Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Lima Lagi Menyusul JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) akan memanggil lima orang tersangka yang belum hadir dalam pemeriksaan kasus dugaan suap saat pemilihan Deputi Gubernur Senior Bank Indonesia (DGS BI) yang dimenangkan Miranda Goeltom pada tahun 2004, Jumat (28/1). Kelima tersangka yang tidak hadir dalam penyelidikan baru akan diperiksa pekan depan. Lanjut ke hal A2 kol. 6

http://epaper.waspadamedan.com

SABTU, Pahing, 29 Januari 2011/24 Safar 1432 H

No: 23401 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

KPK Selkan Panda Di Salemba

Harga Eceran: Rp2.500,-

18 Politisi Lainnya Ikut Ditahan Di Rutan Berbeda JAKARTA (Waspada): Anggota DPR asal Fraksi PDI Perjuangan, Panda Nababan, resmi ditahan KPK dan ditempatkan di Rumah Tahanan Salemba, Jakarta Pusat, Jumat (28/1) petang. Panda ditahan setelah dijemput paksa di Bandara Soekarno-Hatta Jumat siang dan menjalani pemeriksaan di KPK

sebagai tersangka kasus dugaan suap pemilihan Dewan Gubernur Senior Bank Indonesia Miranda Goeltom saat ia menjabat

anggota DPR 1999-2001. Kepastian penahanan Panda ini disampaikan Ketua Departemen Hukum DPP PDI Perjuangan, Gayus Lumbuun, Jumat sore. “Pak Panda sudah resmi ditahan di Rutan Salemba,” kata Gayus, yang mengaku baru menemui Panda di Gedung

KPK, Kuningan, Jakarta Selatan. Selain Panda, menurut Gayus, KPK juga menahan politisi PDI Perjuangan lain yang juga berstatus tersangka, Agus Tjondro. “Tapi saya tidak tahu Agus Tjondro ditahan di mana. Kalau tidak di Salemba, kemungkinan di Cipinang,” kata anggota

Komisi III ini. Saat ditemui, dikatakan Gayus, Panda mengungkapkan kekecewaannya terhadap jemput paksa yang dilakukan KPK. Ia menduga, KPK melakukan penangkapan karena khawatir mendapat kritik keras saat rapat kerja dengan Komisi III pekan depan.

Panda: Saya tak ditangkap paksa Panda Nababan menegaskan, dirinya tidak dijemput paksa saat penyidik KPK menjemputnya di Bandara

Lanjut ke hal A2 kol. 6

Nama Politisi Yang Ditahan KPK Kasus Suap Pemilihan DGSBI Dua politisi yang ditahan di Pondok Bambu: 1. Ni Luh Mariani (PDIP) 2. Engelina Pattiasina (PDIP)

Sembilan politisi yang ditahan di LP Cipinang: 1. Paskah Suzetta (Golkar) 2. Daniel Tandjung (PPP) 3. Sutanto Pranoto (PDI Perjuangan) 4. Poltak Sitorus (PDI Perjuangan) 5. Matheos Pormes (PDI Perjuangan) 6. Sofyan Usman (PPP) 7. M Iqbal (PDI Perjuangan) 8. Marthin Bria Seran (Golkar) 9. Ahmad Hafiz Zawawi (Golkar)

Tujuh politisi yang ditahan di Salemba: 1. Soewarno (PDI Perjuangan) 2. Baharuddin Aritonang (Golkar) 3. TM Nurlif (Golkar) 4. Reza Kamarullah (Golkar) 5. Asep Ruchyat (Golkar) 6. Panda Nababan (PDIP) 7. Max Moein (PDIP)

Engelina

Satu politisi ditahan di Polda Metro Jaya 1. Agus Condro (PDIP)

Antara

Antara

Paskah Suzetta

Antara

Baharuddin Aritonang

TM Nurlif

Panda Nababan Antara

Peserta SNMPTN Jalur Undangan Hanya Dari Sekolah Terakreditasi

AP

SEBUAH kapal tunda menyemprotkan air ke KMP Laut Teduh II yang terbakar Selat Sunda, Banten, Jumat (28/1).

