dan stand-stand pameran,” katanya. Dikatakan Marwan, kegiatan ini melibatkan siswa, orangtua, karyawan, mitra, masyarakat Kota Medan,Deliserdang dan Sumatera Utaram, juga melibatkan siswa Yaspendhar serta sekolah lainnya dari tingkat TK, SD, SMP dan SMA. Untuk tingkat TK dan SDakandigelarlombamewarnai, menggambar, busana muslim, dan try out UASBN. Tingkat SMP dan SMA akan digelar lomba try outUN,kompetisiband,tarikreasi daerah, sementara untuk orangtua dan masyarakat akan digelar gerak jalan keluarga. “Untuk itu panitia juga memberikankesempatankepadapihak sponsor/mitra kerjaYaspendhar untuk berpartisipasi pada event ini. Untuk informasi dapat menghubungi bagian informasi Harapan Expo di Kampus Johor Jalan Karya Wisata Ujung atau Abdul Jalil 081376120222,” katanya. (m43)

Pelantikan Dan Diklat OSIS SMP Darussalam Di Sembahe SEMBAHE, Deliserdang (Waspada): Untuk menumbuhkanjiwakepemimpinan,sebanyak 50 siswa SMP Swasta Darussalam Medanmelaksanakandiklatsekaligus pelantikan OSIS periode 2010-2011 di Sayum Saba, Sembahe, Kab. Deliserdang, Minggu (23/1). Kepala SMP Darussalam Ariadi, AEF. SPd kepada wartawan, Senin (24/1) menjelaskan, diklatdanpelantikaninimendapat sambutan yang luar biasa sekali dari Ketua Yayasan Islam Miftahussalam Prof Dr Ir H Bustami Syam, MS. ME. Beliau sangat memotivasi dan mendorong kegaiatan pelatikan ini, sehingga denganpelatihanininantinyalahir pemimpin-pemimpin muda, kendati masih tingkat SMP. “Jadi pemimpin tidak mesti harus tua, yang muda juga bisa. Hanya saja cakupannya masih setingkat SMP, tapi dengan diklat inimerekadigodokuntukmenjadi pemimpinmasadepannantinya. Hal ini sesuai dengan tema Mendidikpemimpimmudayang beriman, berbakat dan berkualitas,” katanya. Untuk itu, Ariadi berharap kepada pengurus OSIS baru ini kiranya bisa berbuat yang terbaik danmembawanamabaiksekolah, khususnya di tengah-tengah lingkungan sekolah, masyarakat


DILANTIK: Pengurus OSIS SMP Darussalam periode 2010-2011 foto bersama dengan Kepala sekolah Ariadi, AEF, SPd beserta dewan guru usai mengikuti diklat dan pelantikan di Sembahe, Minggu (23/1). dan Kota Medan.Walaupun selama ini kita ketahui nama pengurus OSIS sudah harum terlebih dahulu. PKS III Kesiswaan Al Padri, SPd menjelaskan, sebelum dilakukan diklat dan pelantikan di Sembahe, para pengurus dan Ketua OSIS yang terpilih ini sebelumnya mengikuti pemilu yang diadakan di sekolah. Pemilu ini dibuat miniatur dari pilkada dan pemilu di Indonesia, yang dilengkapi dengan perangkat partainya. Dikatakan Al Padri, sebelum dilakukan pelantikan pengurus

OSIS ini terlebih dahulu mengikuti diklat meliputi, pendidikan kepemimpinan,kerjasamadalam kedisiplinan, games kerjasama dan diskusi penjabaran berbagai ide-ide untuk kepengurusan setahun ke depan. Adapun pengurus OSIS SMP Darussalam periode 2010-2011, yakni Ketua OSIS Stefani Al Hasyim Hasibuan, Sekretaris Ayu FauziAstutidanBendaharaNindy Aprilia Tanjung. Hadir dalam kegiatanPKSIRahimah,SAg,Dra. Israwati,EffendiGinting,SPd,Raju Siregar, SPd, Adlin Nasution, SPd dan Ramadhan. (m43)

musim panen nanti dapat membayar pinjamannya. Menurut petani yang mengaku hanya sebagai penyewa sawahini,darihasilpanennyaseluas 10 rante, tidak mampu menutupi kebutuhan berasnya selama empatbulanatausampaikembali turun tanam sawah. Praktis, dia terpaksa mencari utangan untuk dapat kembali turun sawah. Sedangkan untuk menutupi biaya hidup sehari-hari dia terpaksa mencari pekerjaan mocokmocok atau mencari upahan. “Jangankan punya stok gabah untuk dijual, untuk biaya pengolahan sawah dan bayar sewa sawah, saya terpaksa pinjam uang,” cetus Sitorus. Hal yang sering mengecewakandaninidapatdirasakanpetani pada saat turun tanam, harga pupuk meningkat tajam. Kemudian, menjelang musim panen, harga gabah langsung turun hingga tingkat harga terendah. Belum lagi berkurangnya hasil yang diperoleh akibat serangan hama. Sehingga lengkaplah penderitaan yang dialami petani. Kalaupun petani mengalihkan lahannya ketanaman palawija, ubi kayu atau kelapa sawit, itu disebabkan harga gabah tidak pernah stabil, timpal J br Sinaga. (a15)

WASPADA Selasa 25 Januari 2011

Pemakai Ganja Diamankan KABANJAHE(Waspada): SatuanUnitNarkobaPolresTanah Karo mengamankan SH, 23, warga Jalan Jamin Ginting, Gg Mercu, Desa Raya, Kec Berastagi karena menyimpan ganja di saku-

nyamaupundiasbeskamarmandi rumahnya, Minggu (23/1). Keterangan yang di peroleh dari tersangka SH, daun haram yang di milikinya dibeli dari seorang temanya yang bermukim

di Tanah Karo yang namanya sudah diketahui Sat Narkoba Polres Tanah Karo. Petugas menggeledah SH danmenemukansisaganjadisaku celana.

Kapolres Tanah Karo AKBP Ig Agung Prastyoko, SH melalui KasatNarkobaAKPAzhardidampingi Kaorbin Ops Narkoba Aptu Agus Karyono Harahap kepada Waspada membenarkan. (cmm)

Selasa 25 Januari 2011

Camat Hulu Siapas Paluta Cabuli Pegawai TKS GUNUNGTUA (Waspada): Oknum Camat Kecamatan Hulu Sihapas, Kabupaten Padang Lawas Utara, MP, 45, dilaporkan ke Polres Labuhanbatu, Kamis (20/1), karena mencabuli seorangpegawaiTenagaKerjaSukarela (TKS) perempuan berusia 18 tahun, RD. Korban didampingi anggota keluargnyamembuatpengaduan ke Polres Labuhanbatu , karena tempat kejadian perkaranya (TKP) di kamar 103 Hotel Nuansa Rantauprapat pada Sabtu (15/ 1) sekira pukul 18:00. Pengaduanditerima Kepala SPK ‘C’ Polres Labuhanbatu, Aiptu R Simanjuntak, sesuai surat tanda penerimaan laporan pengaduan No: STPL/64/I/2011/ SPK-C. Pengaduan tentang perbuatan cabul sesuai Pasal 293 KUH Pidana. Kemudian Senin (24/1), korban melayangkan surat pengaduan kepada Bupati Paluta, Drs H Bachrum Harahap. Dia menceritakan kronologis kenapa sampai terjadi perbuatan cabul yang dilakukan oknum Camat, MP, kepada dirinya. Berawal dari MP mengajak korban ke Gunungtua, Sabtu (15/ 1), untuk menghadiri rapat. Korban menolaknya dengan alsan tidak mau dirinya saja yang diajak

ikut, kecuali pegawai yang lain juga ikut. Kemudian sekitar pukul 10:00,korbandidatangitemannya sesama pegawai TKS, Aspina Siregar dan mengajaknya makan pecal ke Jalan baru didekat SMK Negeri 1 Batang Onang. Korban pun mau dan tidak ada firasat buruk apapun. Ternyata tidak berapa setelah tiba di tempat penjual pecal, tibatiba MP datang dengan mengendarai mobil dinas. Kemudian oknum camt tersebut mengajak korban dan temannya Aspian Siregar jalan-jalan ke Padangsidimpuan. Setibanya di Padangsidimpuan, MP membawa dua pegawainya itu ke sebuah kafe. Kemudian menawarkan air mineral kemasan botol. “Sedikitpun saya tidak curiga. Ternyta setelah air mineral itu say minum, kepala saya pusing dan pikiran saya seperti melayang-layang,” aku korban. Dalam kondisi seperti iut, MP langsung mengajak korban dan temannya pulang. Setibanya di tempat penjual pecal tempat mereka bertemu tadi, Aspina Siregar turun dari mobil, sedangkan korban langsung dibawa MP ke Rantau Parapat di L. Batu. Mereka tiba di Hotel Nuansa

sekira pukul 18:00 dan MP langsung memesan kamar nomor 103. Setelah masuk kamar, MP langsungmemaksamenyetubuhi korbanyangmasihdalamkondisi sempoyongan. “Pak Camat merenggut keperawanan saya secara paksa,” sebut korban. Keesokan harinya, Minggu (16/1), MP membawa korban pulang ke kampungnya di Aek Godang, Kec. Hulu Sihapas,Kab.Paluta.Namuntepatnya di kawasan hutan lindung Nabundong, MP menurunkan korban dan kemudian dijemput temannya Aspina Siregar. Keesokan harinya, Senin (17/ 1) korban yang masih berusia 18 tahun itu memeriksakan dirinya ke dokter. Hasil diagnosa dokter, ternyata selaput keperawanan korban sudah robek. Tidak terima akan kejadian ini, korban pulang ke rumah dan mneceritakannyakepadaibunya. Malam harinya ibu korban mendatangi istri Camat dan menceritakan kejadian tersebut. Namun dikarenakan tidak adanya itikan baik dari keluarga MP maupun istrinya yang telah mengetehui kejadian itu, maka keluarga korban berkumpul dan melaporkan kejadian itu kepada Kepla Desa Aek Nauli. Hasil pertemuan itu, semua

sepakat untuk membawa hal ini ke jalur hukum. Kemudian korban bersama keluarganya membuat laporan pengaduan ke Polres labuhan Batu di rantau Parapat. Kemudian membuat pengaduankepadaBupatiPaluta, Drs H Bachrum Harahap. Korban dan keluarganya sangat berharap agar MP dihukumseberat-beratnya,kemudian meminta Bupati Paluta untuk memberikan sanksi kepada oknum Camat tersebut. Korban Lain Sementara informasi dihimpun Waspada, Senin (24/1), ada pegawai TKS lainnya yang akan melaporkan MP dengan kasus serupa ke PolresTapsel. Peristiwa pencabulan kepada DH, terjadi saat pulang menghadiri acara pemerintahan bersama MP di Hotel Tor Sibohi, Sipirok, Kab. Tapsel. Mobil camat yang mereka tumpangi tidak langsung menuju Aek Godang, Kec. Hulu Sihapas, Kab. Paluta. Namun dibelokkan MPkesalahsatukebunyangdikalimnnya sebagai miliknya. Namun pengaduan itu tertunda karena korban diminta membawa akta kelahiran, agar polisi dapat memastikan pasal yang akan dikenakan, KUHP atau UU Perlindungan Anak dan Perempuan. (a20/csp)

Empat Pria Mengaku Anggota Polri Bajak Mobil Muatan Enam Ekor Lembu MEDAN (Waspada): Empat pria diduga mempergunakan benda mirip senjata api mengaku anggota Polri membajak mobil mengakut enam ekor lembudi kawasan Dusun III, Desa Sei Jenggi, Kecamatan Perbaungan, Kabupaten Serdang Bedagai. “Selain membajak mobil mengakut ternak lembu, putra pengusaha ternak bersama sopirnya Sipono, 50, ditelanjangi lalu di buang ke sawah-sawah kawasan Dusun Limbong, Kecamatan Pantai Labu, Kabupaten Deliserdang,” kata korban Iswandi Ba-ngun, 21, putra pengusaha ternak warga Jalan Pancurbatu, Pasar III, Kecamatan Namorambe, Kab. Deliserdang kepada Waspada di Medan, Senin (24/1) sore. Iswandi Bangun didampingi abangnya Hendra Bangun, 22, dan opungnya Ranggi Bangun, 73, mengatakan, peristiwa itu terjadi,Jumat(21/1)diniharipukul 01:30. Awalnya, dia bersama sopirnya Supono warga Desa Sudirejo, Pasar III, Namorambe mengendarai mobil L-30 membeli enam ekor lembu di daerah Limapuluh Kabupaten Batubara dan Kecamatan Perdagangan, Kabupaten Simalungun. Dalam perjalanan pulang ke MedandansampaidiJalanDusun III, Desa Sei Jenggi, Kecamatan

Waspada/Ismanto Ismail

DIRAMPOK: Korban Iswandi Bangun, 21, diapit abangnya Hendra Bangun, 22, dan opungnya Ranggi Bangun, 73, ketika usai memberikan keterangan kejadian itu kepada Waspada, Senin (24/1) sore. Perbaungan, tiba-tiba dipepet mobil Kijang. Merasa tidak bersalah, korban memerintahkan sopirnya berhenti. Selanjutnya empat pelaku memakai topi pet turun dari mobil Kijang. Pelaku mendekati sambil mengaku petugas Polri. Salah seorang pelaku meminta kepada sopirmemperlihatkansuratjalan. Seterusnya, sopir memenuhi permintaan pelaku berupa surat jalan. Ketika diperlihatkan, pelaku langsungmenghardikkorbandan sopir, ini surat jalan tidak resmi. Denganperingasmerekamenarik

paksa korban dan sopir langsung dimasukankedalammobilKijang milik pelaku. Tindakan pelaku bukan sampai disitu saja dan melainkan, kedua tangan korban dan sopir diikat kebelakang pakai tali dan kemudian menutup wajah pakai kain, serta menelanjangi korban dan sopir tersebut. Di dalam mobil korban dan sopir dipukuli dengan menggunakanbendadidugamiripsenjata api. Sedangkan mobil L-300 bermuatan lembu diambil diambil pelaku. Setibaditempatsepikawasan korban dicampakkan di perla-

Rahmat Hidayat: Waspada Referensi Mengajar MEMASUKI areal salah satu pusat pendidikan agama Islam tertua di Tanjungbalai, maka akan bertemu seorang guru dengan penampilan sederhana, namun pekerja keras, enerjik dan perawakan cukup ideal dibalut warna kulit hitam manis, menjadikan pendidik yang murah senyum ini salalu dekat dengan siswasiswanya. Rahmat Hidayat, begitu nama lengkapnya adalah guru Bahasa Indonesia di MTs YMPI Sei Tualang Raso Tanjungbalai. Sebagai seorang pengajar, kata Rahmat, sudah sepantasnya guru banyak membaca karena dalam kehidupan sehari-hari, guru merupakan tempat bertanya masyarakat dalam berbagai persoalan. Dan bila hanya puas dengan ilmu dan pengetahuan yang dimiliki selama ini ujarnya, maka seorang guru tentu tidak mungkin maju terutamadalamhalkeilmuandan pengetahuan. Rahmat, sapaan akrab untuknyamengatakan,salahsatu bahan bacaan untuk menambah ilmu dan pengetahuan sebagai sarana pendukung profesi keguruan yakni Harian Waspada, dimana informasi di dalamnya tersaji secara lengkap dengan suguhan berbagai disiplin keilmuan sehinggadapatdijadikanreferensi dalam memberikan materi ajar kepada siswanya. “Waspada, yah, jujur saja, harian tersebut layak dijadiakan referensi mengajar karena selain informasi yang uptodate, juga


Sumatera Utara


Waspada/Rasudin Sihotang

KOMPETENSI DASAR: Rahmat Hidayat sedang mengajarkan Kompetensi Dasar (KD) gagasan utama dan penjelas pada kolom Tajuk Rencana. menyajikan ilmu pengetahuan yang wajib diketahui oleh siapa saja khususnya guru dan siswa,” ucap Rahmat yang di usianya beranjak 27 tahun ini masih setia hidup melajang. Dikatakan Rahmat, dirinya sangat terbantu mengajar berkat Waspada karena dari koran itu, Rahmat banyak mendapatkan referensi mengajar khususnya bidang studi Bahasa Indonesia. “Hampir semua Kompetensi Dasar(materiyangakandiajarkan) selaluterdapatdiWaspada,seperti pelajaran mengenai berita, pengumuman, tajuk rencana, lklan baris,referensibuku,cerpen,puisi semuanya ada di Waspada,” tutur Rahmat. Selain itu, ujar Rahmat, Waspadajugamerupakankoranyang peduli tentang pendidikan, terbukti beberapa tahun ini para guru dan siswa terbantu dengan

adanya pembahasan soal Ujian Nasional (UN) mulai dari tingkat SD sampai SMA sederajat. Selain itu,wartawandidaerahjugaselalu menyoroti persoalan dunia pendidikan baik itu kebijakan pemerintahterhadappendidikanhingga kehidupan para guru. Rahmat berharap di ulang tahun yang ke-64 ini, Waspada tetap menjadi surat kabar yang terdepan dan tak pernah berhenti menyuarakan kebenaran dan keadilan sesuai dengan semboyannya.“Semoga Waspada tetap eksis dan dapat menjadi pelopor kemajuan pendidikan di Kota Tanjungbalai,” ujar Rahmat sambil menjelaskan dirinya dan sekolah merupakan pelanggan setia Waspada dan selain dalam bentuk cetak,Waspada juga bisa diakses melalui situs internet Rasudin Sihotang

dangansawah.Kemudian,pelaku kabur sambil membawa mobil L-30 bermuatan lembu. Melihat pelaku mengaku petugas Polri pergi, korban dan sopir masing-masing membuka ikatan ditangannya. Selanjutnya mereka mendatangi rumah Kades Limbong keadaan bugil, dan langsung diberikan pakaian. Dalam beberapa menit setelah kejadian, petugas Polsek Beringin datang ke TKP. Karena TKPnya bukandiwilayahhukumnya,maka korban dibawa ke Mapolsek Perbaungan. Dalam kasus itu, petugas Polsek Perbaungan melakukan pemeriksaan terhadap korban dan sopir serta saksi lainnya. “Duaharisetelahkejadianitu, mobil L-300 ditemukan dipinggir Jalan Aksara Medan,” ujar korban dan menurutnya, sesuai informasi di tempat ditemukan mobil Kijang L-300, kendaraan itu parkir sudah dua hari, kerugian lembu yang hilang mencapai Rp50 juta lebih. Kasus ini sudah dilaporkan ke Polsek Perbaungan sesuai dengan No.Pol.: 18/1/2011/SU/Res Sergai/Sek Perbaungan diterima Ka SPK Aiptu Sait AR. (m36)

Siswa SMKN 2 Kisaran Rakit Ratusan In-Focus KISARAN (Waspada) : Siswa Sekolah Menengah Kejuruan Negeri 2 (SMKN 2) Kisaran kembali unjuk kemampuan dalam merakit ratusan In-Focus hanya dalam kurun waktu sepekan. “Dari 500 unit In-Focus yang dirakit siswa asal Asahan, Batubara,Tanjungbalai,Labuhanbatu, Simalungun dan Sergai, siswa SMKN 2 Kisaran mampu menyelesaikan 113 unit,” ujar Kepsek SMKN 2 Kisaran Mahmuddin Syah, Senin (24/1). Selainprestasiini,sebutMahmuddin, SMKN 2 Kisaran merupakan sekolah di Indonesia yang diberikan kepercayaan oleh Kementerian Pendidikan Nasional dalam merakit In-Focus. Mahmuddin menambahkan, seluruh rakitan In-Focus hasil karya para siswa akan disalur-

kan kepada 28 sekolah di 6 kabupaten/kota untuk peningkatan sarana dan prasarana sebagai bentuk upaya pemerintah meningkatkan kualitas pendidikan. Kemampuan merakit InFocus merupakan salah satu dari sederetanprestasiyangdisandang sekolah peraih Sertifikat ISO 9001-2008 itu. Sebelumnya, siswa SMKN 2 Kisaran telah merakit Laptop (Netbook) siap untuk dipasarkan. Tammam Muddin Arif, salah seorang SMKN 2 Kisaran sebelumnya turut menambah perbendaharaan prestasi sekolah penyandang predikat Rintisan Sekolah Bertaraf Internasional (RSBI) itu. Siswa kelas XI Program Study Teknik Pemesinan itu memboyong gelar juara 2 nasional pada uji Kompetensi Metrologi dan


MERAKIT: Puluhan siswa unjuk kemampuan merakit In-Focus di ruang Komputer Jaringan SMKN 2 Kisaran. Dalam sepekan, para siswa berhasil menyelesaikan 113 unit In-Focus. Pengukuran Metalurgi yang dilaksanakan PT Kawan Lama Sejahtera medio November 2010 di Jakarta. Tammam berhak mengikuti

kejuaraan nasional setelah sebelumnya tampil sebagai juara pertama pada uji kompetensi Metrologi tingkat Regional SumutNAD di Medan. (a10)


B6 07.00 Si Doel 09.00 Dahsyat 11.00 Intens 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Sinema Siang 15.00 Kabar Kabari 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Bisik Bisik Menantu 19.30 Putri Yang Ditukar 22.30 Mega Sinema :


07.15 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebritis 15.00 Uya Emang Kuya 16.00 Cinta Juga KUya 16.30 Sensasi Artis 17.00 Liputan 6 Petang 18.00 Islam KTP 19.30 Bintang Untuk Baim 21.00 Arini 22.30 SCTV Sinema 00.30 Liputan 6 Malam

07.00 Upin & Ipin 08.30 LAyar Liburan Sekolah 10.00 Cerita Pagi 11.00 Sidik 11.30 Lintas Siang 12.00 Cerita Siang 13.00 Layar Kemilau 15.00 Layar Spesial 16.30 Lintas Petang 17.00 Cerita Pilihan 18.00 Animasi Spesial 19.00 Sinema Spesial 19.30 Sinema Pilihan 21.00 Cerita Pilihan 22.00 Udin Bui 23.30 Jendela 00.00 Lintas Malam

07.00 Star Kids 08.00 Sinema Pagi 10.00 Kabut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 15.00 Djarum Indonesia 17.00 Topik Petang 17.30 Katakan Katamu 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 World Most Amazing Video 22.00 Mohon Ampun Aku 23.00 Telisik 00.00 Topik Malam

07.00 Sensasi Artis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 FTV Siang 14.00 Happy Song 15.00 KiSS Sore 15.30 Fokus 16.30 Bread, Love & Dreams 17.00 Artis Sahabat 18.00 Dia Anakku 19.00 Nada CInta 21.00 Antara Cinta Dan Dusta 22.00 Mega Asia 00.00 Angling Dharman 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 KPPU 21.05 Top Nine News 21.30 Sentilan Sentilun 22.05 Economic Challenges 23.00 Headline News 23.30 Metro Sports

WASPADA Selasa 25 Januari 2010

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Extravaganza 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19.15 3 Sahabat 20.00 Realigi 21.15 Bioskop TRANS TV 23.15 Bioskop TRANS TV 01.30 Reportase Malam

06.30 Apa Kabar Indonesia 10.00 Coffee Break 11.00 MEnyingkap Tabir 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Nuansa 1000 Pulau 14.30 Yang Terlupakan 15.00 Kabar Pasar 16.00 Pulang Kampung Nih 17.00 Renungan Hari Ini 17.30 Kabar Petang 19.30 Jakarta Lawyer’s Club 21.00 Apa Kabar Indonesia Malam 22.30 Documentary One 23.30 Kabar Arena

08.00 Fanboy & Chum Chum 08.30Vicky & amp-amp 09.00 Back At The Banyard 09.30 Obsesi 10.30 Bukan Sinetron 11.30 Catatan Rahasiaku 12.00 Dr Heppi 13.00 Momon 13.30 Global Siang 14.00 American Funniest 14.30 Petualangan Panji 15.00 Hand Made 15.30 Kuliner LEbay 16.00 Obsesi 16.30 BErita Global 17.00 The Penguin Of Madagascar 18.30 Mong 19.00Vicky & amp-amp 20.00 Sinema Asia

07.30 Selebrita Pagi 08.00 Tom & Jerry 09.00 Scooby Doo 10.00 Mariam Mikrolet 11.00 Rahasia Sunnah 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Bintang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Selebrita Sore 18.30 Pintu Kejutan 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Mata Lelaki 00.00 Jam Malam


Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Film Komedi Romantis Natalie Portman Pimpin Box Office Natalie Portman, sudah berada di posisi tinggi pada musim penyerahan penghargaan bersama Black Swan, menempati posisi No.1 di box office Amerika Utara pada Minggu (23/1), untuk pertama kali dalam lima tahun melalui debut komedi romantisnya.

Kristen Stewart/

Bintang Twilight Hidup Tak Lajim KRISTEN Stewart menjalani hidup yang tidak lazim selama 20 tahun. Sejak dia memerankan Bella Swan dalam film Twilight, dia berubah status menjadi idola muda dengan emosi yang labil dan tanpa privasi, sebagaimana dikutip dari The Washington Post. Aktris itu mengatakan dalam edisi Februari majalah Vogue bahwa dia terganggu karena tidak bisa pergi ke mal karena tidak boleh terlalu sering berada di luar.

No String Attached meraih penghasilan sebanyak 20,3 juta dolar AS dari penjualan tiket di seluruh Amerika Serikat dan Kanada, selama tiga hari pembukaan 21 Januari, demikian keterangan distributor Paramount Pictures. Di film tersebut, Natalie tampil bersama Ashton Kutcher, sebagaimanadikutipdariReuters. Pembukaan itu melampaui dugaan Viacom Inc unit, yang menyatakan film tersebut cuma bisa meraih 25 juta dolar AS. Natalie dan Ashton berperan sebagai teman yang memasuki hubungan seks tanpa ikatan. Namunmasalahpunbelakangan muncul. Paramount menyatakan perempuan adalah 70 persen penontonfilmtersebut,danorang yang berusia di bawah 25 tahun memberi film itu kajian yang palingbagusdalamjajakpendapat di luar bioskop.

Paramountjugamenyatakan tak mungkin untuk menjelaskan bagaimana kehebohan Black Swan membantunya. Tapi semuanya membantu, kata Presidenstudiodistribusitersebut Don Harris. Film itu disutradarai veteran Ghostbusters Ivan Reitman — yang belum melahirkan karya laris sejak Six Days, Seven Nights pada 1998. Film besar terakhir AshtonKutcheradalahWhatHappens inVegas, komedi romantis 2008 bersama Cameron Diaz. Natalie Portman,29 terakhir kali memimpin box office pada Maret 2006, ketika thriler V For Vendetta meraup 26 juta dolar AS selama akhir pekan pertamanya. Posisi kedua ditempati film The Green Hornet, juara pekan sebelumnya dan adaptasi buku komik 3D produksi Columbia Pictures, dengan perolehan 18,1 juta dolar AS. TheDilemmakomediromantis produksi Universal Pictures dibintangiVinceVaughndanKevin James, juga merosot satu tangga, ke urutan ke 3, dengan pemasukan 9,7 juta dolar AS pada akhir pekan keduanya. Masing-masing pemasukan 10-hari kedua film tersebut berjumlah 63,4 juta dan 33,4 juta dolar AS. Drama sejarah Inggris The King‘s Speech bertahan di tempat keempat, setelah Colin Firth menggondol penghargaan Aktor Terbaik karena memerankan King George VI, yang gagap. Film itu, berada di tempat

kesembilan dua pekan lalu, mengantungi 9,1 juta dolar AS dari penjualan tiket dan penghasilan totalnya selama sembilan pekan berjumlah 58,6 juta dolar AS. Film barat True Grit merosot dua tempat ke posisi kelima, dengan penghasilan 8 juta dolar AS. Film pembuatan ulang dua saudara peraih Oscar —Joel dan Ethan Coen— Jeff Bridges dalam peran John Wayne sebagai marshal AS yang pemabuk dan keraskepala.Filmitutelahmeraih 138 juta dolar AS dalam lima pekan. Sementara itu Black Swan, thriler psikologi dengan tema balet yang juga dibintangi Natalie Portman, berada di tempat keenam dengan 6,2 juta dolar AS, denganpenghasilantotal83,5juta dolar AS selama delapan pekan. The Fighter, menghadiahkan Golden Globe untuk Christian Bale buat kategori Aktor Pendukung pekan sebelumnya, melompatduajenjangkeNo.7,dengan pemasukan 4,5 juta dolar AS. Little Fockers, di posisi kedelapan, memperoleh 4,4 juta dolar AS, sehingga pendapatan total lima-pekannya berjumlah 141 juta dolar AS, kendati dinilai miring oleh banyak pengeritik. Film keluarga Yogi Bear berada di tempat kesembilan dengan4jutadolarAS,danTRON: Legacy menutup box office di No.10 dengan perolehan 3,7 juta dolar AS. Selama enam pekan, film tersebut meraup 163 juta dolar AS.(ant)

Stewart sedang menyelesaikan dua film terakhir dalam saga (Twilight) dan harapannya agar film itu memuaskan kepada penggemarnya. Twilight telah membuatnya menjadi bintang, kata Stewart kepada Vogue. Dia berusaha mengetahui apa yang harus dilakukan dengan uang yang diperolehnya. Bintang cilik dalam film Panic Room itu mengatakan adalah hal yang luar biasa jika memberikan uang kepada orang-orang yang tak mampu. (ant)

Andika ‘Kangen’ Ditilang Andika Mahesa vokalis Kangen Band ditangkap di daerah Sawah Besar, Jakarta Barat. Rumor yang berkembang dia terlibat kasus narkoba. Saat dikonfirmasi, Kapolsek Sawah Besar Kompol Lutfi Kurniawan membantah. Namun, dia membenarkan pelantun Pujaan Hati itu memang berurusan dengan polisi akibat terkena razia lalu lintas di daerah Sawah Besar, Jakarta Barat. “Tidak benar itu (narkoba). Hanya pelanggaran lalu lintas saja. STNK mobil yang dia tumpangi ketinggalan. Begitu doang,” sanggah Lutfi saat dihubungi via telepon, Senin (24/1). Lutfi juga menegaskan tidak menemukan narkoba di dalam mobil yang ditumpangi duda satu anak itu. Dia menjelaskan, polisi

Bieber Main Film Glee

JIKA menemukan jalan-jalan di Amerika pada 6 Februari 2011 ternyata sepi, dan tidak terlihat anak-anak baru gede (ABG),

maka tidak salah bahwa itu akibat ulah Justin Bieber. Bintang muda penuh talenta Bieber akan merilis film perdana-

Boy George Kembalikan Patung Curian Penyanyi Boy George menyerahkan satu patung religius, salah satu koleksi pribadinya, kepada pemilik yang asli yaitu suatu gereja di Siprus. Pop Eater melaporkan, setelah tahu bahwa patung Kristus itu sebenarnya dicuri dari Gereja Siprus, George mengembalikanpatungitu.Patungitusudahdimilikinya selama lebih dari 26 tahun. Berdasarkan laporan NME, vokalis Culture Club itu membeli barang tersebut dari seorang pedagang barang seni di London tahun 1985. George tidak tahu asal barang itu. Patung itu sebenarnya milik Gereja Siprus, di pedesaan Siprus bernama New ChoriaKythrea. Gereja itu bisa membuktikan kepemilikan patung itu kepada George. “Saya selalu berteman dengan Siprus dan menjaga patung itu selama 26 tahun. Saya ingin melihat patung itu dipamerkan di Siprus khususnya di Gereja Santo Charalambos tempat patung itu dicuri,” kata George. (ant)

Black Swan/

nya “Justin Bieber: Never Say Never,”. Film itu akan menayangkan sebuah konser Bieber dalam format 3D berbarengan dengan penayangan episode khusus Glee pada Super Bowl Sunday, sebagaimanadikutipdariReuters. Film rumah produksi Paramount Pictures itu dijamin akan menghipnotis dan mengundang teriakanhistorisanakABGselama 30 menit. Film itu sendiri akan hadirdibioskopkesayangananda bertepatan dengan hari Valentine. ilm rumah produksi Fox Glee memiliki penonton setia anak ABG dapat membantu mempromosikan film Never Say Never dibanding video gamenya, Glee merupakan acara TV paling banyak ditonton tahun ini.(ant) Tina Toon/vvn

Rahasia Tubuh Langsing Tina Toon Tina Toon masih sulit melepas imej sebagai penyanyi cilik yang gemuk dan menggemaskan. Tina sudah remaja ini berusaha melepas imej tersebut dengan tampil beda. Sejak beberapa tahun lalu, penampilan Tina Toon berubah drastis. Tubuhnya terlihat lebih langsing. Tina juga sangat modis dalam memilih pakaiannya. Kini ia berubah menjadi sosok gadis remaja yang peduli pada penampilan. Tina mengaku berusaha ke-

rasmenurunkanberatbadannya. Penyanyi ‘Bolo-Bolo’ ini berhasil menurunkan berat badannya sekitar 25 kg. Lantas, apa rahasia sukses tubuh langsing Tina? ‘’Kurangi makan, banyak makan buah dan minum air putih. Banyak kegiatan, fitness setiap hari,’’ kataTina saat ditemui di Sentul City, Bogor, Jawa Barat. Saat menjalani proses penurunan berat badan, penyanyi berwajah oriental ini sangat mendengarkan nasihat ibunya dan juga tekun berolahraga.

“Seringnya nggak makan, olahraganya rutin jadi fit. Untung saja (dalam proses diet), aku tidak drop,’’ ungkapnya lagi. Denganpenampilanbarunya ini, pelantun ‘Cinta Pertamaku’ itutidakjarangmenerimakeluhan dari para fansnya di akun twitter-nya. Kebanyakan para fansnya itu mengaku kangen dengan sosok‘’Tina Si Bolo-Bolo’’. “Aduh Tina kan nggak dibonsai, harus tumbuh juga,’’ lanjutnya dengan tawa lebar. (vivanews)

sedang melakukan razia rutin di kawasan Sawah Besar, Minggu, (23/1) malam. Saat itu, mobil yang ditumpangi Andika bersama temannya ikut terjaring razia. “Kami sedang menggelar operasi rutin. Dia (Andika) dibonceng mobil temannya. Tapi saat dicek, STNK-nya lupa dibawa. Jadi ini hanya pelanggaran lalu lintas biasa saja,” paparnya. Lantaran tak membawa STNK, mobil ditumpangi Andika sempat ditahan di Polsek Sawah Besar. Setelah diurus dengan menunjukkan STNK, mobil tersebut kembali dibawa pulang pemiliknya. “Mobil sempat kita tahan tadi malam. Tapi setelah diurus, pemilik mobil menunjukan STNK aslinya, maka tadi pagi mobilnya sudah bisa dibawa pulang,” tandasnya.(okz)


WASPADA Selasa 25 Januari 2011

B7 Ketiadaan Money Changer Jadi Keluhan Wisatawan

Sejumlah Tokoh Calon Ketua PMI Bermunculan BIREUEN (Waspada): Sejumlah tokoh masyarakat di Bireuen mulai bermunculan mencalonkan diri sebagai Ketua Palang Merah Indoensia (PMI) cabang setempat yang akan dilaksanakan Rabu (26/1) di Bireuen Jaya Hotel. Informasi yang dihimpun Waspada, Senin (24/1), beberapa tokoh yang bakal memmeriahkan bursa calon ketua PMI Bireuen itu antara lain, Murdani Yusuf, SE, Muzakkar, SH, dan Ir Saifuddin. “Tapi yang pasti calon ketua itu pada saat hari pemilihan,” terang Mursal, tokoh muda di sana. Menurut Mursal, siapapun calon terpilih adalah figur yang serius bekerja sosial kemasyarakatan serta mampu membawa organisasi untuk kemaslahatan masyarakat Bireuen, sesuai visi dan misi organisasi itu sendiri.(cb03)

SABANG (Waspada): Kapal pesiar MV. Amedia berbendera Bahamas singgah di Pelabuhan Sabang, Senin (24/1) pagi sekira pukul 08.00. Sayangnya Monye Changer belum ada di Sabang. Menurut data yang dihimpun Waspada di kantor Syahbandar Sabang menyebutkan, kapal mewah ibarat hotel apung itu membawa 312 penumpang dari berbagai negara, sebelum masuk ke Teluk Sabang terlebih dahulu singgah di Mali, India. Setelah bersandar di Pelabuhan BPKS sekira 6 jam, kapal super mewah yang panjangnya 190 meter itu akan melanjutkan pelayaran menuju Pulau Langkawi, Malaysia. Selama di Sabang dipastikan tidak mengalami kesulitan, sebab kata sumber, kapal pesiar yang memiliki kru (ABK) sebanyak 90 orang ini hampir setiap tahun masuk ke Teluk Sabang. “Jadi sudah biasa tidak ada kesulitan lagi,” kata petugas di kantor Syahbandar. Wakil Kepala BPKS, Ir. Nasruddin Daud mengatakan, penyambutan kapal pesiar di dermaga BPKS kemarin siang, akan diagendakan setiap tahun. Begitupun, Nasruddin merasakan kekecewaan turis mancanegara karena ketiadaan money changer (tempat penukaran uang asing dengan uang rupiah). Ratusan penumpang kapal pesiar MV Amedia turun dari kapal menikmati keindahan alam kota Sabang. Pada umumnya mereka lebih senang jalan-jalan kaki sambil mencari souvenir di seputar kota. Ada juga yang naik becak mesin keliling kota Sabang dan menikmati keindahan pantai Sumur Tiga, Pantai Kasih dan taman hiburan Sabang Fair. (b29)

HMI Seminarkan Raqan Lembaga Wali Nanggroe LHOKSEUMAWE (Waspada): Ratusan mahasiswa yang tergabung dalam Himpunan Mahasiswa Islam (HMI) Cabang Aceh Utara menggelar seminar tentang rancangan qanun (Raqan) Lembaga Wali Nanggroe, Senin (24/1) di aula Kantor Walikota Lhoksemawe. Walikota Lhokseumawe, Munir Usman pada pembukaan seminar menyambut baik kegiatan itu. “Semoga hasil dan rekomendasi dari seminar ini akan memberikan sebuah pemahaman dan solusi yang terbaik bagi kita semua,” ungkap Munir Usman. Keberadaan wali nanggroe, menurut walikota, sesuai dengan kesepahaman Pemerintah RI dan GAM yang ditanda tangani di Helsinki, Finlandia. Dalam butir 1.1.7 ditegaskan, lembaga wali nanggroe akan dibentuk dengan segala perangkat upacara dan gelarnya. “Selanjutnya segala legalitas perumusan lembaga wali nanggroe diatur lebih lanjut pada BAB XII Pasal 96 dan 97 Undang-undang Pemerintah Aceh (UUPA),” demikian Walikota Munir Usman. Pemateri seminar Raqan Wali Nanggroe disampaikan para dosen Universitas Malikussaleh. Masing-masing, M. Rizwan Haji Ali, M.A (Dosen Ilmu Politik) dan Amrizal J.Prang, SH.LL.M (Dosen Fakulta Hukum). Ketua panitia pelaksana seminar, Muslihit mengatakan, hasil rekomendasi seminar akan disampaikan kepada DPR Aceh dan Pemerintah Aceh.(b17)

Hantam Kawanan Sapi, Mugee Ikan Meutumpok BIREUEN (Waspada): Sapi liar yang banyak berkeliaran di jalan raya, akhirnya kembali membawa malapetaka. Seperti yang dialami Ahmadi, 20, seorang mugee (agen) ikan, asal Desa Desa Teupin Panah, Kec. Peulimbang, Bireuen, Minggu (23/1) meutumpok (jatuh) ke badan jalan dan mengalami luka setelah sepeda motor Honda GL Pro bermuatan puluhan kilogram ikan basah yang dikendarainya menghantam kawanan sapi di atas badan raya di kawasan Desa Padang Kasab, kecamatan yang sama. Keterangan yang diperoleh Waspada, Minggu (23/ 1), Ahmadi baru membeli ikan di kawasan PPI Peudada hendak membawa ke Pidie Jaya dan kawasan sekitarnya. Naas baginya setiba di kawasan Padang Kasap kawanan sapi menghadangnya di tengah jalan, sehingga dirinya tak tak mampu mengelak, sehingga sepeda motornya menghantam kawanan sapi itu. “Tidak dapat saya elakkan lagi saat itu, saya tak pantas marah sama sapinya, namun kepada pemiliknya kenapa masih juga melepaskan sapinya yang dapat mencelakai orang gara-gara sapinya,” kata Ahmadi kepada Waspada di lokasi lakalantas. (amh)

Rakyat Aceh Harus Dapat Deviden Dari Garuda Waspada/T. Zakaria Al Bahri

BELANJA SOUVENIR: Tampak dua turis asing berbelanja barang souvenir menggunakan uang asing karena di Sabang belum ada money changer (tempat penukaran uang). Foto direkam, Senin (24/1).