Feri Terbakar Di Selat Sunda, 19 Tewas BANDARLAMPUNG (Antara): Kapolda Lampung Brigjen Sulistyo Ishak menyatakan jumlah korban tewas kecelakaan kapal KMP Laut Teduh II di Selat Sunda telah mencapai 19 orang. “Dua diantaranya warga Lampung dan sudah dievakuasi ke Kalianda Lampung Selatan pada Jumat siang,” katanya, di Bandarlampung, Jumat(28/1). Dia menyatakan, tidak menutup kemungkinan korban tewas akan bertambah apalagi yang berasal dari Lampung, mengingat hingga saat ini pencarian dan penyisiran oleh

tim SAR masih terus dilakukan. “Kami membantu proses penemuan penyisiran pada sekitar lokasi terbakarnya KMP Laut Teduh di Selat Sunda dengan menurunkan tiga kapal bantuan,” kata dia. Menurut Ishak, dua kapal yang diturunkan untuk membantu penyisiran korban itu berasal dari Polair Polda Lampung dan satu diantaranya merupakan backup bantuan dari Mabes Polri. Dia melanjutkan, berdasarkan informasi terkini yang diperoleh, jumlah kendaraan yang

LENTERA

Imam Syafi’i Oleh H. Ameer Hamzah “Saya belum pernah melihat seorang ulama pun yang lebih faqih dari Imam Muhammad bin Idris AsySyafi’i.” (Imam Ahmad bin Hambal) NAMA aslinya Muhammad bin Idris bin Abbas bin Syafi’i al Quraisyi. Lahir di Gazza (Palestina) tahun 150 H, pada hari wafat Imam Abu Hanifah. Sejak kecil sudah yatim, ibunya yang miskin tetap mendidik Muhammad bin Idris untuk mewarisi ilmu-ilmu agama, sebab ayah Muhammad bin Idris, kakek sampai datuk-datuknya juga alim ulama.

Lanjut ke hal A2 kol. 6

terbakar di dalam kapal tersebut adalah sebanyak 89 kendaraan, termasuk bus dan truk. “Kami hanya membantu penyisiran dengan status bawah kendali operasi, termasuk tim identifikasi korban bencana,” kata dia. Jumlah penumpang selamat pada kapal Feri KMP Laut Teduh II yang terbakar Jumat dinihari sebanyak 427 orang. Kapal tersebut terbakar di dekat perairan Merak pada Jumat dini hari. Lanjut ke hal A2 kol. 6

HISTORY HISTORY

MEDAN (Waspada): Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) melalui jalur undangan hanya akan diikuti oleh siswa dari sekolah yang sudah terdaftar pada sistem database SNMPTN 2010 dimana siswanya pernah mengikuti ujian tulis SNMPTN 2010. Selain itu, diprioritaskan adalah sekolah yang memiliki akreditasi A atau B. “Dalam pendaftaran melalui jalur undangan ini, kepala sekolah harus proaktif mendaftarkan siswa terbaiknya untuk diseleksi menjadi calon mahasiswa baru di perguruan tinggi negeri (PTN) yang diminati,” kata Ketua Panitia Lokal SNMPTN USU, Prof. Zulkifli Nasution melalui

Humas Bisru Hafi, S.Sos, MSi kepada Waspada, Jumat (28/1), sehubungan akan segera dibukanya pendaftaran SNMPTN 2011 Jalur Undangan dimulai pada 1 Februari-12 Maret 2011 yang dilakukan secara online melalui laman (website) http:/ /undangan.snmptn.ac.id. Sedangkan siswa yang berhak ikut jalur undangan adalah siswa SMA/SMK/MA/MAK yang sedang duduk di kelas XII dan akan mengikuti UN tahun 2011, memiliki prestasi akademik serendah-rendahnya berperingkat 25% terbaik di kelasnya secara konsisten dan memperoleh rekomendasi dari kepala sekolah. Lanjut ke hal A2 kol. 2

AP

DEMONSTRAN yang menentang 30 tahun pemerintahan Presiden Hosni Mubarak bentrok dengan polisi anti huru hara di Kairo, Mesir, Jumat (28/1). Puluhan ribu demonstran antipemerintah yang memenuhi jalan-jalan Mesir di hadang oleh polisi yang menggunakan peluru

Napi LP T. Gusta Kendalikan Rusuh Di Mesir, Oposan ElBaradei Tahanan Rumah Curanmor Di Mebidang MEDAN (Waspada): Seorang narapidana Lembaga Pemasyarakatan (LP) Tanjung Gusta diduga sebagai pengendali sindikat pencurian kendaraan bermotor (curanmor) di wilayah Medan, Binjai dan Deliserdang (Mebidang). Bahkan, aksi kejahatan tersebut juga melibatkan seorang warga Aceh yang bertindak sebagai joki (pengantar sepedamotor curian). Demikian dikatakan Kapol-

sekta Sunggal Kompol Sonny Marisi Nugroho,SH,SIK kepada Waspada usai memaparkan keberhasilan jajarannya menangkap 16 tersangka pencuri sepedamotor, pembongkaran rumah, pencurian di warnet, Jumat (28/1) sore. Menurut Sonny, keterlibatan seorang napi berinisial O tersebut berdasarkan pengakuan dua kelompok sindikat

Lanjut ke hal A2 kol. 1

KAIRO, Mesir (AP): Ribuan demonstran anti pemerintah Mesir bentrok dengan polisi usai shalat Jumat (28/1) di Kairo. Pasukan keamanan menembakkan peluru karet, gas airmata dan meriam air ke arah para demonstran yang jumlahnya ribuan orang.Bentrok antara pihak keamanan dan massa tak terhindarkan. Bentrokan itu merupakan suatu aksi penentangan terhadap kekuasaan 30 tahun Presiden Hosni Mubarak. Sementara, tokoh oposisi dan pemenang Hadiah Nobel Perdamaian Mo-

Lebih Dulu Asahan Atau Tanjungbalai? KABUPATEN Asahan dan Kota Tanjungbalai merupakan satu bagian tak terpisahkan. Selama sebelas tahun,Tanjungbalai langsung di bawah administrasi Pemerintahan Daerah Kab. Asahan, tepatnya sekitar 1945 sampai 1956. Masa itu, status Tanjungbalai hampir tidak jelas. Kendati status haminte belum dicabut, namun tak ada Walikota yang ditetapkan, kecuali pejabat yang memimpin Asahan. Jadi, seolah-olah Tanjungbalai wilayah Kab. Asahan, dimana Tanjungbalai sebagai ibukotanya. Tetapi, dengan SK Departemen Dalam Negeri Nomor: Up. 15/2/3 tanggal 18 September 1956, status Kota T. Balai

Lanjut ke hal A2 kol. 4

Waspada/Rahmad F Siregar

BANGUNAN yang dipercaya sebagai makam Raja Kesultanan Asahan, Sultan Abdul Jalil Rahmatsyah, tidak terawat, bangunannya mulai retak dan di sekitarnya dipenuhi rumput.

hammed ElBaradei, yang kembali ke Kairo untuk bergabung dengan demonstran ditangkap dan dikenakan tahanan rumah. Sumber kepada CNN mengatakan, pihak berwenang mengenakan jam malam dari pukul 06:00 sore sampai pukul 07:00 pagi waktu setempat di Kairo, Iskandariyah dan Suez, di mana demo besar-besaran terjadi. ElBaradei, pemenang hadiah Nobel dan mantan kepala badan pengawas nuklir PBB (IAEA), sebelumnya diperingatkan agar tidak meninggalkan

satu masjid di dekat pusat kota Kairo, di mana dia melaksanakan shalat Jumat. Gunakan meriam air Para demonstran berkumpul di enam lokasi di Kairo, satu kota berpenduduk kira-kira 18 juta jiwa.Demo juga berlangsung di Assiut di selatan Kairo dan al-Arish di Semenanjung Sinai. Stasiun televisi regional melaporkan bentrokan antara ribuan demonstran dan polisi di kota pelabuhan Iskandariyah di tepi Laut Tengah dan Minya di selatan Kairo. Lanjut ke hal A2 kol. 4