Isu Penambangan Emas Geumpang Tak Benar SIGLI (Waspada): Isu yang berkembang di masyarakat tentang emas Geumpang telah ditambang tidak benar. Tiga perusahaan penambang emas berskala internasional, PT East Asia Mineralt, PT Centurion Mineral dan Megallanic Garuda Kencana, ternyata selama ini hanya melakukan penelitian (eksplorasi-red).

Itu terungkap dalam presentasi yang dihadiri perwakilan tiga perusahaan berskala dunia tersebut di Gedung Dewan Perwakilan Rakyat (DPRK) Pidie, Senin (24/1). “Kami selama ini hanya melakukan survey terhadap sumber emas di pegunungan Geumpang. Sampai sekarang kami belum melakukan eksploitasi,” kata Thomas Mulija dari PT Centurion Mineralst.

Ia mengatakan, dari hasil survei atau eksplorasi sementara diakui terdapat kandungan sumber endapan tambang logam berupa emas di perbukitan Kec. Tangse dan Geumpang, Pidie. Untuk menambang hasil tersebut tentunya harus dilakukan secara terbuka melibatkan masyarakat dan tidak boleh tertutup. Sebab, sebagai langkah awal untuk mengambil hasil alam yang dikandung di Kab. Pidie, pihaknya membutuhkan tahap explorasi yang berupa mencari prospek untuk menentukan peluang tambang. Setelah semua selesai dilakukan, pihak perusahaan akan melakukan studi penentuan kelayakan secara ekonomis, tehnologi dengan lembaga perusahaan independent serta diteruskan pembangunan infrastruktur gedung penambangan. Setelah jelas kadar emas yang terkandung. Untuk memenuhi itu membutuhkan waktu lima sampai delapan tahun masa eksplorasi, yang diperkirakan menelan biaya mulai AS $ 500 juta sampai AS $ 2 miliar, paparnya.

Kepala Dinas Perindustrian, Perdagangan dan Koperasi (Disperindagkop) Pidie, Said Mulyadi, SE.MSi mengatakan, dengan adanya presentasi terbuka seperti diharapkan itu yang berkembang selama ini di tengah masyarakat yang dinilainya sudah salah paham, dapat dimengerti masyarakat. Menurut dia, tiga perusahaan besar di dunia tersebut bekerjasama dengan sejumlah perusahaan lokal, dibenarkan hanya sebatas melakukan survey, bukan mengambil hasil emas secara menambang. “Kami berharap masyarakat dan seluruh komponen masyarakat dapat mengerti, jangan salah paham lagi. Sebab mereka hanya melakukan survey. Dan kita selalu mengawasi mereka,” kata Said Mulyadi yang akrab disapa Waled. Hadir Bupati Pidie Mirza Ismail, Ketua DPRK dan sejumlah anggota DPRK Pidie, Kasdim 0102 Pidie, Wakapolres Pidie dan sejumlah tokoh LSM dan masyarakat.(b20)

Sengketa Batas Aceh TimurBener Meriah Meruncing Waspada/Abdul Mukthi Hasan

MENGHANTAM SAPI: Warga membantu memilih ikan milik Ahmadi seorang mugee ikan yang berhamburan di badan jalan kawasan Desa Padang Kasab, Peulimbang, Bireuen, Minggu (23/1), pasca sepeda motornya menghantam kawanan sapi di kawasan itu.

Pengesahan APBK Diharapkan Tidak Molor BIREUEN (Waspada): Dewan Perwakilan Rakyat Kabupaten (DPRK) Bireuen menargetkan pengesahan APBK tahun 2011 tidak molor. Dewan menginginkan ketuk palu anggaran dapat dilaksanakan pada Februari. “Dewan terus intensif membahas sepihak KUA-PPAS yang diajukan eksekutif baru-baru ini. Minimal akhir pekan ini sudah rampung. Memang agak terlambat karena sempat dikembalikan untuk perbaikan,” ucap Ketua DPRK Bireuen Ridwan Muhammad, SE, Senin (24/1). Usai pembahasan PPAS-KUA, katanya, dewan akan melanjutkan ke proses ditetapkan menjadi Rancangan APBK Bireuen tahun 2011. “Dewan bertekad untuk secara bertahap melakukan perbaikan dari soal waktu pengesahan agar tidak molor, tentunya dengan tetap membahas secara teliti,” tegasnya. Sementara informasi lain menyebutkan, rincian PPAS Bireuen 2011 adalah sebagai berikut, pendapatan diperkirakan Rp782 miliar terdiri dari PAD Rp49 miliar, dana perimbangan Rp582 miliar dan lain-lain pendapatan daerah yang sah Rp149 miliar. Sementara total belanja yang Rp776 miliar terdiri dari belanja tak langsung (BTL) Rp484,6 miliar, terdiri dari belanja pegawai Rp 450 miliar, belanja hibah Rp5 miliar, belanja bantuan sosial Rp8 miliar, belanja bantuan keuangan kepada provinsi/kabupaten/kota dan pemerintahan desa Rp19 miliar. Sementara belanja tidak terduga Rp2 miliar. Sedangkan belanja langsung (BL) Rp291 miliar dan pengeluaran pembiayaan hutang 2010 Rp6 miliar. (cb03)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

LHOKNIBONG (Waspada): Sengketa batas antara Kabupaten Aceh Timur dan Kabupaten Bener Meriah, kian meruncing. Setelah sebelumnya Bupati Bener Meriah, Tagore Abubakar, menuduh Aceh Timur mencaplok wilayahnya, kini giliran tokoh masyarakat Aceh Timur yang balik menuding Tagore membohongi publik. Seperti diberitakan Waspada, Sabtu 8 Januari 2011, Bupati Bener Meriah, Tagore Abubakar, mengklaim sejumlah Dusun di Desa Blang Seunong, Kec. Pantee Bidari, Aceh Timur, seperti Dusun Sarah Raja, Sarah Gala dan Sijuek, dulu adalah wilayah sah Kabupaten Aceh Tengah atau Kabupaten Bener Meriah. Untuk memudahkan proses Pemilu tahun 70-an, Bupati Aceh Tengah ketika itu menitipkan sementara dusun itu ke

Pemkab Aceh Timur. Masih menurut Tagore, karena masa penitipan sudah berlangsung puluhan tahun, Pemkab Aceh Timur mengklaim dusun itu masuk dalam wilayah administratif Aceh Timur. Dalam berita itu, Tagore juga menegaskan, pihaknya sampai kini masih menyimpan bukti surat titipan wilayah itu ke Pemkab Aceh Timur, yang dibuat tahun 70-an. Namun pernyataan Tagore dibantah para tokoh masyarakat di Aceh Timur, termasuk para sesepuh Kecamatan Pantee Bidari. Mareka sengaja menemui Waspada, di Lhoknibong—pusat Kecamatan Pantee Bidari, Senin (24/1) kemarin guna menyanggah statement Tagore Abubakar. “Tagore telah membohongi publik. Salah besar jika dikatakan dusun ini dulunya wilayah Aceh Tengah dan dititip

ke Aceh Timur, tahun 70-an. Sebab, sejak 1950-an, Dusun Sarah Raja, Sarah Gala, Sijuek, Pureing dan Peulalu, Desa Blang Seunong, sudah termasuk dalam wilayah Aceh Timur. Ketika itu Blang Seunong masih tunduk ke Kecamatan Simpang Ulim Raya. Kita punya segudang bukti yang hingga kini masih tersimpan rapi di kantor camat,” tegas juru bicara tokoh dan sesepuh Pantee Bidari, Mukim Saleh. Mukim Saleh menambahkan, selain bukti dalam bentuk data dan arsip, hingga kini pihak Aceh Timur juga memiliki saksi kunci yang masih hidup dan mereka tahu persis soal seluk beluk status Desa Blang Seunong. Saksi kunci dimaksud antara lain, Aman Catat (sesepuh Sarah Gala) dan Harun Main, pensiunan PNS kantor Camat Simpang Ulim. (cmus)

Pendidikan Karakter Santri Di NAD Perlu Dicontoh MEDAN (Waspada): Pola pendidikan di pesantren dengan tujuan membangun karakter santri menjadi lebih mandiri, perlu diterapkan dalam sekolah-sekolah umum di Indonesia. Pernyataan itu dikatakan Ketua Tim Peneliti Universitas Negeri Medan (Unimed) Ediyanto, PhD ketika berkunjung ke Pesantren (Dayah) Jeumala Amal di Kecamatan Bandar Baru, Kabupaten Pidie Jaya, Senin (24/1). “Pola yang diterapkan pesantren atau dayah tentunya akan sangat membantu pendidikan di sekolah umum. Maka itu ini perlu ditiru,” kata Ediyanto. Dijelaskan Ediyanto, pihaknya dengan didukung Kementerian Agama kini sedang melakukan penelitian di tujuh provinsi di Pulau Sumatera termasuk Provinsi Nanggroe Aceh Darussalam (NAD) dengan mengangkat tema best practice pendidikan karakter berbasis pesantren dan kitab kuning. “Maka itu kita sangat ingin agar penelitian ini bisa berhasil dan bisa memberikan dampak positif bagi masyarakat dan pendidikan di Indonesia,” katanya lagi. Berbicara soal pendidikan di pesantren, Ediyanto mengatakan pesantren sangat tidak bisa dilepaskan dari kitab kuning yang selama ini menjadi bahan ajar bagi setiap santrinya. Direktur Dayah Jeumala Amal, Tgk Anwar Yusuf, MA, menyambut baik penelitian yang dilakukan Unimed bekerjasama dengan Kementerian Agama ini. Dikatakan dia, paling tidak ada 1.000 dayah yang tersebar di seluruh NAD.

Karena itu, ujar Tgk Anwar, perlu dilakukan kajian secara serius terkait peran pesantren dalam membentuk karakter siswanya. “Saya pikir adalah hal yang positif ketika kita bicara soal pembentukan karakter santri,” katanya. Tgk Anwar juga menyebutkan keprihatinannya terhadap perkembangan dayah-

dayah di NAD. Menurutnya, figur kiai atau ulama pemimpin pesantren semakin tergerus oleh persoalan politik praktis. “Maka itu kini ingin agar para ulama bisa kembali memikirkan dayah dan membangun dayah sesuai cita-citanya masing-masing,” katanya. (rel/m14)

BANDA ACEH (Waspada): Perlu diingat, Garuda Indonesia itu lahir dari Aceh dengan tujuan untuk perjuangan Republik Indonesia. Alasannya, PT Garuda Indonesia jangan melupakan itu. DemikianWakil Gubernur Aceh H Muhammad Nazar menanggapi rencana Kementerian BUMN menjual saham maskapai penerbangan itu kepada publik sebesar tiga puluh persen. Dalam perbincangan dengan Waspada, Minggu (23/1), H Muhammad Nazar menyatakan, rencana penjualan saham maskapai penerbangan milik pemerintah itu kepada publik sah-sah saja. “Tetapi yang perlu diingat Garuda Indonesia itu lahir dari Aceh dulu untuk tujuan perjuangan RI,” tegasnya. Seperti yang sering disampaikan Wakil Gubernur Aceh itu dalam berbagai pertemuan dengan pemerintah pusat maupun dengan masyarakat Aceh, PT Garuda Indonesia tidak melupakan masyarakat daerah paling ujung Pulau Sumatera karena Aceh adalah sebagai daerah modal bagi PT Garuda Indonesia. “Dijual atau tidak saham kepada publik, rakyat Aceh harus dihargai dengan memberikan deviden atau bagi hasil,” tuturnya. Menurut H Muhammad Nazar, mekanisme dan bentuk deviden yang hendak diberikan bisa macam-macam. “Jadi tanpa harus menempatkan saham lagi di Garuda, rakyat Aceh memang pemegang saham pertama secara nyata. Deviden itu bisa dalam bentuk diskon tiket kepada penduduk Aceh atau dana pembangunan sosial secara permanen dan berkelanjutan yang dapat diberikan kepada Aceh atau dengan caracara lain,” terangnya. H Muhammad Nazar juga menuturkan, sebagai Wagub dan masyarakat Aceh dirinya akan terus mendorong agar Aceh dapat keuntungan dari bisnis penerbangan itu. “Harta waqaf Aceh saja yg telah berumur ratusan tahun di Mekkah dan Thaif mau dikembalikan ke jamaah haji Aceh. Karena itu Garuda juga harus melakukan hal sama, artinya berikanlah deviden kepada Aceh dalam berbagai bentuk. Kalau Aceh baik pemda maupun swasta ingin beli saham yang hendak dibuka itu, maka hal tersebut urusan lain, murni bisnis dan kalkulasinya terpisah lagi,” kata Wagub Aceh. H Muhammad Nazar juga berharap agar anggota DPR-RI asal Aceh ikut mendukung pemikirannya itu dengan menyampaikan persoalan-persoalan seperti itu dalam forum-forum resmi maupun tidak resmi. “Saya juga yakin Pak Meneg BUMN punya pikiran yang sama dengan kita,” tandasnya. (b09)

Waspada/Zainal Abidin

MOTIVASI: Dandim 0103/Aceh Utara, Letkol Wakhyono sedang memberi motivasi kepada para siswa kelas-III SMA Negeri 1 Dewantara Aceh Utara, Senin (24/1).

Dandim Motivasi Ratusan Siswa SMAN 1 Dewantara DEWANTARA (Waspada): Ratusan siswa kelas III SMA Negeri 1 Dewantara, Aceh Utara mendapat motivasi untuk melanjutkan pendidikan setelah menyelesaikan pendidikan di sekolah menengah atas. Dandim Aceh Utara, Letkol Wakhyono dalam kunjungannya ke SMAN-1 Dewantara, Senin (24/1) memberi semangat para siswa melanjutkan pendidikan ke perguruan tinggi. Didampingi Kepala Sekolah H. Kasem, SPd.MPd, Dandim menegaskan, meskipun bukan dari keluarga berada, namun bila memiliki semangat yang kuat akan berhasil. Menjelang jam pelajaran, Dandim 0103 juga menjadi pembina upacara bendera di lapangan sekolah. Kepada seribuan siswa dia mengingatkan untuk lebih meningkatkan kedisiplinan. Selain itu, siswa juga harus menjauhi segala bentuk narkoba agar mereka bisa meraih kesuksesan. Sementara menurut Kepala SMAN-1 Dewantara, siswa kelas tiga yang akan mengikuti ujian nasional tahun ini mencapai 301 orang. Mulai sekarang mereka telah dibekali berbagai kegiatan belajar tambahan bisa meraih nilai tinggi agar mereka bisa mencapai nilai maksimal, saat ini siswa membutuhkan motivasi dari berbagai pihak, terutama orang tua murid.(b17)

Laka Lantas Depan SPBU Cunda, 1 Tewas


DISKUSI: Peneliti dari Unimed, Ediyanto, PhD sedang berdiskusi dengan Direktur Dayah Jeumala Amal, Tgk Anwar Yusuf, MA tentang pendidikan karakter di Dayah, Senin (24/1).