Resepsi HUT Ke-80 Dan Pembukaan Muswil XI

Al Washliyah Jangan Ciptakan Konflik Yang Memecah Umat MED A N ( Waspada): Di tengah maraknya problematika sosial politik Muslim Nasution saat ini, seluruh jajaran Al Jam’iyatul Washliyah dan umat Islam khususnya di Sumatera Utara ini untuk tetap menjaga harmonisasi kemitraan antara pemerintah dengan umat, dan jangan menciptakan konflik yang dapat memecah belah keharmonisan umat Islam dan umat beragama lainnya. “Bangunlah bangsa ini dengan cara bergandeng tangan dengan pemerintah di daerah manapun saudara-Saudara

berada, jangan ciptakan konflik yang dapat memecah belah keharmonisan ummat Islam dan umat beragama, kritiklah siapapun dengan etika dan kesantunan, tanpa harus menghujat dan mencemooh, apalagi dengan cara-cara yang anarkis,”

Lanjut ke hal A2 kol. 3

erampang Seramp ang - Dulu gak terpikir, senjata bisa makan tuan - He...he...he...

Medan 25-32 C

P.Sidimpuan 20-30 C

R.Prapat 26-320C

Penyabungan 20-30 0C

0

Sibolga 22-310C

Berastagi 18-270C

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

SABTU, Pahing, 29 Januari 2011/24 Safar 1432 H z No: 23401 * Tahun Ke-65

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

KPK Tahan 19 Politisi Termasuk Panda Nababan Dan Paskah Suzetta

JAKARTA (Waspada): 19 Tersangka kasus dugaan suap dalam pemilihan Dewan Gubernur Senior BI Miranda Goeltom, yang menjalani pemeriksaan sejak Jumat (28/1) pagi, akhirnya sekitar pukul 17:30 resmi ditahan oleh Komisi Pemberantasan Korupsi (KPK).

Paskah Suzetta

Aburizal Jenguk Paskah Di Cipinang

Menurut informasi salah seorang pengacara para tersangka dari politisi PDI Perjuangan, Robert Keytimu, keenam belas tersangka resmi ditahan di rumah tahanan yang berbeda. KPK sendiri belum memberikan keterangan resmi karena masih melakukan pemeriksaan terhadap

tiga tersangka lainnya. “Para tersangka ditahan dibeberapa rutan. Termasuk juga dari anggota kami, dari PDI Perjuangan. Mereka ditahan kurang lebih 20 hari, sampai dipanggil untuk pemeriksaan lebih lanjut,” kata Robert. Sementara anggota DPR asal Fraksi PDI Perjuangan, Panda Nababan, resmi ditahan KPK dan ditempatkan di Rumah Tahanan Salemba. Panda ditahan setelah dijemput paksa di Bandara SoekarnoHatta Kamis (28/1) siang dan menjalani pemeriksaan di KPK sebagai tersangka kasus dugaan suap pemilihan Dewan Gubernur Senior Bank Indonesia Miranda Goeltom saat ia menjabat anggota DPR 1999-2001. Kepastian penahanan Panda ini disampaikan Ketua

Departemen Hukum DPP PDI Selain Panda, menurut Perjuangan, Gayus Lumbuun, Gayus, KPK juga menahan kepada Kompas.com, Jumat politisi PDI Perjuangan lain petang. yang juga berstatus tersangka, “Pak Panda sudah resmi Agus Tjondro. “Tapi saya tidak ditahan di Rutan Salemba,” tahu Agus Tjondro ditahan di kata Gayus, yang mengaku mana. Kalau tidak di Salemba, baru menemui Panda di Ge- kemungkinan di Cipinang,” dung KPK, Kuningan, Jakarta kata anggota Komisi III ini. Selatan. Sembilan tersangka yang ditahan di Rutan Cipinang yakni: 1. Paskah Suzetta (Golkar) 2. Daniel Tandjung (PPP) 3. Sutanto Pranoto (PDIP) 4. Poltak Sitorus (PDIP) 5. Matheos Pormes (PDIP) 6. Sofyan Usman (PPP) 7. M Iqbal (PDIP) 8. Marthin Bria Seran (Golkar) 9. Ahmad Hafiz Zawawi (Golkar) Lima tersangka ditahan Di Rutan Salemba 10. Panda Nababan (PDIP) 11. Soewarno (PDIP) 12. Baharuddin Aritonang (Golkar)

Lanjut ke hal A2 kol 1

Panda Nababan

Pesan Megawati Untuk Panda

JAKARTA (Waspada): Ketua Umum DPP Partai Golkar Aburizal Bakrie yang akbrab disapa Ical langsung mendatangi Rutan Cipinang, Jumat (28/1). Kehadiran Ical untuk membesuk kader Golkar yang kini ditahan KPK terkait kasus dugaan suap saat pemilihan Deputi Gubernur Senior Bank Indonesia (BI) tahun 2004. Kedatangan Ical satu jam setelah sembilan tersangka yang juga mantan anggota DPR RI periode 1999-2004 tersebut ditahan KPK di Rutan Cipinang. Ical tiba di Rutan Cipinang bersama rombongan. Ia dan rombongan langsung masuk ke Rutan. Dua kader Golkar

JAKARTA (Antara): Ketua Umum DPP Partai Demokrasi Indonesia Perjuangan (PDIP) Megawati Soekarnoputri menyampaikan pesan kepada Panda Nababan agar tegar menghadapi proses hukum. “Saya tadi sudah memberitahukan kepada Ibu Mega perihal Pak Panda yang ditangkap petugas KPK (Komisi Pemberantasan Korupsi) dan Ibu Mega berpesan supaya Pak Panda tegar,” kata Ketua Bidang Hukum DPP PDI Perjuangan Trimedya Panjaitan ketika dihubungi melalui telepon selulernya di Jakarta, Jumat (28/1). Tr i m e d y a P a n j a i t a n mengatakan hal itu terkait

Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 7

Warga Enam Desa Kepung Maling Pria Miliki Kartu BIN Dan Pasangannya Diamankan BIREUEN (Waspada): Ratusan masyarakat dari enam desa di Kec. Juli, Bireuen, Kamis (27/1) malam hingga Jumat (28/1) pagi mengepung areal persawahan di kawasan irigasi Km 4.5 lintas BireuenTakengon, mencari maling yang sebelumnya masuk kios di Keude Trieng, Juli. Namun hingga kemarin maling yang dicari tak ditemukan. Menjelang dinihari warga telah melingkari areal persawahan, sebagian menggunakan sepedamotor dan sebagian lagi berjalan kaki. Mereka mencari seorang pria yang kabarnya baru saja gagal men-

curi. Sementara Kapolres Bireuen AKBP HR Dadik Junaedi, SH melalui Kapolsek Juli AKP Effendi ZA yang dikonfirmasi, Jumat mengatakan, masalah itu sedang diselidiki kebenarannya. Informasi yang diperoleh pihaknya, ada seorang ABG lari dari rumah dikejar orangtuanya gara-gara tidak masuk sekolah. ABG itu kemudian sembunyi di sebuah kios. Pemilik kios yang mengetahui hal itu menyangka ABG tersebut maling. Sementara ABG tersebut langsung kabur hingga akhirnya dikejar dan

dikepung warga karena menduga ABG itu sembunyi di persawahan. Suami Isteri Di tengah kesibukan itu, anggota Polsek Juli yang ikut dalam pencarian berhasil mengamankan pasangan suami-isteri yang tidak jelas identitas dan status perkawinannya. Pasangan itu adalah Muhammad, 31, mengaku asal Desa Cot Jrat, Kec. Kota Juang namun sudah lama tidak menetap di desanya dan wanita yang diakui isterinya,