LHOKSEUMAWE (Waspada): Aryani, 47, warga Kampung Jawa Lama, Kec. Band Sakti, Pemko Lhokseumawe tewas tergilas truk di Jalan Medan-Banda Aceh depan SPBU Cunda, Lhokseumawe, Senin (24/1) pukul 12.30. Kejadian berawal ketika sepeda motor korban yang berstatus pegawai negeri sipil (PNS) terjatuh saat membelok. Kasat Lantas Polres Lhokseumawe melalui Kanit Laka, Aipda Suardi menjelaskan, Sepmor yang dikendaraai korban BL 5555 NE datang dari arah Barat. Saat berbelok melintasi median jalan yang terbuka, kedaraan Ariyani terjatuh. “Bersamaan datang satu unit mobil barang jenis dump truck dari dari arah yang sama sehingga pengendara sepmor tergilas dengan ban depan mobar,” jelas Suardi. Mobil barang BL 8576 LG tersebut dikendaraai Abdul Rahman,43, warga Desa Cot Gapu, Kecamatan Kota Juang, Bireuen. Saat ini polisi telah mengamankan dump truck untuk diperiksa lebih lanjut.(b17)



WASPADA Selasa 25 Januari 2011

Warga Bambel Minta Jembatan Pedesi Diperbaiki KUTACANE (Waspada): Warga Bambel, Aceh Tenggara, mendesak pihak Dinas Bina Marga setempat agar segera memperbaiki jembatan Pedesi yang kondisinya kian memprihatinkan. Pasalnya, selain papannya telah lapuk dan muncul lubang besar yang menganga, sebagian besi jembatan yang berfungsi sebagai penahan kenderaan yang melintas, terlihat raib. Sadi, salah seorang warga setempat kepada Waspada, Minggu (23/1) mengatakan, ketika jalan Pedesi –Terutung Payung diaspal kontraktor, jembatan penghubung beberapa desa di kecamatan Bambel itu, pernah ambruk ke

dasar sungai akibat dilalui truck bertonase tinggi. Meski telah diperbaiki pihak berkompeten, namun beberapa bulan kemudian, kondisi jembatan itu mulai memprihatinkan dan sangat membahayakan bagi pengguna jalan yang melintas, terutama kendaraan roda tiga dan roda empat. Kadis Bina Marga Agara, Ir Khairul Anwar ketika dikonfrimasi Waspada via telefon selular, Senin (24/1) hanya menjawab singkat, “tahun ini juga jembatan akan kita perbaiki, tanpa menyebutkan sumber dana dan besarnya alokasi dana untuk perbaikan jembatan pedesi tersebut.”(b27)

Paket Kandidat Bupati Agara Jadi Pembicaraan KUTACANE (Waspada): Setidaknya hingga Senin (24/1) di tengah – tengah masyarakat Aceh Tenggara (Agara) mencuat lima paket bakal calon (balon) bupati yang menjadi pembicaraan warga, bakal memimpin Bumi Sepakat Segenep tahun 2012. Semula santer dibicarakan Bupati Agara saat ini, Ir. H. Hasanuddin, B, berpasangan dengan Kadis Dikpora Agara H. Ali Basrah, Spd, MM, namun dua pekan terakhir, bupati yang juga ketua DPD II Golkar Agara ini disebut–sebut bakal menggaet Aminuddin, M.Kes, anggota DPRA hal ini mengundang suara pro kontra dan warga mengatakan soal politik serba abu-abu. Paket lainya yang mencuat Drs. Raidin Pinim, MAP, Kadis Perhubungan Agara, namun kubu Raidin masih disebut, sedang menyerap

aspirasi pasangan yang diinginkan masyarakat, namun nama balon wakilnya yang disebut-sebut, masing-masing, H Ali Basrah, Spd, MM, Kadis Dikpora Agara, Ustadz Abbas, LC ulama kharismatik Agara, Wakil Ketua DPRK Agara Nazaruddin juga santer diusung nama Marzuki Desky, ketua Pemuda Pancasila Agara, dan nama Ridwan,SE,MSi, kepala Bapedda Subulusalam. Kecuali itu, nama Drs.Marthin Desky yang baru dilantik menjadi ketua Baitulmall Aceh ini disebut – sebut bakal menggandeng Ridwan, SE, MSi, sebagai wakilnya, sementara H AmricopengusahadiJakartadibicarakanbakal menggandeng Ridwan S.Sos yang saat ini menjabat Camat Lawe Sigala-gala. Dari jalur independen yang telah mengikrarkan dirinya bakalmajuadalahNasrulzaman,ST,M.Kes.(b28)

Avanza Kontra Truk, 4 Tewas Di Aceh Tamiang KUALASIMPANG (Waspada): Tabrakan maut antara Avanza BK 1875 JL kontra dump truk pengangkut sawit milik PT. Socfindo Sei Liput BL 8129 U mengakibatkan 4 tewas, 2 luka berat dan seorang luka ringan. Peristiwa tabrakan maut itu terjadi di Jalan Raya Banda Aceh-Medan ,persisnya di kawasan Bukit Seumadam,Kecamatan Kejuruan Muda,Kabupaten Aceh Tamiang, Sabtu (22/ 1) sekira pukul 15: 30. Keterangan dihimpun Waspada menyebutkan, Avanza yang meluncur dari arah Kualasimpang menuju Medan itu membawa para pekerja bangunan lapangan Futsal di Aceh Tamiang bermaksud kembali ke Pulau Jawa (baca: Bekasi). Sedangkan dump truk

meluncur dari arah Medan menuju Kualasimpang. Mobil Avanza melaju dengan kecepatan tinggi dan sesampainya di kawasan Bukit Seumadam, sopir mobil Avanza tak mampu mengendalikan kendaraannya. Setahu bagaimana tiba–tiba langsung terjadi tabrakan dengan dump truk yang meluncur dari arah berlawanan, sehingga Avanza terpental jatuh di bawah bukit Seumadam. Akibatnya, 4 orang di dalam Avanza tewas, dua luka berat dan seorang lagi bernama Rinto, 23, warga Bekasi mengalami luka ringan kini dirawat di RSUD Tamiang. Sedangkan sopir dan kernet dump truk selamat dari peristiwa maut itu. (b24)

Target Pendapatan Dan Pembiayaan Rp429 M REDELONG (Waspada): Dalam Kebijakan Anggaran (KUA) Kabupaten Bener Meriah tahun anggaran 2011, Dewan Perwakilan Rakyat Kabupaten (DPRK) Bener Meriah, Senin (24/1) mulai menggelar rapat badan anggaran membahas Kebijakan Umum Anggaran (KUA) dan Prioritas Plafon Anggaran Sementara (PPAS) Kabupaten Bener Meriah, tahun anggaran 2011. Rapat badan anggaran itu, dilaksanakan di ruang sidang DPRK setempat dihadiri sejumlah anggota dewan serta eksekutif. Sidang mulai dibuka Ketua DPRK Bener Meriah, Drs Rusli M Saleh, sekira pukul 10:00. Menurut Drs Rusli M Saleh dalam pidatonya pada saat membuka sidang itu menyebutkan, draft KUA dan PPAS, salah satu bagian dari proses perencanaan pembangunan yang terdiri atas formulasi kebijakan anggaran, perencanaan operasional anggaran yang akan dijadikan acuan dalam menyusun, membahas dan menerapkan rencana kerja anggaran.

Ketua tim panitia anggaran eksekutif yang juga Sekda Bener Meriah T. Islah, MSi dalam kata sambutannya merincikan, target pendapatan dan penerimaan pembiayaan daerah tahun 2011 senilai Rp429.028.422.989. Terdiri atas Pendapatan Asli Daerah (PAD) senilai Rp15.770.100.000, dana perimbangan Rp350.277.299.472, lain-lain pendapatan yang sah Rp57.981.023.517 dan penerimaan pembiayaan senilai Rp5.000.000.000. Menurut ketua panitia anggaran eksekutif ini, untuk kebijakan belanja daerah, alokasi belanjanya diarahkan dapat memberikan dukungan optimal terhadap jalannya tugas dan fungsi pada berbagai SKPD di jajaran Pemkab Bener Meriah. Rencana pengeluaran daerah tahun anggaran 2011 antara lain, belanja langsung senilai Rp153.359.546.228, belanja tak langsung senilai Rp271.768.876. 761, pengeluaran pembiayaan Rp3.900.000. 000, sehingga total belanja keseluruhan senilai Rp429.028.422.989. (cb04)

Puluhan Kendaraan Terjaring TAKENGEN (Waspada): Untuk meningkatkan kesadaran tertib berlalu lintas di Aceh Tengah, Polres dan Kodim 0106 mengadakan razia gabungan. Dalam kegiatan ini puluhan kendaraan yang melanggar terjaring petugas Satlantas dan SUB Den POM setempat. Razia gabungan ini langsung dipimpin Kapolres Aceh Tengah, AKBP, Edwin Rahmad Adikusomo dan Dandim 0106 Aceh Tengah, Letkol, Inf Sarwoyadi yang didampingi, SUB Den POM, Lettu CPM Choirul. “Razia ini setelah adanya koordinasi antara Polres dan Kodim Aceh Tengah karena selama

ini banyak pengguna jalan yang melanggar di sini,” kata Kapolres Aceh Tengah, AKBP Edwin Rahmad Adikusomo, menjawab Waspada, Senin (24/1). Untuk menghindari hal-hal yang tak diinginkan dan supaya tertib lalu lintas, tidak ada diskriminasi bagi pemakai kendaraan yang melanggar, sebut Edwin. Sementara Dandim 0106 Aceh Tengah, Letkol Sarwoyadi menyebutkan, razia gabungan ini direncanakan akan menjadi program rutin yang akan dilakukan minimal sekali dalam sebulan di dataran tinggi Gayo ini.(cir/b18)

GAMBA GEUTANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Peugot nama dan alamat jih. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.


Seorang pria menunjuk ke kabel listrik milik PLN yang melintang di jalan hampir menyentuh tanah. Kondisi seperti ini membahayakan pengguna jalan raya di Desa Kide Geurobak, Kecamatan Darul Ihsan, Kabupaten Aceh Timur. Foto diambil beberapa hari lalu. Pengirim Munawir Sazli, Aceh Timur, 0813970987xx

Waspada/Ali Amran

JEMBATAN LAPUK: Salah seorang warga terlihat hati-hati ketika melintasi jembatan Pedesi Kecamatan Bambel yang kondisinya sudah lapuk dan renggang.

Selundupkan Barang Eks LN, KM Sultan Aceh Diamankan IDI RAYEUK (Waspada): KM Sultan Aceh diamankan pihak kepolisian di Kuala Peudawa Puntong, Kec. Idi Rayeuk, Kab. Aceh Timur, Senin (24/1) sekira pukul 04:00, diduga menyelundupkan barang illegal eks Luar Negeri (LN) ke Aceh. Namun saat penggerebekan, polisi tak berhasil menangkap seorang pun Anak Buah Ka-

pal (ABK) dan tekong (Nahkoda—red) serta masinis kapal. Polisi dari Polda Aceh dan Resort Aceh Timur di bawah kendali Sat Pol Air, menyita ratusan ban mobil eks Luar Negeri (LN) ber sama satu mesin mobil jenis Center. Menurut informasi, saat pembongkaran dilakukan di Kuala Peudawa Puntong, diperkirakan keburu pagi dan air laut mengalami surut, sehingga KM Sultan Aceh ditinggalkan di lokasi 20 meter dari darat. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kasat Pol Air, Aiptu Zainir mengungkapkan, keberhasilan kepo-

lisian ini tidak terlepas dari informasi masyarakat. Aiptu Zainir menjelaskan, setelah diselidiki hingga siang kemarin, KM Sultan Aceh GT 28 No. 445 PPF ternyata dalam kondisi tak bertuan. Meski demikian, sambung Aiptu Zainir, pihaknya tetap mengamankan KM Sultan Aceh ke kantor Sat Pol Air Polres Aceh Timur di dermaga PPI Kuala Idi. “Meski sulit karena tidak ada satu pun tersangka yang kita amankan, namun kasus ini akan kita selidiki, termasuk kepemilikan kapal yang menyelundupkan barang illegal ke Aceh,” kata Aiptu Zainir.(cmad)

ABG Mabuk Digulung WH LANGSA (Waspada): Sekelompok Anak Baru Gede (ABG) yang dalam keadaan mabuk karena menenggak minuman keras (miras) di depan umum, langsung digulung petugas Satpol PP dan WH Kota Langsa. Saat ditangkap, para ABG yang sedang asyik menenggak minuman haram itu tak berkutik dan segera diamankan ke Kantor Satpol PP danWH Langsa. Keterangan yang diperoleh Waspada, menyebutkan, peristiwa itu terjadi Minggu (23/1) sekira pukul 22:30. Saat itu warga melihat sekelompok remaja baru gede sedang berkumpul di jalan Desa Pondok Pabrik kawasan perkebunan sawit PTPN-

I Langsa sambil menenggak minuman keras. Melihat aksi para remaja itu, warga yang merasa resah langsung melaporkan peristiwa itu kepada petugas Satpol PP dan WH Langsa. Tak lama kemudian, petugas Satpol PP danWH Langsa segera meluncur ke TKP dan menciduk kelompok remaja ABG dimaksud. “Mereka (ABG-red) berkumpul sampai belasan orang, tapi saat petugas WH sampai di lokasi mereka banyak kabur dengan sepeda motor, jadi hanya beberapa saja yang berhasil diamankan petugas dan dibawa ke kantor WH,” sebut warga. Kasie Penegakan Kebijakan

Daerah Satpol PP dan WH Kota Langsa Kamaruzzaman yang dikonfirmasi Waspada Senin (24/1) membenarkan pihaknya telah mendapatkan laporan dari warga terkait remaja ABG yang menenggak miras di depan umum di desa Pondok Pabrik. Adapun tujuh remaja ABG pesta miras yang berhasil diamankan petugasWH yaitu,YA, 17, dan WS, 14, keduanya warga Gampoeng Meurandeh Kloneng, Langsa Lama, SP, 18, dan ES, 21, warga Pondok Pabrik, Langsa Lama, MY, 23, warga Gampoeng Teungoh, Langsa Kota, RG, 18, warga Blang Seu-nibong, Langsa Kota dan BR, 22, warga Meurandeh Aceh, Langsa Lama. (ts)

PT PLN Subulussalam Sosialisasikan PPOB SUBULUSSALAM (Waspada): PT PLN (Persero) Cabang Subulussalam melalui Tim Sosialisasi Payment Point Online Bank (PPOB) PLN Wilayah Aceh gelar sosialisasi terkait rencana pembayaran rekening listrik yang jadwalnya akan mulai dilakukan melalui pelayanan bank maupun kantor pos, Maret atau April 2011. Acara ini digelar, Senin (24/1) di Grand Mitra Hotel Subulussalam. Hadir di sana Walikota Subulussalam diwakili Asisten II Azwir, Manajer PT PLN (Persero) Cabang Subulussalam Zarmini, Pabung Kodim 0109 Kapten (Inf) Suryadi, Pabung Polres AKP Mohd Nasir, Perwakilan Perbankan, Kantor Pos dan camat, Kapolsek Penanggalan, Sultan Daulat dan Simpang Kiri, unsur Dinas Pertambangan, Energi dan SD Mineral, sejumlah perwakilan Kepala Sekolah (SD-SLTA) dan para Kepala Desa se-Kota Subulussalam, LSM dan unsur karyawan PT PLN Cabang Subulussalam. Sayid Zulihan, unsur tim sosialisasi dalam paparannya mengatakan, PPOB dilaksanakan untuk memudahkan pengawasan dan pengelolaan terhadap piutang pelanggan, mengamankan arus kas pendapatan, menyederhanakan proses bisnis, efisiensi dan meningkatkan pelayanan kepada pelanggan. Di sisi lain, dengan sistem PPOB pihak PLN diharapkan akan lebih fokus pada pelayanan dan perbaikan kinerja. Menjawab wartawan terkait besaran tunggakan konsumen PLN Cabang Subulussalam, khususnya di Kota Subulussalam pada posisi Desember 2010 senilai Rp297 juta. Sementara untuk Ranting Kuta Fajar yang merupakan tunggakan terbesar sebesar Rp 1,9 milyar dan Ranting Tapaktuan nihil.(b33) Waspada/Khairul Boangmanalu

Zarmini, Manajer PT PLN (Persero) Cabang Subulussalam saat memberikan keterangan pers usai gelar Sosialisasi PPOB, Senin (24/1) di Grand Mitra Hotel Subulussalam.

17 Februari Peringatan Hari Jadi Kute Tekengen Ke-434 TAKENGEN (Waspada): Hari jadi Kute Takengen, ibukota Aceh Tengah dalam sejarahnya belum pernah diperingati. Setelah tim pansus DPRK menetapkan hari jadi Kute Takengen, 17 Februari 1577 M, Pemkab setempat mengagendakan berbagai kegiatan menyambut hari bersejarah bagi rakyat di Danau Laut Tawar ini. “Untuk pertama kalinya, rakyat Aceh Tengah akan memperingati hari jadi Kute Takengen. Semoga dihari jadi Kute Takengen ini, menjadi renungan buat kita untuk bangkit,” sebut Ir H Nasaruddin, MM, Bupati Aceh Tengah menjawab Waspada, Senin (24/1) di Takengen. Penetapan hari jadi Kute Takengen, hasil Pansus DPRK Aceh Tengah, bersama Dinas terkait, bukanlah tidak memiliki akar sejarah. Kajian yang mendalam selama 1 bulan ini, dengan 92 nara sumber dan membolak-balik buku referensi. Mengapa Kute Takengen, bukan Takengon? “Memang secara administrasi kita masih mempergunakanTakengon. Belum baku menjadi Kute Takengen, karena undang-undang tentang nama ini belum dirubah,” sebut Nas. Takengon dengan Takengen itu berbeda maknanya. Kalau Takengon ini lafal yang diucap-

kan pada masa kolonial Belanda. Banyak nama di Aceh Tengah hurufnya diubah oleh Belanda. Bebesen misalnya, kaum imprialis ini merubahnya menjadi Bobasan. Pihak kolonial mengubah huruf e menjadi o. sehingga nama Takengen berubah menjadi Takengon. Takengen memiliki makna yang mendalam dan itu diucapkan oleh leluhur Gayo. Semua tokoh masyarakat yang menjadi sumber bagi tim pansus DPRK Aeh Tengah, menceritakan, Kute Takengen sudah ada pada masa kerajaan Linge. Keturunan reje (raja) Linge inilah yang melahirkan raja terkemuka Aceh Darussalam. Sudah menjadi catatan sejarah, putra Linge, Meurah Johan yang mendirikan kerajaan Aceh Darussalam. Sebelum raja Aceh Darussalam, Sultan Iskandar Muda wafat, Takengen sudah ada, sebut M. Jihad tokoh masyarakat dari Bintang dan Rasyidin tokoh masyarakat Linge. Kata-kata Takengen, keluar dari mulut Sengeda anak reje Linge yang akan mengantarkan gajah putih ku Kute Ni Reje. Sengeda menempuh rute dari Linge via Serule, menuju arah timur Danau Luat Tawar. Di sanalah terucap katakata “sentan ku engon (saat kuli-

hat), maknanya alam yang sangat indah. Kalau begitu harus king ni pakat (bulatkan pakat). “Takengen sendiri perpaduan dua kalimat itu, indahnya alam Gayo yang perlu dijaga dan dilestarikan, dengan bulatnya pakat dan tekad,” sebut Jihad. Sejarah ini bukan cerita dari orang tua kepada anaknya, hingga beberapa generasi. Namun sejarah kerajaan Aceh Darussalam dan hubungannya

dengan Linge, sebuah kawasan terpencil Aceh Tengah, memiliki catatan-catatan yang menjadi tinta emas sejarah. Sejarah pertama memperingati Kute Takengen yang ke 434, puncaknya 17 Februari ini, Pemkab Aceh Tengah merencanakan sejumlah kegiatan besar. “Kita sudah programkan berbagai kegiatan, lagi dibuat drafnya, akan kita usulkan untuk di SKkan bupati,” sebut H Muchlis

Gayo, SH, Kadis Pemuda dan Olah raga. Ada 40 jenis kegiatan yang diusulkan. Pemasangan baliho HUT Kute Takengen ke 434 di 14 kecamatan. Lomba pacu kuda untuk 3 kabupaten. Pawai budaya, pameran pembangunan. Pasar rakyat, pentas SD SMP, pemilihan abang-aka Gayo. Lomba Asmaul Husna SD. Lomba samadiyah antar kecamatan. (b18/cir)

Waspada/Bahtiar Gayo

KUTE TAKENGEN: Di antara hamparan dan gunung, Kute Takengen, sudah ada sejak 434 tahun yang lalu. Hari bersejarah ini, akan diperingati untuk pertama kalinya.

Ekonomi & Bisnis

WASPADA Selasa 25 Januari 2011

Harga Beras Tembus Rp10 Ribu Per Kg MEDAN (Waspada): Harga beras lokal produksi lahan pertanian di daerah Sumatera Utara (Sumut) kembali melonjak menembus Rp10 ribu per kg, diantaranya beras jenis ramos sebelumnya dijual Rp9.500 per kg naik menjadi Rp10.500 per kg. M e n u r u t K Ta r i g a n , pedagang bahan pokok di Pasar Aksara, Senin (24/1), harga beras kualitas terbaik yang melonjak saat ini menembus rekor baru di atas Rp10 ribu per kg akibat kian menipisnya pasokan beras petani lokal ke pasaran. Sejak Desember 2010 hingga Januari 2011 hampir hanya sebagian kecil daerah sentra produksi pertanian padi di Sumut memasuki masa panen, sehingga produksi beras di kilang padi merosot sehingga harga jual melambung, sebutnya. Produksi beras petani Sumut diperkirakan akan mulai bangkit pada Februari hingga April dimana banyak daerah sentra produksi pertanian di berbagai kabupaten memasuki masa panen, namun jumlah produksinya belum diketahui apakah mencukupi kebutuhan, sebutnya. Saat ini harga beras termurah masih dipasok Perum Bulog mendistribusikan dua jenis beras dari luar negeri yakni Vietnam dan Thailand dijual

pedagang rata-rata di bawah Rp7.500 per kg, tuturnya. Sementara itu harga beras produksi petani lokal kualitas terendah seperti jenis IR 64, C4, dan jongkong sebelumnya dijual Rp7.500 per kg telah melonjak menjadi Rp9.500 per kg secara eceran di pasar tradisional. Sementara itu beras jenis kuku balam dijual Rp9.700 per kg dan ramos Rp10.500 per kg, namun khusus beras kualitas terbaik pasokannya kian menipis di pasaran dan akan pulih menjelang Maret bulen depan, katanya. Perda BKP Tentang banyaknya produksi pertanian Sumut dipasok ke luar daerah terkait perbedaan harga tinggi BKP mengharapkan pihak pemerintah daerah dan provinsi melahirkan Perda tentang penataan produksi pangan sehingga daerah berlebih akan mengalihkan ke daerah yang kekurangan. Namun ketika disinggung tentang tindakan apa dilakukan jika para pelaku usaha melanggar Perda tersebut, Purwadi mengatakan hal tersebut akan digodok dalam usulan akan dilakukan, sebutnya. Hal tersebut dikatan Kepala Badan Ketahanan pangan (BKP) Sumatera Utara Setyo Purwadi dalam rapat bersama Anggota DPD RI Parlindungan Purba dan anggota DPRD Sumut Brilian Mochtar. Saat ini pihaknya bersama tim pengendali inflasi daerah ( TPID) sedang melakukan koordinasi menekan harga pangan dan tingginya inflasi

Menkeu Perkirakan Revisi APBN Juli JAKARTA (Waspada): Menteri Keuangan Agus Martowardojo memperkirakan kemungkinan pemerintah akan mengajukan revisi pada APBN 2011 (APBN-Perubahan) di bulan Juni atau Juli, bila tekanan harga pangan terus mengancam laju inflasi. Untuk saat ini pemerintah masih belum longgarkan asumsi inflasi dalam APBN 2011. “Kita masih pegang sampai kita nanti kaji dan revisi. Dalam organisasi tidak bisa kemudian dilonggarkan begitu aja, kita harus berupaya tinggi mencapai indikator ekonomi makro yang diajukan dalam anggaran,” katanya di Jakarta, Senin (24/1). Terkait tekanan harga pangan yang berakibat pada tingkat inflasi, Menkeu mengindikasikan kemungkinan revisi APBNP 2011 pada pertengahan tahun ini. “Kalau APBN-P kami belum bisa sekarang, tapi mungkin indikasinya di Juni-Juli,” jelasnya. Seperti diketahui, tekanan harga pangan dunia yang kian melonjak diakui pemerintah bisa mengancam inflasi dalam negeri. Beberapa kebijakan digulirkan pemerintah untuk mengatisipasinya, antara lain pembebasan bea masuk 57 pos tarif bahan pangan, pakan ternak, dan pupuk. Kepala Badan Pusat Statistik (BPS) Rusman Heriawan menyatakan dengan adanya kebijakan tersebut akan menekan laju inflasi. Pasalnya, harga pangan di luar negeri yang lebih

rendah dari dalam negeri ditambah dengan adanya pembebasan bea masuk akan memicu imported deflation. Namun, dia mengungkapkan, pihaknya masih belum dapat menyatakan berapa besar tekanannya terhadap laju inflasi tahun ini, masih harus dikaji lagi. “Belum, belum bisa diketahui sekarang. Tapi power-nya adalah menahan inflasi pasti. Selama harga dunia rendah,” ujar Rusman. Senada BPS pihak Bank Indonesia (BI) pun terus mewaspadai sumber-sumber tekanan inflasi, terutama yang berasal dari kenaikan harga bahan pangan serta kemungkinan penyesuaian harga-harga yang ditetapkan pemerintah. “Meningkatnya ekspektasi inflasi akibat risiko naiknya harga pangan, yang telah mempengaruhi persepsi dan dinamika di pasar keuangan domestik akhir-akhir ini. Hal ini juga menjadi perhatian khusus kami,” kata Gubernur BI Darmin Nasution, Jumat (21/1) malam, dalam acara Bankers Dinner di Jakarta. Darmin menambahkan, pihaknya dan pemerintah akan terus menjalin koordinasi dalam rangka mempertajam programprogram untuk meningkatkan sisi pasokan dan perbaikan distribusi bahan kebutuhan pokok. Sehingga koordinasi ini akan membawa ke target inflasi di kisaran 5 persen pada 2011 dan 4,5 persen pada 2012.(j03)

pada akhir tahun lalu. Pasok beras Diantaranya meminta Perum Bulog secara berkesinambungan memasok beras berasal dari cadangan pemerintah ke pasaran sesuai permintaan pedagang untuk meme-

nuhi kebutuhan masyarakat agar harga beras yang tinggi dapat ditekan secara murah, ujarnya. Disamping itu BKP juga telah melakukan koordinasi dengan Dinas Pertanian Sumut dan seluruh kabupaten kota agar memberikan laporan

tentang produksi padai di daerahnya masing-masing sebagai langkah untuk meningkatkan produksi beras petani, sebutnya. Selain itu peningkatan produksi cabai dan jenis sayur mayur lainnya di seluruh daerah sentra pertanian akan dipuayakan untuk ditingkatkan, tutur-

B9 Eximbank Pacu Penyaluran Kredit

nya. Anggota DPD RI Parlindun g a n Pu r b a j u g a s a n g a t mengharapkan BKP sebagai instansi melakukan koordinasi tentang kondisi pangan agar benar-benar menjalankan komitmen tugasnya sesuai fungsi, sebutnya.(m40)

MEDAN (Waspada): Untuk meningkatkan pertumbuhan ekspor di Indonesia, PT Indonesia Eximbank menargetkan pembiayaan kredit ekspor lebih tinggi dari 2010 mencapai 69,61 persen dari tahun 2009. Direktur Eksekutif (CEO) Indonesia Eximbank, I Made Gde Erata di Medan, kemarin menyatakan angka tercatat pada akhir 2010 mencapai Rp15,74 triliun dan tahun 2009 berkisar Rp9,28 triliun. “Kenaikan kredit ekspor tersebut lebih besar dibanding pertumbuhan rata-rata kredit perbankan nasional. Hal ini dikarenakan eksportir Indonesia mampu melakukan penetrasi ke pasar-pasar seperti negara-negara kawasan Timur Tengah,” ujarnya. Selain Timur Tengah, lanjutnya, penetrasi produk RI juga masuk ke pasar-pasar non tradisional seperti kawasan Eropa Timur, Eropa Tengah, dan Afrika Utara. “Dengan semakin meningkatnya ekspor tersebut telah mendorong kenaikan pemberian kredit sehingga pada akhir 2010 pembiayaan kredit melebihi dari target ditetapkan atau sebesar Rp15,5 triliun,” lanjutnya. Dari data telah dikumpulkan, lanjutnya, sektor ekonomi utama dibiayai seperti perindustrian 51,02 persen, pertambangan 10,94 persen, pertanian 10,54 persen, pengangkutan dan pergudangan 9,80 persen, dan jasa-jasa lainnya 8,94 persen. “Sedangkan dari sektor industri terbesar dibiayai meliputi industri kelapa sawit 15,47 persen, industri maritime 13,35 persen, industri tekstil 7,33 persen, jasa dunia usaha lain-lainnya 6,30 persen, industri karet 6,03 persen, pertambangan minyak dan gas bumi 5,73 persen,” ujarnya. Selain itu, lanjutnya, pertambangan baru-bara 4,05 persen, perkebunan kopi 3,43 persen, industri perabot 3,42 persen, industri makanan 3,32 persen, industri otomotif 3,02 persen, dan lainnya 2, persen lebih. (m38)

5 BUMN Kebun Lepas Saham Tahun Ini

Waspada/Jaka Rasyid

IKAN DEPIK: Ikan Depik merupakan hasil alam potensial dari Danau Laut Tawar, ikan depik kering khas dari wilayah tengah Aceh ini di jual Rp110 ribu per bambu, sementara depik basah di jual Rp100 ribu perbambu. Ikan ini menjadi oleh-oleh tamu yang berkunjung ke Takengon. Tampak aktifitas pejual ikan depik di Pasar Ikan Takengon, Kabupaten Aceh Tengah Sabtu (22/1) sore.

BI Cermati Gangguan Inflasi Pada Pertumbuhan

J A K A RTA ( Wa s p a d a ) : Gubernur Bank Indonesia (BI) Darmin Nasution mengatakan, BI mencermati penguatan kegiatan ekonomi pada 2011 yang diperkirakan akan disertai peningkatan tekanan inflasi. Karena itu BI terus mewaspadai sumber-sumber tekanan inflasi, terutama yang berasal dari kenaikan harga bahan pangan serta kemungkinan penyesuaian harga-harga yang ditetapkan pemerintah. “Meningkatnya ekspektasi inflasi akibat risiko naiknya harga pangan, yang telah mempengaruhi persepsi dan dinamika di pasar keuangan domestik akhir-akhir ini juga menjadi perhatian khusus kami,” katanya akhir pekan lalu, dalam acara Bankers Dinner di Jakarta. Darmin menambahkan BI dan Pemerintah akan terus menjalin koordinasi dalam rangka mempertajam programprogram untuk meningkatkan sisi pasokan dan perbaikan distribusi bahan kebutuhan pokok. BI mengharapkan pemerintah akan menangani hal ini dengan sebaik-baiknya. Sinergi kebijakan dan jalinan koordinasi tersebut diyakini akan membawa inflasi pada sasarannya yaitu 5 persen pada 2011 dan

4,5 persen pada 2012. Selain itu, sambung Darmin, BI tetap berkomitmen untuk mengarahkan BI Rate guna mencapai target inflasi jangka menengah menuju kisaran 3,5 persen. Dengan begitu, diharapkan akan menstabilkan kisaran suku bunga bank. “Penetapan BI Rate ini dilakukan dengan takaran tepat agar inflasi dan ekspektasi inflasi mengarah pada target inflasi tersebut tanpa mengorbankan pertumbuhan,” jelasnya. Target inflasi jangka menengah tersebut dapat dicapai pada 2015, sehingga inflasi Indonesia sejajar dengan negara kawasan di ASEAN. “Dengan inflasi yang semakin rendah dan stabil yang disertai perbaikan berbagai kendala struktural maka pada 2015 diperkirakan perekonomian Indonesia dapat tumbuh hingga 7,5 persen,” tegas Darmin. Na m u n D r a m i n j u g a menghimbau agar industri perbankan Indonesia untuk mengatasi efisiensi mengingat permodalan, aset dan efisiensi masih rendah dibandingkan negara lain di kawasan. Menurutnya, rasio biaya operasional terhadap pendapatan operasional (BOPO) dan

net interest margin (NIM) bank di Indonesia masing-masing 81,6 persen dan 5,8 persen. Sedangkan Singapura, Malaysia, Thailand, dan Filipina rasio BOPO berkisar 32,7 persen-73,1 persen dan NIM sekitar 2,3 persen-4,5 persen. “Hal ini menunjukkan efisiensi perbankan Indonesia terendah di ASEAN-5,” ujar Darmin. Lebih lanjut Darmin mengatakan, padahal rata-rata kenaikan harga saham perbankan di Indonesia sangat fantastis. “Saya meminta perbankan untuk berupaya mengejar ketertinggalan dalam inflasi,” tegas Darmin. Untuk itu pihaknya telah menyiapkan beberapa langkah untuk membuat NIM itu secara bertahap turun. BI pun akan berusaha untuk menurunkan NIM mendekati 4 ( persen). “NIM kita 5,8 persen. Kita tentu saja pertama tidak berani mengatakan menggiringnya ke arah 3 tapi mendekati 4 kita usahakan. Memang tidak bisa cepat tetapi kita usahakan,” tambah Darmin. Sementara itu, Presiden Direktur PT CIMB Niaga Tbk Arwin Rasyid mengatakan, dasar efisiensi dilihat dari cost income ratio, dimana saat ini

perbankan nasional rata-rata di bawah 30 persen. “Kondisi tersebut sebanding dengan bank-bank global,” tuturnya. Selain itu, Indonesia memiliki selisih bunga pinjaman dan deposito yang tinggi. Hal ini disebabkan inflasi lebih tinggi dan posisi suku bunga yang lebih tinggi juga dari pada negara lain. Meski demikian, Darmin mendorong perbankan nasional agar lebih berani lagi mengambil peranan membangkitkan kembali sektor korporasi dengan layanan berkualitas dan biaya efisien. Dia melihat ada masalah besar, di mana dalam kondisi likuiditas perbankan berlebih, justru peran perbankan dalam pertumbuhan ekonomi masih rendah. Hal ini terlihat dari rasio kredit terhadap PDB pada 2010 hanya sekitar 26,1 persen dan sedikit meningkat dari 25,7 persen pada 2009. Rendahnya rasio tersebut merupakan dampak krisis 1997/ 1998 yang telah menyebabkan perekonomian nasional tergolong dalam low laverage economy. Karena itu perbankan harus kreatif mengambil peran lebih besar membangkitkan kembali sektor korporasi.(j03)

Tungku Masak Asal Lampung Diminati Warga Sergai

Waspada/Edi Saputra

TUNGKU MASAK: Pedagang tungku masak asal Lampung ketika akan menjajakan dagangannya ke pelosok Kab.Serdang Bedagai. Foto direkam, Senin (24/1) di Dusun XIV Desa Firdaus Kec. Sei Rampah.

SEIRAMPAH (Waspada): Selain mahal dan sulitnya mencari minyak tanah, serta banyaknya warga trauma untuk menggunakan (beralih) ke LPG kehadiran tungku masak asal Palembang sangat diminati karena menjadi salah satu alternatif bagi masyarakat khususnya Kab.Serdang Bedagai dalam hal memenuhi kebutuhan masak memasak. Pedagang tungku masak asal Desa Braja Mulia Kec. Braja Selebah Kab. Lampung Timur, Lampung Azis, 26, Herintanto, 36, dan Johan, 23, mengatakan, mendatangkan tungku masak beriameter 10 inchi dengan tinggi hampir 40 centimeter yang terbuat dari campuran tanah liat, abu jerami ditambah abu batu-bara, jelas mereka ketika disambangi Waspada,

Senin (24/1) di rumah sewaan mereka di Dusun XIV Desa Firdaus Kec. Sei Rampah. Diakui Azis, satu unitnya tungku dijual eceran seharga Rp80 ribu hingga Rp90 ribu langsung dipasarkan ke masyarakat Sergai baru beberapa pekan saja sudah menghabiskan 450 unit. “Di Sergai ini ada tiga lokasi pemasaran tungku, satu di Desa Firdaus Kec. Sei Rampah dan dua di Desa Payalombang, Kec. Tebingtinggi dalam sebulan terakhir telah memasarkan sekira 1.350 unit yang berarti sangat diminati,” tutur Azis. Sementara itu Ida,45, warga Dusun XIV, Desa Firdaus, Kec. Sei Rampah, ibu rumah tangga yang membuka usaha warung nasi kepada Waspada, mengaku baru dua minggu membeli

tungku masak seharga Rp90 ribu yang ternyata sangat membantu, selain hemat kayu bakar, panas ditimbulkan cukup baik dan praktis bisa digeser ataupun dibawa kemanapun dan terpenting tidak tergantung lagi dengan minyak tanah, paparnya. Hal senada juga diutarakan Sunarwati, 57, warga Dusun Dusun III Desa Sei Rejo, Kec. Sei Rampah sudah menggunakan tungku itu hampir satu tahun dibelinya seharga Rp100 ribu per unitnya, jelasnya. “ Keistimewaanya hemat kayu bakar dan panas yang sempurna sehingga sejak menggunakannya tidak ketergantungan lagi dengan gas LPG dan minyak tanah,” tambah ibu telah puluhan tahun membuka warung di desa itu. (ces)

JAKARTA (Waspada): Lima perusahaan perkebunan pelat merah atau Badan Usaha Milik Negara (BUMN) akan melepas sahamnya kepada publik pada kuartal III-2011 hingga akhir tahun ini. Namun, menurut Deputi Menteri BUMN Bidang Industri Primer, Megananda, kementerian tidak akan melepas saham lima perusahaan tersebut bersamaan. “Kami akan pilah dulu, sambil melihat mana lebih siap,” ujar dia di kantornya, Jakarta, Senin (24/1) Adapun lima perusahaan tersebut adalah PT Perkebunan Nusantara (PTPN) III, PTPN IV, PTPN V, PTPN VII, dan PTPN XIII. Megananda menuturkan, semua PTPN tersebut saat ini kondisinya lebih baik dibanding sebelumnya. Total aset seluruh BUMN perkebunan itu sepanjang 2010 sebelum audit mencapai Rp44 triliun, dengan pendapatan sebesar Rp40 triliun. Dia melanjutkan, pelepasan saham ke publik tersebut akan dilaksanakan setelah perusahaan perkebunan pelat merah itu membentuk induk usaha (holding). Menurut rencana, kementerian akan membentuk holding perusahaan perkebunan pada kuartal I-2011. Sebelumnya, Menteri BUMN Mustafa Abubakar mengatakan rencana pembentukan holding BUMN perkebunan dipastikan tidak akan mengganggu rencana sejumlah PTPN akan melakukan penawaran umum perdana saham (initial public offering/IPO). Direktur Utama PTPN III, Amri Siregar berharap IPO dapat dilaksanakan tahun ini, dengan pelepasan 25-30 persen saham dan target dana sebesar Rp3 triliun. “Prioritas kami IPO, karena sudah siap. Saya harapkan IPO bisa tahun ini supaya daya tawar ke investor makin kuat,” kata dia. Dana hasil IPO akan digunakan perseroan untuk ekspansi usaha, di antaranya mengakuisisi lahan milik swasta, pengembangan industri hilir, peremajaan (replanting) kebun, pembangunan pabrik baru, dan kerja sama operasi (KSO) dengan PTPN I guna revitalisasi lahan sawit dan karet seluas 41.200 hektare. (vvn)

XL Sediakan Layanan Minta Pulsa Internasional PT XL Axiata Tbk (XL) tidak pernah berhenti melahirkan inovasi yang dapat memaksimalkan layanan-layanannya. Salah satu yang terbaru dan inovatif adalah layanan Minta Pulsa Internasional, yang memungkinkan pelanggan XL Prabayar di Indonesia meminta pulsa dari pelanggan operator lain yang berada di luar negeri, untuk sementara baru Malaysia. Layanan ini merupakan hasil kerjasama antara XL dengan Tranglo, Celcom, dan Maxis. VP Enterprise & Carrier XL Titus Dondi, mengatakan layanan Minta Pulsa Internasional ini merupakan terobosan XL untuk yang kesekian kalinya, yang semakin memudahkan pelanggan XL prabayar di Indonesia. Terutama yang memiliki kerabat atau keluarga di luar negeri. Untuk sementara layanan ini baru berlaku di Malaysia, yang berarti dapat dimanfaatkan oleh para pekerja migran Indonesia di sana dan keluarganya. “Kami berharap, ke depan, layanan ini bisa dikembangkan ke negara lain yang juga banyak pekerja migran kita, semisal Timur Tengah,” katanya. Pada layanan ini, yang merupakan kerjasama antara XL dengan Tranglo (perusahaan penyedia jasa transaksi financial secara mobile), pelanggan XL Prabayar dapat meminta pulsa dalam jumlah tertentu kepada seseorang di Malaysia. Untuk sementara, baru pelanggan operator Celcom dan Maxis yang bisa dimintai pulsa. Pelanggan yang meminta pulsa cukup mengirimkan SMS ketik MINTA<spasi>Nomor yang dituju<spasi>jumlah yang diinginkan lalu kirim ke 313, contoh: MINTA<spasi>60126330830<Spasi>25000. Tranglo sebagai partner kemudian akan memforward permintaan pulsa kepada nomor yang dimintai pulsa menggunakan platform gloRequest. Jika permintaan itu disetujui, maka Tranglo akan meminta XL untuk mengisi pulsa ke nomor peminta pulsa mengggunakan platform gloTransfer. Jumlah pulsa yang bisa diminta adalah 25.000, 50.000, dan 100.000. Sementara itu, tarif yang dikenakan pada setiap transfer pulsa yang disetujui adalah Rp1.000. Pelanggan tidak akan dikenakan biaya jika permintaannya tidak disetujui. Untuk bisa melakukan permintaan pulsa, pelanggan minimal harus memiliki pulsa 1.000. Proses meminta dan transfer pulsa dapat dilakukan secara instan, mudah, dan aman. Baik pelanggan XL yang meminta pulsa, maupun pihak yang dimintai pulsa sama-sama akan menerima notifikasi melalui SMS. Sebelum layanan ini, XL juga telah memiliki layanan hampir serupa yaitu XL Bagi Pulsa Internasional. Layanan yang cukup membantu para pekerja migran Indonesia di Malaysia tersebut memungkinkan pelanggan Celcom di Malaysia bisa mengirimkan pulsa ke pelanggan XL di Indonesia.