Lanjut ke hal A2 kol 7

Reuters

KAPAL RORO TERBAKAR. Kapal Roro Lautan Teduh II terbakar di Selat Sunda, Merak, Banten, Jumat (28/1).13 orang tewas dan ratusan lainnya luka-luka serta puluhan kendaraan roda empat ikut terbakar musnah akibat terbakarnya kapal roro itu sekitar pukul 02.30 Wib dalam perjalanan dari Merak menuju Lampung.

Kapal Angkut 567 Orang Terbakar 13 Tewas MERAK (Waspada): Kapal KMP Laut Teduh 2 terbakar di tengah laut antara Merak dan Bakauheni Jumat (28/1) dinihari. Untuk sementara 13 orang dinyatakan tewas dan sejumlah penumpang lainnya dalam pencarian. Kepala Pusat Komunikasi Publik Departemen Perhubungan, Bambang Supriadi Ervan mengatakan, kapal berangkat dari dermaga Merak pada pukul 03:19 WIB. Tidaak sampai sejam berlayar, ada yang tak beres di kapal. “Pukul 03:59 WIB nahkoda melaporkan pada Ship Traffic Centre (STC) bahwa ada api di car deck,” kata Bambang, Jumat (28/1). Lanjut ke hal A2 kol 7

PT PLN Bangun PLTA Asahan III Berbiaya Rp2,2 T

Bupati Dan Ketua DPRD Tobasa Tagih 2 Megawatt PLTA BALIGE (Waspada): PT Perusahaan Listrik Negara (PLN) segera membangun proyek Pembangkit Listrik Tenaga Air (PLTA) Asahan III berbiaya Rp2,2 triliun dengan kapasitas terpasang 2 x 87 Megawatt di wilayah Kab.Asahan dan Kab.Tobasa yang ditandai peletakan batu pertama pembangunan akses jalan dan base camp, Jumat (28/1). Peletakkan batu pertama dilakukan Dirut PT PLN Dahlan Iskan, GM Pikitring Sumbagut Bintatar Hutabarat, Bupati Tobasa Pandapotan Kas-

min Simanjuntak, Ketua DPRD Tobasa Sahat Panjaitan, Wakil Bupati Asahan, sejumlah anggota DPRD Asahan dan DPRD Sumut. Pembangunan akses jalan dan base camp merupakan tahapan awal dari rangkaian panjang proyek PLTA Asahan III. Terkait proyek ini, jauh sebelumnya pada pekan pertama bulan Juni 2010, Dirut PT PLN Dahlan Iskan telah menandatangani kontrak agreement dengan Nippon Koei.Ltd untuk engineering service bekerjasama dengan

konsultan dalam negeri PT Co n n u s a E n e r g i n d o, P T Kwarsa Hexagon, PT Arkonin Engineering Manggala Pratama, PT Tata Guna Patria dan PT Jaya CM. Dirut PT PLN Dahlan Iskan dalam sambutannya mengatakan, untuk membiayai proyek ini, PT PLN telah mendapatkan jaminan pinjaman dari investor Jepang, sehingga diperlukan upaya percepatan untuk segera membangun PLTA Asahan III

Lanjut ke hal A2 kol 3

Danau Toba Digodok Musrenbang 7 Pemda

Waspada/Abdul Mukthi Hasan

BERJAGA-JAGA: Warga berjaga-jaga di areal persawahan Kec. Juli, Bireuen, Kamis (28/1) menjelang dinihari menunggu pemuda yang dilaporkan bersembunyi di kawasan itu.