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Selasa, 25 Januari 2011




KIA Carnival Diesel Matic Thn. 2000. Hitam, BK Rp. 79Jt. Hub. 0813 6145 0444

SUZUKI Sidekick Thn ‘97/98 Hitam, BK Mdn asli, Lengkap siap pakai, Originil, Hrg 76 Jt/damai HP. 0812.6545.1974

DANA Th. 75 - 2010 MOBIL + Sp. MOTOR % D. TRUCK + TRONTON, BM: KILAT T.OVER: SHM + SKC + DP & KTA BPKB Mr. JG.0813 7548 5990, 777 90 557

Informasi Pembaca

MERCEDES BENZ M/T 230 E Biru met Thn. 89. Sgt orisinil. Mewah, mulus dan terawat sekali. Hrg. 45Jt Nego. Hub. 0813 7550 1012

SUZUKI Carry Extra (Adi Putro) 1987/ 1988. Mulus/Siap pakai/VR/BR/Tape. Hub. 061.77721957 - 0852 6215 9494 (TP)

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)


Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

* DIJUAL BMW 318I * Thn. 89/90. W. Hijau tua metalik. BK 2 angka. Velg 16 inc. Ban Baru, jok kulit. MB Tech. Alarm. AC dingin, Body sgt mulus sekali. Hub. 0812 6552441 Harga Nego.


Xenia Li....DP 12 Jt-an......Angs. 3 Jt-an Terios........DP 14Jt-an.......Angs 4 Jt-an Luxio.........DP 9 Jt-an........Angs 4 Jt-an Hub. JOSUA - 061.77004944 / 0812 6311 0820

DAIHATSU Espass 1.3 Thn. 95 W. Silver met. Mulus. BK Mdn, Pintu sorong. BK VR, AC, TR. Hub. 0811 618906, 061.76654120 DAIHATSU READY STOCK NIK 2011

- Xenia DP Mulai 14 Jutaan Angs. 3 Jutaan - Pick Up DP Mulai 10 Jutaan Angs. 2 Jutaan - Luxio DP 8Jutaan Angs 3 Jutaan Buruan Proses Cepat dan Jaminan Garansi 3 Thn. Daihatsu. Hub. TEDDY 77884663 / 0812 6325 656

HONDA City thn 96 warna merah BK Medan 2 Angka, mulus, siap pakai. Harga 68Jt Nego. Hub. 0812 6351 3360 HONDA CIVIC WONDER 1986. Warna biru metalik. BK Asli Medan, Tape, AC, Jok kulit, mobil siap pakai. Hub. 0813 9754 2141. Harga Nego.

HONDA Jazz IDSI M/T Thn. 2004. Biru met, BK Mdn Rp. 115Jt. Hub. 0816 3113 953 Dijual sedan HONDA Prestise thn. 87 warna coklat - metalik. AC, Tape, VRBR, Mulus, siap pakai. H. 23 Jt. 500/ Nego. HP. 0813 7031 0953

ISUZU Panther LDX Coklat Metalik. P. Steering, P. Window, 4 Pintu. BK Asli Medan. BK Panjang, Tape, Accesories, Remote Alarm, Cantik luar Dalam. Mulus Bang. Harga 45Jt/Nego Hub. 0812 6568 818 / 77305875 ISUZU Panther LDX 91 Coklat Metalik. P. Steering, P. Window, Alarm, Jok baru, Mesin sehat, mulus luar dalam. Siap pakai jalan jauh. Lihat dulu. Harga Nego. 45/Nego. Hub. 0812 6568 818 / 7730 5875

ISUZU Panther LDX Thn. 91 (Diesel) Hrg. 39 Jt Hub. 0852 5485 9636

DIJUAL/OVER KREDIT * L300 Pick Up 2004. Balik DP 33 Jt. Bulanan 2.561.000,Selama 31 bln. * L300 Pick Up 2005 93 Jt Nego. Hubungi 0852 6212 0411

GRANDIA ‘02. Merah, Solar, Lengkap Rp. 106.000.000/ Nego. HP. 0812 6358 1395 - 0815 3004 395 MITS. Kuda 1999, merah dunhill, bensin, lengkap AC Central, vr, dvc disc, elect mirrow hub. acuan Jl. Kirana 17 bisa tukar tamb, cash credit 77159251 - 0811635101, mesin, vosneling, gardan, sehat, body originil, tinggal pakai saja.

OPEL Blazer LT DOHC Thn. 01 Warna biru Silver Hrg. 68Jt. Hub. 0812 6542 4866 SUZUKI Real van Thn. 2003 W. Hijau Met, Mulus. Jual Cepat Hrg. 53Juta Nego. Hub. 061-7776 9494 Maaf TP. SUZUKI Sidekick Thn. 96, warna biru tua met, AC, CD, VR, BR, CL, Asli Medan, Kondisi bagus. Hub. 0812 6338 789 - 77603984 SUZUKI Carry Elvan DRD Tahun 2004 warna merah metalic. BK Medan asli. Satu nama dari baru. Kondisi mulus, sangat seperti baru. Dijual Cepat. Hub. 0813 9610 1939

DIJUAL CEPAT SUZUKI KATANA 96. Hitam metalik. AC, Tape, Velg Racing, Body Kaleng. Mesin Bagus dan mulus. Harga Rp. 45 Jt. Hub. 0852 7630 6013 TP.


SUZUKI Katana GX ‘93. Mulus, lengkap. Harga 43,5Jt/Nego. Hub. 0812 6541 424 - 061.77438080

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

# TOYOTA BARU # Ready Avanza, Altis DP 58 Jt-an. Yaris DP 22 Jt an. Innova DP 34 Jt-an. Fortuner DP 61 Jt-an. Hub. FERY 0852 6113 7592 atau 7781 6673


TOYOTA Kijang Grand Rover Diesel Thn. 98. Biru, BK Mutasi Rp. 75Jt. Hub. 0812 6594 2789 TOYOTA Kijang Capsul Model LGX New Bensin 1,8 EFI Thn. 2003. Sgt mulus, orisinil, Biru muka, VR 17, BR, PS, PW, CL, RMT, E. Miror, AC DB, DVD, MP3, Pake TV, Full Acesories. Hrg. 135 Jt. Nego. Hub. 0812 4431 7686 TOYOTA Avanza Thn. 2006 Dijual. Type G. BK Medan Asli, Warna silver, Cat asli mulus. Mesin halus, Km. Rendah. 42.000. Mobil masih seperti baru. Harga Rp. 128 Juta/Nego. Hub. 0812 6038 561

TOYOTA Kijang Kapsul LX Thn. 97 (Bensin). Silcer metalik Hrg. 81 Jt. Hub. 0821 6056 4141

TOYOTA Kijang LGX, DSL ‘00. Htm, AC DB, VR, BR, Jok Klt. Rp. 26Jt. Angs: 3,59Jt (langsung BW Plg). Toyota Soluna XLI ‘02, BK Medan asli, silver, AC, RT, VR, BR (baru), DP 16Jt. Angs: 2,23Jt. Hub. 061.76700 976

!! TOYOTA 100% BARU !!

* TOYOTA 2011 * Fortuner, Innova, Avanza, Yaris, Rush Cash / Credit, Proses Cepat, Terima Tukar Tambah. Hub. (BUDI) 0821 6060 4998 / 061-6969 9882


TOYOTA Kijang Grand Extra 1.8 Dijual. Thn. 96/97. Hijau met, Long, AC, DB, Tape, PS, PW, CL, VR, BR, Remot. Mobil sangat mulus. Hrg. 75 Jt damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr dari Simpang (4) Lampu Merah Maaf TP.

TOYOTA Kijang Commando Dijual. Th. 90. 5 Speed. Merah maron, siap pakai, lengkap. Harga nego. Hub. HP. 0813 6168 9835

TOYOTA Great (Sedan) Thn ‘92 akhir dijual, W. Biru Met, VR, BR, AC, PS, TP CD, Remote, Spion model lipat, Siap pakai, Hrg 65 Jt/nego Hub. 0813.7030.1442

TOYOTA BARU Innova, Fortuner, Yaris, Vios, Altis, Camry, Rush, Avanza. Hub. 0813 7043 7766

TOYOTA Avanza 6 Th. ‘07, Wrn Hitam, 1300cc, Mobil ctk, 1 tgn dari baru Rp. 130 Jt. Kembar Ponsel Jl. SM. Raja No. 200 (Depan UISU) 0857 6097 8888 / 7851402

SUZUKI Katana GX Power Steering 1997 w. Ungu metallic, tape kenwood, body originil, hub. acuan kirana 17 bisa tukar tambah, cash credit 77159251 - 0811 635101 mobil terawat, tinggal pakai, sehat, mulus, tgn. 1

TOYOTA Kijang Capsul LSX /Diesel/ Th. 97. Biru Met/Jual Cepat/ BU/Mesin sehat/Body Kaleng/Mulus/VR/BR/ RT/Ban Baru/BK Mutasi/Hrg. 90Jt/ Nego/HP. 0812 60 44 103

SUZUKI APV 2006 Type L. Hitam metalik. Mobil mulus Kaleng2. Original semua, BK Panjang asli Medan cantik. Luar dalam. Jarang pakai. Lihat dulu. Harga 93 Jt/Nego. Hub. 0812 6568 818 / 7730 5875

TOYOTA Kijang Grand Extra Long Th. ‘96. Wrn. Hijau met, Mls sekali, ctk sekali. Kaleng2 Spt baru, ban baru, pakai TV, Mentah sekali, 1 tangan dari baru Rp. 81Jt. Kembar Ponsel Jl. SM. Raja No. 200. (Depan UISU). 0815 337 33688 / 7851402

TOYOTA Avanza 05 Silver Original BK Medan. Hrg. 125Jt Nego. Hub. 061-77601540, TP



1 Spd Motor Smas/ Sogun/ Supra X Thn ‘05 Atas, A. 3,0 - 3,5 Jt, TP Hub Mr. Sin, SMA 4 Mdn Hub. 0852.9661.8244 - 0852.7699.0657, Pakai sendiri



TOYOTA Krista Silver 00/ 01, Original BK Medan. Hrg. 125 Jt Nego. Hub. 0812 6084 0862, TP

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0816.314.1807


BUNGA O% atau



Cash Back 5 Jt


JAMINAN : BPKB, SURAT TANAH, EMAS, BUNGA MULAI 1,25% PROSES CEPAT MAX. Rp. 300JUTA. JW. 5 THN. Telp. (061) 8446489, 8826936 8477880, 7954444, 7368754 (0622) 430780, (0624) 21796



Telp. (061) 8446489, 8826936, 8477880, 7954444, 7368754, (0622) 430780, (0624) 21796



Hyundai Long An ROBEX 220. Dozer D6D. Komatsu Gracio PC 200/7. Mesin Genset Mitsubishi. 0812 6079 819

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


1 Unit Hitachi Landy Ex-200 Thn. 2002 1 Unit Hitachi Zaxis Zx-200 Thn. 2002. Hub. 0819 2000618 (EDI) BURSA

ELEKTRONIK TV, LED, LCD, Kulkas, M. Cuci, Handycam, DSLR, Laptop, LCD Projector, H. Theater, Sound PS 1, 2, 3, PSP Dll. Hub. CV. MARKET. Telp. 76324682 - 0812 653 93000. Jl. S. Budi No. 424 B. Psr. IV Dkt BNI T. Sari.


TV LCD LG 32”= 3,4Jt, 42” LCD P. TOSHIBA : 2,5JT 29” Flat Baru LG= 2,1Jt, 29” Bekas 1Jt-1,7Jt, 14-21=300rb650rb,17” LCD Monitor 1 Jt, 22”=1,5Jt,PS1=400rb, PS2=800rb- DVD Cina 200rb, H. Teater LG 950rb. Compo DVD AIWA - PMPO 10.000= 900rb. Ampli/Mixer/Spk, BMB, Kenwood, Black Speder, dll.


Handicam Sony Hi-8 = 1 Jt. Sony HDD 3,5Jt. Panasonic DVD=3jt. DVD 2 Jt. Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax, Printer= 600rb Projector LCD= 3Jt


TERCECER/HILANG Hilang surat Tanah - Penglepasan Hak Dengan Ganti Rugi No. 26, Tgl. 19-062009. a/n. Asniar. Alaamt Jl. Veteran PSR. VII. Dsn IX. Luas Tanah 92M2

TERCECER 1 Buah BPKB Sp. Motor Yamaha. BK 5293 IP. A/n. ZURAIDAH. Alamat Dsn. III Tg. Mulia. Kec. Hinai Langkat.

TERCECER 1 (Satu) Buah BPKB Asli E No. 2546 996 - E. Spd. Motor BK 3150 US a/n. SURIADI. Dusun VI DS Limau Manis. Tanjung Morawa D/S


Telah tercecer satu Surat Tanah a/n: Drs. Zulfan, MBA dengan luas +/- 1.421 m2 yang berlokasi di Lingkungan II Kelurahan Rengas Pulau, Kec. Medan Marelan. Bagi siapa yang menemukan harap hub: Telp. 0821 6725 1718


KOMPUTER Laptop-Pc-Lcd-Projctor-CCTV-Camera-Tinta Top: Servis: expres (Tukar +) 636 1967. Jl. rantang 20s Latop baru 320Gb+cam= Rp. 239rb x 13. (bisa tukar +/cash/kredit) Pc (Wnet/Ruma) P4 + LG 17” = 1 Jt -(Cpu P4=500rb) Latop2nd=1xJt + 3bonus LCD new19” = 1Jt. LCD=579rb Tosiba 15” Cel 80Gb + dvdcrw/wfi/+1,5Jam PROJECTOR=2Xjt (sewa 500rb)

Jual AC Bermacam Merek 1/2, 3/4, 1,1 1/2, 2Pk-1,3Jt2 Jt. Kulkas 1 Pt - 2 Pt=600rb- 1,2Jt. 2 Pt -Jumbo - 2 Jt. Prejer 5 rak = 1,2Jt, 6 rak SOCES 1,8Jt. M. Cuci 1 Tb2 Tb= 600rb- 1,2 Jt. M. Cuci Baru= 2,2 Jt (1 tb 9 kg). Genset 3000 w. 2,5Jt. Stabilizer 3000 watt, 10.000 Watt Hub. UD. SENANG HATI: 4517509 - 77073637. Jl. Sekip 67 A (Jual & Beli) Cash/Credit






BERITA TERCECER 1 (Satu) Buah BPKB No. 2408615-B. BK 1291 GP Merk Isuzu Panther Th. 2005. An. Ambral Thaib Ponda Tanjung T. Almt. Komp. Tasbih Blok YY No. 95 Medan.