Al Bayan

Imam Hambali Oleh: H. Ameer Hamzah IMAM Hambali terkenal sebagai perawi hadits. AlMusnad nama kitabnya. Beliau sangat pemurah harta dibagi-bagikan kepada fakir dan miskin. Beliau sangat dermawan, seperti curah hujan. Nama lengkap adalah Imam Ahmad bin Hambal bin Hilal al-Syaibani. Lahir di Baghdad (Iraq) bulan Rabiul Awal 164 H. Seperti halnya Imam Syafi’i, Ahmad bin Hambal juga seorang anak yatim sejak kecil. Ibunya mengasuh Ahmad dengan ilmu-ilmu keislaman, tauhi, fiqh, akhlak, menghafal al-Quran dan hadits. Daya hafalnya luar biasa.

Lanjut ke hal A2 kol 2

MEDAN (Waspada): Konsep Pengelo-laan Kawasan E k o s i s t e m D a n a u To b a (PKEDT) yang ada selama ini dinilai kurang sinergis diterapkan. Tujuh pemerintah daerah di sekitar kawasan strategis nasional tersebut, termasuk Pemprovsu, masih jalan sendiri-sendiri menerapkan konsep penge-lolaan yang sudah disusun dalam Lake Toba Ecosystem Management Plant (LTEMP). “Karena persoalan kurangnya sinergitas itu, maka ke depan konsep pengelolaan

KE DT ak an dimasukkan dalam Musyawarah Rencana Pembangunan (Musren-bang) tujuh Pemda yang kesimpulannya akan dirumus-kan dalam dua hari ini,” kata Ketua Harian Badan Pelak-sana Badan Koordinasi Pengelolaan Ekosistem Kawa-san Danau Toba (BKPEDT), DR Edward Simanjuntak, MM di Medan, Kamis (27/1). Ketujuh Pemda tersebut yakni Kabupaten Karo, Phakphak Barat, Samosir, Humbahas, Simalungun, Tobasa, Taput dan Pemprovsu.

Memasukkan konsep PKEDT dalam Musrenbang tujuh Pemda itu, menurut Edward untuk lebih mempokuskan atau menajamkan program yang sudah disusun dalam LTEMP agar bisa dilaksanakan secara holistik oleh tujuh Pemda. Konsep pengelolaan KEDT yang meliputi dua wilayah utama, yakni mengenai tutupan lahan di Cacthment Area Danau Toba atau wilayah tangkapan air Danau Toba yang berupa areal perbukitan yang mayoritas kondisinya sudah

gundul serta menyangkut wilayah perairan Danau Toba yang dimaksudkan mempunyai nilai yang lebih sehat dan layak dikonsumsi. Dari dua konsep besar pengelolaan KEDT ini, lanjut Edward, maka masing-masing Satuan Kerja Perangkat Daerah (SKPD) dari tujuh Pemda, akan memasukkan hasil kesimpulan rapat Koordinasi dan Evaluasi BP-BKPEDT Tahun 2011 pada Musrenbang di masing-masing wilayah.

Lanjut ke hal A2 kol 3

HISTORY HISTORY

Lebih Dulu Asahan Atau Tanjungbalai? KABUPATEN Asahan dan Kota Tanjungbalai merupakan satu bagian tak terpisahkan. Selama sebelas tahun, Tanjungbalai langsung di bawah administrasi Pemerintahan Daerah Kab. Asahan, tepatnya sekitar 1945 sampai 1956. Masa itu, status Tanjungbalai hampir tidak jelas. Kendati status haminte belum dicabut, namun tak ada Walikota yang ditetapkan, kecuali pejabat yang memimpin Asahan. Jadi, seolah-olah Tanjungbalai wilayah Kab. Asahan, di mana Tanjungbalai sebagai ibukotanya. Tetapi, dengan SK Departemen Dalam Negeri Nomor : Up. 15/2/3 tanggal 18 September 1956, status

Lanjut ke hal A2 kol 6

Waspada/Rahmad F Siregar

TERANCAM PUNAH: Bangunan yang dipercaya sebagai makam Raja Kesultanan Asahan, Sultan Abdul Jalil Rahmatsyah, tidak terawat, bangunannya terlihat mulai retak dan di sekitarnya dipenuhi rumput liar, bahkan makam ini terancam punah karena abrasi sungai Asahan yang sudah mendekati bangunan.