Telah hilang/tercecer BPKB Kendaraan Yamaha Mio an. CUT FARAH DIBA dengan No. BK 5113 UA, No. Mesin 5 TL-187799


An. JENNY, BK 12 CR Merek Mobil Suzuki Escudo Nomade Th. 1997, Hijau Metalic. Strip Huning Mas NRMHDESB4 16 VJ 022696 NM.616A ID 132632




Cuci AC, Isi Freon, Bongkar Psg, AC Tambah Freon, Perbaikan, Spare parts. AC - KULKAS - MSN CUCI Hub.06177972065 / 0813 6149 7921



HUB: 0857 6078 7441061.69678231




Hubungi Dealer


Cash Back s/d 12 Jt



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN




HP. 0812 6053 690

7352833 0812 6064 9333


KULKAS, DISPENSER, M. CUCI HUB. MAJU TEKNIK Tel. 7030118, Flexi 76750084


Ekonomi & Bisnis

WASPADA Selasa 25 Januari 2011


Investor Ragukan Hukum Indonesia

Pemerintah Diminta Revisi Tata Niaga Gula

JAKARTA (Waspada): Menteri Perencanaan Pembangunan Nasional (PPN)/Kepala Bappenas Armida Alisjahbana mengingatkan Senin (24/1), ketidakpastian penyelesaian persoalan berkaitan dengan penegakan hukum, politik dan demokrasi di Indonesia,secara tidak langsung berimbas pada perekonomian nasional. Menurutnya, perhatian publik saat ini tertuju pada penegakan dan penyelesaian kasus hukum. “Masalah-masalah ini jadi complain (investor), tapi kami bilang bahwa kami sedang melakukan pembenahan,” ungkapnya di Jakarta. Dia mengakui, persoalan berhubungan dengan politik, demokrasi, penegakan hukum, serta korupsi, secara tidak langsung berimbas pada sektor lain, termasuk perekonomian nasional. Kendati membaik, indeks pemberantasan korupsi (IPK) Indonesia masih rendah menjadi salah satu indikator belum tercapainya pembangunan nasional. Presiden Susilo Bambang

J A K A RTA ( Wa s p a d a ) : Sejumlah kalangan meminta pemerintah untuk melakukan revisi tata niaga gula seperti tertuang dalam Surat Menteri Perindustrian dan Perdagangan (Menperindag) No.527/2004 guna mendukung tugas Perum Bulog sebagai penyangga atau buffer stock gula nasional. Ketua Forum Industri Pengguna Gula (FIPG), Suroso Natakusuma di Jakarta, Minggu, menyatakan, hal itu sebagai tindak lanjut dari rekomendasi Panitia Kerja (Panja) swasembada gula meminta pemerintah menjadikan Bulog sebagai lembaga stabilisator gula. “Dengan perkembangan kondisi pergulaan nasional saat ini, kebijakan tata niaga gula tersebut sudah tidak sesuai lagi sehingga perlu dilakukan penyesuaian secara komprehensif,” katanya. Seperti diketahui selama tahun 2010 harga gula berfluktuasi luar biasa dan tidak terkendali, oleh karena itu “buffer stock” gula diharapkan dapat menstabilkan harga gula, se-



Teknisi komputer: Syarat max. 25 thn, SIM A, KK, KTP, Wanita PRT, Max. 25 thn, KTP KK Hub. (061) 3024.3669 Jl. Rantang 20s LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. Bpk Ridho (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan


127 Pengemudi. Komisi, Bonus, Insentif, GPS, Mess, Mobil baru, dll. Syrt: 23 - 50 thn, SIM & KTP, Tdk bertato/ bekas tato, Segera dtg/ kirim lamaran ke: Jl. Kapt. Muslim No. 92 Medan Telp. 7637.5840


Beberapa orang untuk menempati posisi sebagai “Supir”, Syarat: - Mempunyai SIM B1 - Umur 30 - 45 tahun - Diutamakan mengetahui alamat di Medan - Berpengalaman - Jujur, bertanggung jawab, disiplin Disertai surat lamaran, kartu keluarga, fotokopi KTP & SIM, Pasphoto 3x4 sebanyak 3 lembar, ijazah terakhir

Lamaran ditujukan ke:

Jl. Sikambing No. 41A


Dibutuhkan segera ± 15 Orang wanita dan pria, Tamatan minimal SMA sederajat sebagai Tenaga Marketing bergerak dibidang pendidikan di Perusahaan sedang berkembang, yang bekerjasama dengan PUSTEKOM DEPDIKNAS Jakarta Syarat: FOTOCOPY IJAZAH, PAS PHOTO 3X4: 2 LEMBAR/ WARNA, FOTOCOPY KTP Lamaran diantar langsung, bersedia di interview JL. GAJAH MADA/ MSK JL. DAME NO. 16 MEDAN KAMPUS LP3I MEDAN Iklan ini berlaku selama satu minggu dari tanggal terbit


Kami Spa yang sedang berkembang saat ini, Platinum Priority Spa membutuhkan tenaga Trainer dan Therapist. Persyaratan: - Wanita, usia 20 - 40 thn - Pendidikan terakhir min. SMA/ sederajat - Diutamakan yang memiliki pengalaman min. 1 thn - Memiliki sertifikat ahli kecantikan (salon & spa) menjadi nilai tambah Benefit: Gaji + Bonus prestasi + Bonus akhir tahun Kirimkan Surat lamaran, Daftar riwayat hidup, Foto copy KTP dan Pas photo terbaru ke alamat:

Platinum Priority Spa

Jl. Tuasan Komp. Tuasan Indah No. 11-B Medan 20222 NB: Berkas lamaran diterima paling lama tgl. 29 Januari 2010


Dibutuhkan 2 orang untuk dipekerjakan sebagai Pembuat Muebel dan Perabot dengan persyaratan sebagai berikut: 1. Pas Photo 3x4 : 2 lembar 2. Foto copy KTP : 2 lembar 6. Usia maximal 30 tahun 4. Tamatan tidak ditentukan 5. Terampil dalam pengecatan menggunakan gun kompresor 6. Bisa bekerjasama dalam tim Lamaran diantar langsung ke: Jl. Laksana No. 68ABC Medan Maimun, selambat-lambatnya 3 hari setelah iklan ini terbit


PERUSAHAAN yang bergerak dalam bidang Jasa Keuangan Non Bank yang telah berskala Nasional dan memiliki cabang di seluruh Indonesia, bekerjasama dengan BUMN/ BUMD membutuhkan calon karyawan untuk menempati posisi: 1. Pelaksana Marketing 2. Pelaksana Akuntansi 3. Pelaksana Adm. Kredit 4. Pelaksana SDM & Umum 5. Pelaksana Simpanan 6. Pelaksana Verikfikasi 7. Account Officer 8. Funding Officer Ketentuan umum: - Pria, wanita (1 - 8) - Usia max 25 thn (1 - 8) - Bersedia ditempatkan di wilayah Medan, Sibolga, Siantar, Lhokseumawe - Pendidikan min SMU (1, 8) - Menguasai dasar-dasar akuntansi dan Analisa Lap. Keuangan (2) - Sanggup bekerja keras, jujur, komunikatif dan inovatif - Diutamakan mantan karyawan Forex & Asuransi pengalaman min. 2 tahun (1, 7, 8) - Mampu bernegosiasi dan mempunyai relasi yang luas (1, 7, 8) - Memiliki kendaraan roda 2 dan SIM C (7, 8) Kirimkan lamaran & CV anda:

Nasari Jl. Gatot Subroto No. 231-233 Medan

Paling lambat tanggal 29 Januari 2011 Cap pos - Lamaran yang diantar sendiri tidak akan diproses

Yudhoyono dalam rapat kerja nasional di awal 2011 juga mengakui bahwa persoalan korupsi menghambat perekonomian nasional. “Persoalan perizinan, korupsi, juga memengaruhi capaian perekonomian kita. IPK kita tahun 2009 di level 2,8. Target kita mengejar level lima di tahun 2014.Apa yang menjadi persoalan harus diselesaikan agar target bisa dikejar,” tegasnya. Dia yakin, jika IPK Indonesia meningkat dan persoalan berkaitan dengan kepastian hukum selesai, kondisi perekonomian nasional akan semakin baik. Sebab, pelaku usaha dengan sendirinya menaikkan level kenyamanan iklim usaha di Indonesia. Armida mengatakan, saat ini pemerintah tengah mencari solusi lebih efektif dalam mengelola persoalan nasional. Dengan demikian, persoalan bangsa tidak dibiarkan berlarut-larut dalam proses penyelesaiannya. “Pemerintah tidak mungkin bisa bekerja sendiri, maka kita mencoba melibatkan pihak lain.” (okz) !! LOWONGAN KERJA !!


Sebuah perusahaan swasta, menerima tenaga kerja P/W 17 - 38 thn, untuk diposisikan di kantor cabang di Medan, syarat: min. SMU/ sederajat, lamaran diantar lgsg ke kantor Penghasilan Rp. 1.800.000/ bln, INFO Hub:

BPK. WILSON, SE/ IBU MARTA SIMBOLON HP. 0852.6261.5747 - 0813.6127.8601 Atau datang langsung ke alamat kantor: Jl. Brig. Zein Hamid No. 8B dekat Titi Kanal daerah Titi Kuning Medan NB. Non SALES Ada Shift Diutamakan bagi 5 pelamar pertama


Jl. Serdang Gg. Belimbing No. 2D Medan Kantor (061) 7784.1353 Febby: 0878.6717.1941 Barus: 0813.6100.8160 Sebagai Tenaga Penjual ATK Syaratnya gampang Melamar sekarang besok sudah kerja


Dibutuhkan 12 org Mekanik Sepeda motor, Pengalaman min. ±1 thn, Yang berminat lamaran antar langsung ke: Jl. G. Subroto No. 304A (sebelah Kodam)


Dibutuhkan segera tenaga profesional dan berjiwa besar untuk posisi: a. TENTOR: - MAFIKA, B. Indonesia, B. Ingg dan IPS (Sarjana PTN) Usia 30 thn (Max) Diutamakan mempunyai kendaraan b. PEGAWAI ADMINISTRASI - SMK Perkantoran/ Adm, Usia 24 thn (Max) c. OFFICE BOY (OB) - Minimal SMP, Lajang Bersedia tinggal ditempat kerja d. Penjaga anak tamatan SMP Lamaran ditujukan ke:


Jl. Merica Raya No. 87 Perum. Simalingkar HP. 0813.7013.2587 Khusus: SD & SMP untuk ditempatkan di P. Simalingkar & Tj. Anom Lamaran paling lama 1 minggu



Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Di Jl. Eka Setia Medan Johor, LT. 17x18m, LB. 120m, KT 3, KM 2, Dapur lebar, Teras, Pagar, Sertifikat, Harga murah/ damai Hub. 0812.6542.2876

RUMAH DIjual Uk. 9x15 Jl. Bersama Gg. Akur No. 7B, Kel. Bantan, Kec. Medan Tembung, KT 3, KM 2, Tempat jemuran tingkat, Sudah Sertifikat, Harga 150 Jt/nego Hub. Rosmiati 0813.9601.1837

RUKO Dijual Jl. P. Denai No. 79 Samping 9 Jermal 8, Surat Sertifikat Hub HP. 0813.4066.6030

RUMAH Ruko 2 Lantai, Uk. 4,5x21,5m, Surat Sertifikat alamat Jl. Ismailiyah No. 15E Medan Hub. 0812.6507.7009


Bisa KPR, LT. 255, LB. 200, 4 KT, 3 KM, Ada garasi, Carport, SHM, PLN, PAM, Gas, Di depan Taman Blok G No. 3 Harga Rp. 650 Jt (Include AJB) Hub. 0813.7533.4051


Perum. Melati Permai (Komp. Depag), 5 Mnt dri Jl. Binjai Km. 16 di blkg Perumh Padang Hijau arah Paya Bakung, Ada angkot, SHM, pLN, 2 KT, 1 KM, LT. 7x15m, LB. 6x9, Hrg Rp. 60 Jt/ bisa tkr mobil dgn hrg setara, Berminat hub. 0812.6407.0024


Siap huni, Lok Tengah Kota, LT. 680m², SHM, 2 LT, 5 KT, KM, Md dlm, Garasi 3 mbl, Halaman luas dpn blkg, 4500 W, Air PAM Di Jl. Karya Sei Agul Hub. 0812.3332.4909


Jl. Karya Wisata Komp. Taman Johor Baru BLok A1 No. 23, SHM, LB. 130m, LT. 260m, PAM, PLN, 2200 Watt, Carport, Kitchen set, Kursi tamu, 4 KT, 2 KM, Harga Rp. 600 Jt/nego Hub. 0852.6103.4462 - 0878.8077.6583


Rumah Type 65/ 90 - 6x16 (1 Lantai) SHM (Hrg 200 Jt) Ruko 2½ Tingkat (4x17m) SHM (Hrg 550 Jt) Jl. Besar Tembung - Pasar 10 (Pinggir jalan) Ruko 2 Tingkat (4x32m) SHM (Harga 650 Jt) Jl. Yos Sudarso No. 41A (depan Pajak Glugur) Yang berminat hub. 0878.6829.4842


3 TKT COCOK UNTUK USAHA INTI KOTA, DP 100 JT Dijual 4 pintu ruko Jl. Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri), LB. 4x16m, LT. 4x29m, Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha, Perhotelan, Fotocopy, Praktek dokter, Kost²an, hospital, warnet, kantor NB:300meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Jt, Harga 575 Jt, Sisa I unit, Full keramik, Siap huni ± 80 Jt Hub: 7772.2123 / 7759.8123 HP. 081.165.1123

DIJUAL/ 3 PINTU RUMAH UT 11x30m², SK Camat Jl. Sisingamangaraja Gg. Sempurna Sitamiang Padang Sidimpuan Hub. Bapak Jakaria Pohan HP. 0813.6195.7700 0813.7585.0340


Jl. Padang Gg. Pertiwi Baru No. IA Bandar Slamat Medan, Lebar Tanah 14,5, Panjang Tanah 29,5 Surat Sertifikat, 4 KT, 3 KM, 1 Gudang, 1 Garasi, Lantai Keramik, Pagar keliling Listrik 900 W, PAM, Telp Berminat hub HP. 0813.7554.3020


Jl. Sunggal Gg. Baru No. 16, ± 500m dari Jl. Ringroad LT. 263m², LB. 144m², KT 3, KM 3, R. Tamu, R. Keluarga, Dapur, Buka, Harga nego Hub. 0852.7807.1375

hingga secara efektif dapat melindungi kepentingan konsumen. Selama ini kebijakan pergulaan nasional diatur dengan SK 527/2004 hanya diarahkan untuk melindungi petani dan pabrik gula sedangkan kepentingan konsumen diabaikan, sehingga konsumen harus menanggung gejolak kenaikan harga gula. “Karena itu rekomendasi Panja Swasembada Gula DPR yang menyatakan agar fungsi Bulog dikembalikan sebagai pengelola buffer stock komoditas gula dinilai tepat,” katanya. Terkait dengan itu, Suroso menyatakan, izin impor yang terkait masalah pergulaan meliputi raw sugar, Gula Kristal Putih (GKP) dan sejenisnya agar diproses satu lembaga saja. Artinya, pemerintah dapat memberikan pelaksanaan impor gula kepada Bulog, sebagai lembaga berfungsi sebagai pengelola buffer stock gula nasional. Dengan demikian, tambahnya, FIPG tidak keberatan Bulog




Di Patumbak Jl. Pertahanan Gg. Mesjid Uk. 4,8x24m, SK Camat, Hrg 50 Jt/nego HP. 0812.6002.5756


Uk. 14x65: ±970m² (SHM) Lok; Jl. Baru Sei Mencirim dekat SMPN 3 Sunggal D. Serdang, Hrg Rp. 95.000/m² 0811.659.235


Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan




Luas 3 Rante di Pinggir Jalan Aspal, Jl. Bangau Kp. Nangka Kec. Mencirim Timur Binjei, SK Camat Harga nego

Hub. 0813.7503.4449, TP

DIJUAL KEBUN SAWIT Luas ±50 Ha sudah Tanam ± 8 Ha, Tanah Datar di Desa Pinggir Duri - Riau Harga Rata Rp. 20 Jt/Ha Hub. 0813.7503.4449, TP

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


JL. PALANGKA RAYA NO. 9 TELP. (061) 414.5191 MEDAN



1. Kamera bentuk Pulpen (Resolusi tinggi) Rp. 700.000 2. Kamera bentuk Gantungan kunci mobil/ sp. motor (Resolusi tinggi) Rp. 700.000 3. Kamera bentuk jam tangan (resolusi tinggi) Rp. 700.000. Kamera ini bisa digunakan untuk merekam suatu kejadian ataupun untuk merekam seseorang tanpa diketahui, hasil rekaman dapat digunakan sebagai alat bukti yang nyata. Bisa merekam gambar dan suara dengan jelas (gambar berwarna). Kapasitas memori max 6 jam (4 GB). Kamera ini bisa dibawa atau di letakkan dimana saja tanpa mencurigakan. Hasil rekaman bisa dilihat melalui komputer/laptop




Dgn mengerjakan stuffing amplop, dirumah, kirim surat prangko/ flat rate Balasan ke: Taras Mail Po. Box 1070 Medan 20001

Bank Indonesia, Darmin Nasution menjelaskan perbankan syariah tumbuh pesat dalam 10 tahun terakhir. Total aset syariah tumbuh 53 kali lipat. Per Desember 2010, total aset perbankan syariah mencapai Rp100,2 triliun. “Namun, pangsa pasar relatif rendah, atau hanya 3,2 persen dari total aset perban-kan,” ujar mantan dirjen pajak ini. Menurut Darmin, dengan bergabung dengan IILM, Indonesia dapat mengikuti investasi sukuk dan instrumen syariah dikeluarkan lembaga itu dengan rating lebih tinggi. Dengan demikian, Darmin melanjutkan, Indonesia mendapatkan pendanaan lebih murah. “Selain itu, mendorong perbankan syariah untuk berinves-

WC 0813 6147 0812 WC 0812 60444275 Setia Budi



TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188



KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

Ingin Trading Futeres : Forex, Index, Commoditi, Metals, Cfd Stock US, Cfd Indices, Cfd Financial Gold, Silver. Spread Mulai dari 2 Point Bebas Biaya (Swap Dan Cash Komisi) Kami memiliki Solusi Trading yang Nyaman dan menghasilkan minimal 100 pips / hari. Metode CHAOS TRADING Biaya Training Rp 15.500.000,(* Tempat Terbatas, Max 5 Org/Kelas) MasterForex Sumatera Training Center Mandiri Building Lt.6, Jl. Imam Bonjol No. 16 D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 e-mail :



mandiri power buy cicilan 0%

Jl. Brayan Medan

8442246 WC 08126427 1725 ADI

Tumpat Sedot



Ada Garansi


845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F


Hub. 8219951 Jl. Setia Budi No. 2






BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

Ingin Promosikan Produk Anda Harian


DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Media yang Tepat untuk Iklan Anda











Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761 EUROMESH BAJA U-50



Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481 BALAI PENGOBATAN TRADISIONAL




(Untuk reumatik & asam urat)


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat





Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll











Ingin Promosikan Produk Anda

untuk Iklan Anda


tasi pada sukuk yang berfungsi sebagai underlying pemerintah,” katanya. Darmin menilai, bergabungnya Indonesia dalam IILM akan memperkaya instrumen keuangan syariah dan meningkatkan daya saing lembaga keuangan syariah Indonesia. Saat ini, terdapat 12 bank sentral telah bergabung dengan IILM. Bank-bank sentral itu berasal dari Indonesia, Iran, Malaysia, Kuwait, Luxemburg, Nigeria, Sudan, Mauritius, Turki, Uni Emirat Arab, Qatar, dan Islamic Development Bank (IDB). Awalnya, status keanggotaan Indonesia masih kondisional. Dengan disetujui DPR, maka Bank Indonesia mendapatkan keanggotaan penuh. (vvn)

Cucu Asli Mak Erot Bersama


WASPADA Media yang Tepat

dilakukan pemerintah. Salah satunya dengan mensinergikan kinerja Badan Usaha Milik Negara (BUMN) yang terkait.



Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866


USD 2.300 USD 2.600 USD 2.800

Harga Ekonomis Fasilitas Paket Bisnis

- Investasi Rp. 500.000/ orang (Staterkit, Bibit F3, Sertifikat, Konsumsi & Konsultasi) - Biaya ditransfer ke Rek: 057 801 009 839 502 BRI Kranggan Cibubur AN. Muhtarudin

Solusi sehat dan Income + an Hub. (061) 9109.0060 - 0813.8761.7353

USD 1.750

Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis OFFICE: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061- 7326981, 0811647795 Fax. 061-7326981




NB: untuk perubahan type kamar menjadi : Triple menambah USD 50 Double menambah USD 100 AKOMODASI HOTEL BERBINTANG HOTEL MADINAH: DALLAH TAIBA, Setaraf ***** HOTEL MAKKAH : JAWHARAT ANFAL, AL BUSTAN, Setaraf **** HOTEL JEDDAH : AL AZHAR *****

Forum Usaha Jamur Nusantara (Forsamura) Mengadakan Pelatihan singkat budidaya jamur Materi pelatihan: - Teknik budidaya Jamur konsumsi - Managemen rumah jamur - Teknik aplikasi pembibitan jamur - teknik pembuatan media jamur - Prospek usaha jamur - analisa usaha jamur - Produk olahan jamur - strategi pemasaran Waktu pelatihan: - Kelompok belajar (Pokjar) 1, Sabtu, 12 Feb 2011 Pokjar 2, Minggu 13 Feb 2011 - Jam: 09.00-17.00 WIB - Selasa, 15 Feb 2011, Kunjungan Lapangan Tempat pelatihan: - Aula Wisma Haji Jl. Raya Binjai Km. 6,5 Medan Pendaftaran: - Bpk. Sembiring: Jl. Jamin Ginting Gang Pembangunan No. 4 Pdg. Bulan Medan HP. 0812.6028.3362 - 0813.8761.7353 - Adi: 0813.7033.1003 - Muchtar:: 0813.8197.7962 Investasi:

Bibit tanaman perkebunan, kehutanan, buah, ternak Hub. (061) 785.3855 733.1464 / 0878.6982.6525

JAKARTA (Waspada): Dewan Perwakilan Rakyat (DPR) menyetujui Bank Indonesia sebagai wakil Indonesia untuk bergabung dalam International Islamic Liquidity Management (IILM) Corporation. Keuntungan Indonesia bergabung dengan IILM antara lain mendorong perkembangan perbankan syariah Indonesia masih rendah. “Bisa kami sepakati dengan catatan Bank Indonesia memberikan laporan lengkap keikutsertaan dalam lembaga keuangan multinasional lainnya,” kata Ahsanul Qosasih, pimpinan sidang pada rapat dengar pendapat (RDP) antara Bank Indonesia dan Komisi XI DPR RI, di Jakarta, Senin (24/1). Sementara itu, Gubernur


Tiap Hari Sabtu Pkl : 14.00-16.00 WIB Minggu Pkl : 09.00-11.00 WIB Manasik Haji di mulai Tgl. 20 Februari 2011 Daftaran segera ke kantor Pusat Multazam Medan Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 00813.6137.2321 - 0812.6495.8456


bada 2014,” ujarnya. Maksum mengakui, upaya memperbaiki tataniaga gula kristal putih (GKP) terus

Aset Bank Syariah Tembus Rp100 Triliun

Izin Usaha : 503/1099.SK.HO/SL/NT/08 JADWAL HARGA UMROH TAHUN 2011 / 1432 H

Di Bimbing sampai ke Tanah Suci 1. Umroh Reguler 9hr, 13 dan 14hr Maret - April 2. Umroh dan Arbain di Madinah 20hr: 18,5 Jt 3. Umroh Plus Mesir - Bulan Maret 4. Umroh Plus Turkey - Bulan April 5. Umroh Plus Aqsha - Bulan April 6. Umroh Plus Indah Kashmir 7. Umroh Plus Dubai 8. Umroh Paket Promo 10 orang Gratis 1 ONH Plus/ Khusus Thn 2011 Tempat manasik Haji di Mesjid Agung Jl. P. Diponegoro Medan


sekaligus merusak semangat bertani tebu. Ini akan menghancurkan produksi gula domestik dan menjauhkan dari swasem-




1. Jl. Tangguk Bongkar II No. 9B Mandala By Pas Medan, Luas Tanah 230m 2. Perumahan RSS Kampung Kenanga Batang Kuis, Luas Tanah 8x16,5 Hubungi HP. 0813.7554.0284 0812.6444.1183

ditunjuk sebagai satu-satunya pemegang IT (Importir Terdaftar) gula, bahkan, industri pengguna gula akan lebih mudah mendapatkan bahan baku. Sementara itu pengamat pertanian dari UGM, Muhammad Maksum mengatakan dalam pasar global tata niaga gula sudah semakin dinamis, terutama menghadapi perubahan iklim, meningkatnya permintaan dan konflik peruntukan hasil pertanian untuk pangan, pakan dan energi. Untuk itu, lanjutnya, tata niaga dirumuskan 2004 tentu perlu ditinjau kembali namun hal ini sama sekali bukan dimaksudkan untuk melegalisir importasi dan kolonialisasi dengan masuknya gula rafinasi dalam pasar umum. Sebab, masuknya gula rafinasi sekaligus bermakna pembunuhan terhadap potensi ekonomis GKP domestik dan pada gilirannya mengebiri hak ekonomi rakyat tani miskin karena harga gulanya yang merosot. “Jatuhnya harga gula akan merusak kesejahteraan petani,

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887






ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari




Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN


B12 Daihatsu Bantu Toyota Tingkatkan Penjualan Daihatsu Motor Co., akan mendorong produksi di Indonesia hingga mencapai 400,000 unit pada tahun ini untuk membantu Toyota Motor Corp., meningkatkan penjualan di negara-negara Asia Tenggara. Menurut President Daihatsu, Koichi Ina, permintaan mobil di Indonesia terus meningkat, dan penting bagi Daihatsu untuk meningkatkan belanja modelnya bisa ingin meningkatkan produksi lebih lanjut. Perusahaan yang berkan-

tor pusat di Osaka ingin meningkatkan penjualan Indonesia hingga 25 persen yaitu menjadi 145,000 unit pada 2011 dari 115,000 unit tahun lalu. Pabriknya di Indonesia yang dikelola Astra-Daihatsu Motor akan meningkatkan produksnya menjadi 330,000 unit pada Mei tahun ini, dari 280,000 unit dan diharapkan bisa mencapai 400,000 unit pertahun. Pengumuman ini hampir bersamaan dengan kabar diluncurkannya all-new Xenia-Avanza pada akhir tahun


Produsen-produsen otomotif Jepang terus menambah kapasitas produksi di kawasan Asia Tenggara seiring tingginya pertumbuhan yang melebihi pasar-pasar yang sudah mapan seperti di Amerika Serikat dan Jepang. Untuk meningkatkan pendapatanya, perusahaan yang 51% sahamnya di kuasai Toyota ini akan terus melakukan pemangkasan biaya dan meningkatkan penjualan di Jepang, Malaysia dan Indonesia, apalagi Daihatsu akan

Suzuki Segera Luncurkan Swift Dan Kizashi AWD Suzuki akan meluncurkan versi 4 x 4 dari Swift dan Kizashi untuk pasar Eropa Pebruari 2011 mendatang. Swift AWD bermesin 1.2i 16v dengan tenaga 94 (horse power/hp), transmisi manual 5 percepatan. Efisiensi bbm dalam kota mencapai 14,9km/ liter, di jalan tol mencapai 20,4km/liter dan kombinasinya mencapai 18,1km/liter. Emisi gas buangnya mencapai 129g/km. Harganya terrendah adalah 14.490 poundsterling berarti lebih mahal 900 pound dari versi front-wheel drive. Kizashi AWD mengadopsi teknologi intelligent all-wheel drive sehingga dinamai i-AWD, dengan satu tombol, penge-

mudi dapat mengubah dari front ke all wheel drive, mesin nya adalah 2.4L yang bertenaga 178hp. Efisiensinya mencapai 8,8 km /liter dalam kota, dan 15,1km/liter di jalan tol dan kombinasinya mencapai 12km/liter. Emisi gas buangnya 191g/km. Harganya di Jerman dimulai dari 29,900 pound. Grand Vitara Generasi keempat dari Suzuki Vitara tadinya akan muncul pada tahun ini, tetapi karena krisis global, Suzuki memutuskan untuk menunda sampai september 2013 mendatang. Generasi pertama dan kedua Vitara dibuat berba-

sis truk off road (ladder frame chassis), sedangkan Vitara saat ini chasis nya menjadi monocoque, sehingga memberikan kenyamanan dan stabilitas tapi tetap berkemampuan off road. Next generation Vitara akan dibuat dengan basis chassis Kizashi platform yang diunggulkan sebagai handling yang paling baik. Sedangkan untuk mesin saat ni ada 2 mesin J20B 2.0L yang dipakai SX4 dengan tenaga 168hp dan juga J24B yang saat ini dipakai Kizashi yang menghasilkan tenaga 185hp. Ada kemungkinkan mesin diesel dari VW TDI 2.0 yang menghasilkan 204hp. (mkc/m47)

Suzuki Swift.

Toyota Pertahankan Titel Nomor 1

Kasus recall besar-besaran Toyota di salah satu pasar terbesarnya yakni AS tak membuat titel Toyota sebagai produsen nomor wahid dunia tergeser. Toyota seperti dilansir Reuters, kemarin (24/1), tetap menjadi produsen mobil terbanyak di dunia selama 3 tahun berturut-turut. Penjualan mobil Toyota di tahun 2010 lalu mencapai 8,42 juta unit. Sedangkan GM yang juga mengumumkan angka penjualannya Senin ini tercatat sebanyak 8,39 juta unit. Kalah tipis yakni sekitar 30.000 unit dengan Toyota. Perlombaan antara dua raksasa mobil itu makin dekat setelah Toyota terkena kasus recall 10 juta mobilnya tahun 2010 lalu. Akibatnya, penjualan Toyota di AS mengalami penurunan tahun lalu. Di AS dan China GM menjadi rajanya. Sementara penjualan Toyota di Jepang meningkat 8 persen mengalami kenaikan double digit karena pemberian subsidi mobil hijau oleh pemerintah Jepang. Toyota melengserkan GM dari singgasana pada 2008 lalu. Reuters mencatat, agar kedua pabrikan ini bisa menjadi nomor satu, keduanya harus memperhatikan eksistensi mereka di negara yang perkembangan otomotifnya cepat seperti di China, India, Brasil dan Rusia. Negara-negara itu merupakan salah satu pasar krusial. Di Indonesia, popularitas Toyota tak terkalahkan oleh GM berada di urutan puncak dengan mencatat angka penjualan 280.680 unit. Merek GM di Indonesia yakni Chevrolet di tahun 2010 mencatat angka 4.508 unit. Di urutan ketiga produsen mobil dunia ada VW yang mengintai dengan angka penjualan 7,14 juta (masih perkiraan). Ini merupakan rekor bagi VW, yang sebelumnya berambisi untuk menjadi pabrikan mobil nomor satu di dunia pada 2018. (rtr/m47 )

menarik diri dari Eropa karena kuatnya nilai yen menggerus profitnya di sana. Di Jepang, Daihatsu akan meluncurkan minicar e:S pada paruh kedua tahun ini. Efisiensi nya bisa mencapai 30km/ liter dengan mesin 660cc. Daihatsu juga akan memasok model ini untuk Toyota. Produksi akan dibatasi hanya 60,000 unit pertahun. Batas itu akan tetap dipertahankan, bahkan jika permintaannya jauh di atasnya. Toyota tidak punya model dengan mesin 660cc ke bawah. Di Jepang, mobil tipe ini menguasai pangsa pasar hingga 33%, berdasarkan data Japan Automobile Dealers Association dan Japan Mini Vehicles Association. Sementara Daihatsu akan menjual mobil hybrid dengan teknologi dari Toyota, termasuk teknologi mobil listrik. (mkc/m47)

Selasa 25 Januari 2010

Bugatti Veyron Super Sport.

Minicar Daihatsu e:S

Mitsubishi Bakal Bikin Delapan Mobil Ramah Lingkungan

Setelah mengumumkan bakal menghentikan penjualan tiga produknya, Eclipse, Ev e n a d o r, d a n G a l l a n t , Mitsubishi Motors Corp, berencana memperkenalkan delapan hibrida termasuk bertenaga baterai pada 2015. “Karena permintaan untuk mobil hemat bahan bakar mengalami pertumbuhan yang pesat dan sebagian dari rencana ekspansi perusahaan, jangka menengah kami berencana membuat mobil hibrida tersebut,” tulis Mitsubishi dalam keterangan resminya dan dilansir autonews, kemarin. Mobil tersebut rencananya akan hadir secara bertahap, sehingga kedelapannya variannya akan lengkap pada tahun 2015. Saat ini Mitsubishi sudah memproduksi mobil listrik i-

MiEV dan direncanakan akan mulai dikirim ke Eropa dalam waktu dekat ini. Presiden Mitsubishi Osamu Masuko mengatakan, mobil baru tersebut bukan saja dibuat memperkuat posisi keuangan dengan meningkatkan penjualan, namun juga untuk menciptakan lingkungan yang lebih bersih. Mitsubishi juga dikabarkan sedang mengembangkan sebuah mobil melalui aliansi dengan perusahaan PSA dan Nissan Motor Co. “Kami akan bertujuan untuk meningkatkan penjualan global dengan kendaraan kompetitif seperti model kompak yang memenuhi kebutuhan kelas menengah di negara berkembang, serta SUV yang cukup menarik bagi pelanggan di berbagai daerah, “ ujar Masuko.

KIA Luncurkan New Picanto Pabrikan Korea Selatan KIA Motors meluncurkan versi terbaru dari city car Picanto. Dengan Picanto, KIA ingin menegaskan lagi kehadiran mereka di segmen mobil kecil. Seperti dilansir Reuters, Senin (24/1) peluncuran KIA Picanto itu digelar di kandang KIA, Korea Selatan. KIA menargetkan penjualan 220.000 unit Picanto di Korea dan di luar negeri tahun ini. Di Korea, mobil perkotaan


ini tidak disebut dengan nama yang sama. Picanto di Korea menjelma menjadi Morning. Setelah meluncur di Korea, Picanto akan segera masuk ke pasar Eropa dan Asia. Model terbaru ini akan dikenalkan di Geneva Motor Show Maret 2011 nanti. Hebatnya, mobil kota ini bisa meminum berbagai jenis bahan bakar. KIA Picanto ini memiliki 4 jenis mesin mulai dari mesin

Mitsubishi bertujuan untuk meningkatkan


Line up generasi mobil hot hatch Volkswagen Golf bakal bertambah lagi. VW mengonfirmasi akan segera melepas Golf generasi ketujuh pada 2012 atau awal 2013 nanti. Hal tersebut disampaikan juru bicara VW menanggapi pemberitaan kalau VW akan melansir Golf edisi ketujuh pada November 2012. Seperti dilansir Minggu (23/1), Golf MK VII akan menjadi mobil VW pertama dengan platform MQB yang datang dengan wheelbase lebih panjang dan overhang lebih pendek. Platform MQB yang fleksibel tersebut akan digunakan pada model VW Gr up, termasuk Audi A3. Sebelumnya spy shot VW Golf ketujuh sempat beredar di internet beberapa waktu lalu. Namun saat itu belum ada konfirmasi apa-apa dari VW. Kabarnya Golf MK VII akan menampilkan generasi terbaru dari mesin bensin dengan direct injection turbocharged dan diesel turbo hemat BBM, mulai dari 1,2 TSI sampai ke versi upgrade dari 2,0 TSI di GTI dan ‘R’ untuk AWD model sport. (rtr/dc/m47)

Ducati Juga Berjaya Di AS

Ducati 848

juta kendaraan pada tahun 2014. (oz/m47)

VW Segera Lepas Golf Generasi VII

1.000 cc, 1.200 cc, yang irit bensin. Selain itu generasi terbaru ini tidak hanya akan menggunakan bahan bakar bensin saja, tetapi akan tersedia mesin yang bisa meng-gunakan bifuel (dua jenis bahan bakar, LPG dan bensin) dan flexiblefuel (bensin saja atau dengan campuran bahan bakar lain). KIA akan menyesuaikan jenis bahan bakar Picanto berdasarkan kebutuhan pasar lokal. (rtr/dc/m47)

Foto file Januari 2010, ketika President Toyota Motor Corp. Akio Toyoda memperkenalkan kendaraan listrik hybrid Prius V di arena North American International Auto Show di Detroit, Michigan, AS. Toyota mengumumkan kemarin, berhasil menjual 8,42 juta mobil tahun lalu, yang membuat mereka tetap sebagai pabrikan nomor satu untuk dua tahun beruntun.

Meski produksi motor Ducati bukan buatan Amerika, tetapi di Amerika Utara penjualannya meningkat di akhir 2010. Ducati merupakan salah satu merek motor keluaran Italia, akan tetapi penjualannya di Amerika sangatlah tinggi, padahal industri Ducati saat itu sedang mengalami penurunan. Secara khusus, sebenarnya Ducati telah mengumumkan pertumbuhan penjualan ritel delapan persen pada kuartal ketiga dan sembilan persen pada kuartal keempat tahun 2010, sedangkan industri yang telah menurun 15 persen dan 14 persen di setiap kuartalnya. “Kami sangat puas dengan

penjualan global tahunan sebesar 37 persen menjadi 1,37

hasil Q3 dan Q4, dengan pertumbuhan yang solid dari 2009 dan pangsa pasar. Prestasi ini menandai titik balik bagi Ducati di Amerika Utara, “kata Cristiano Silei, CEO Ducati Amerika Utara. “Kami sangat gembira tentang potensi kita untuk tahun 2011, semoga program dukungan selanjutnya di setiap dealer Ducati dapat membuahkan hasil.” Tambahnya. Selain itu, Ducati menutup tahun dengan kesuksesan di Amerika Utara, berkat sejumlah produk barunya (Hypermotard 796, hypermotard 1100EVO dan EVO SP, Monster 696 ABS, Monster 796, 848EVO Superbike, Superbike 1198S Corse dan Multistrada 1200

keluarga), dan dealer yang telah mendukung program pemasaran yang dinamis. Pada tahun 2010, penjualan spare part meningkat tujuh persen, aksesoris sampai lima persen dan penjualan pakaian meningkat sebesar 24 persen. Adapun kampanye pemasaran, Ducati raced dan memenangkan tombak Peak International Hill Climb dengan Multistrada 1200 dan kembalinya Nicky Hayden untuk menandatangani Amerika rider MotoGP. Penambahan ikon Italia, seperti Valentino Rossi, untuk tim balap Ducati MotoGP, juga salah satu langkah yang mendukung brand awareness. (oz/47)

VW Golf VII.


Posisi Ban Baru Yang Tepat

Selama ini banyak pengguna mobil yang memasang ban baru pada roda depan terlebih dulu, dengan alasannya sistem kemudi ada di roda depan. Sebaiknya hal ini dihindari. Praktek yang aman adalah ban yang benar-benar baru ditempatkan di bagian belakang dan ban lama ditempatkan di bagian depan, jika terpaksa mengganti ban baru di jalan, tidak apa-apa anda memasang terlebih dulu ban baru di depan, nanti di rumah atau di bengkel baru diganti. Kenapa ban baru harus dipasang dulu di belakang? Dalam berkendara ada istilah oversteer dan understeer. Yang dimaksud dengan oversteer adalah situasi dimana ban belakang kehilangan traksi, membuang atau selip. Hal ini bisa terjadi akibat setir yang diputar secara tibatiba, memasuki belokan dengan kecepatan tinggi atau karena kembang ban sudah tipis sehingga ban kehilangan traksi. Nah kalau understeer kebalikannya. Roda depan kehilangan traksi, setir sudah dibelokkan tetapi mobil jalan cenderung lurus alias tidak mau belok dan akhirnya mobil nyelonong keluar jalan. Nah kondisi ban yang gundul bisa memperparah gejala oversteer dan understeer. Secara teknis gejala understeer akan lebih mudah diatasi oleh pengemudi karena setir dipegang oleh pengemudi yang akan dengan mudah mengoreksi kemudi ketika gejala understeer terjadi. Sementara kalau yang terjadi oversteer sulit buat pengemudi untuk mengembalikan ke dalam keadaan normal. Karena oversteer lebih susah dikendalikan ketimbang understeer inilah, kembang ban belakang yang lebih bagus dibutuhkan agar bisa mengendalikan gejala mobil selip. Dengan ban baru diharapkan gejala oversteer bisa diminimalisasi karena traksi akan lebih baik. Gejala understeer sering terjadi kepada mobil-mobil berpenggerak roda depan sementara gejala oversteer sering terjadi pada mobilmobil berpenggerak roda belakang. (bbg sumber/m47)

Waspada, Selasa 25 Januari 2011