Waspada/Jimmi Sitinjak

Dirut PT PLN Dahlan Iskan bersama GM Sumbagut Pikitring PT PLN, Bupati Tobasa, Wakil Bupati Asahan ,Ketua DPRD Tobasa melakukan peletakkan batu pertama pembangunan PLTA Asahan III di Dusun Batu Mamak, Kec.Pintupohan Meranti, Kab.Tobasa, Jumat (28/1).

Karyawan PTPN II Tebas Tanaman Penggarap MEDAN (Waspada): Ratusan karyawan PTPN II bersenjatakan kelewang, parang dan golok merusak dan membabat seluruh tanaman milik penggarap di atas lahan perkebunan milik negara mulai kawasan Jalan Jermal 15, Kelurahan Menteng, Kecamatan Medan Denai hingga Dusun III Desa Amplas, Kecamatan Percut Sei Tuan, Jumat (28/1) sekira pukul 08:00. Hal itu dilakukan setelah berulang kali dilakukan peringatan dari pihak PTPN II, namun tidak diindahkan oleh para penggarap. Di lahan HGU PTPN II Jalan Jermal XV, ratusan karyawan dikawal personel Brimob, menebas seluruh tanaman milik masyarakat penggarap siap panen, seperti jagung, pisang, ketela pohon (ubi), pepaya serta merusak bangunan rumah.

Sedangkan, para penggarap yang selama ini mengusahai tanaman hanya bisa pasrah tanpa bisa berbuat apa-apa, menyaksikan tanaman milik mereka ditenbas habis oleh ratusan karyawan PTPN II yang mendapat pengawalan dari aparat keamanan tersebut. Wandi, 38, seorang penggarap di Jalan Jermal XV

Lanjut ke hal A2 kol 1

Serampang - Pemberi suap kapan ditahan ? - He.... he....he....

Berita Utama

A2 KPK ‘Ngamuk’ ....

13. TM Nurlif (Golkar) 14. Reza Kamarullah (Golkar) 15. Max Moein (PDIP) 16. Asep Ruchimat Sudjana Dua ditahan di Rutan Wanita Pondok Bambu: 17. Ni Luh Mariani Tirtasari (PDIP) 18. Engelina Pattiasina (PDIP) Seorang ditahan di Polda Metro Jaya 19. Agus Tjondro (PDIP) Panda: Segera Bawa Ke Pengadilan Tersangka kasus dugaan suap pemilihan Dewan Gubernur Bank Indonesia (BI) Miranda Goeltom, Panda Nababan meminta agar kasus yang menjeratnya segera dibawa ke pengadilan. Hal itu dikatakan Panda seusai menjalani pemeriksaan di Gedung KPK, Kuningan, Jakarta Selatan, Jumat (28/1) petang. “Segeralah bawa proses ini dibawa ke pengadilan agar terang benderang kasusnya,” ujar anggota Komisi III DPR asal Fraksi PDI Perjuangan ini. Panda juga sempat mempertanyakan mengapa KPK tak kunjung memeriksa dan menetapkan status yang sama kepada penyuapnya. Malam tadi, Panda resmi ditahan di Rutan Salemba, Jakarta Pusat. Sementara itu, tersangka lainnya, Agus Tjondro juga mengungkapkan hal yang sama. Saat akan dibawa ke Rutan Polda Metro Jaya, Agus mengatakan, lebih cepat kasus ini diproses, karena akan lebih baik. “Semakin cepat semakin bagus karena setelah selesai bisa tahu penyuapnya. Biar hakim yang menentukan,” kata Agus yang dibawa dengan Kijang berwarna silver B 2040 BQ menuju tahanan. Lima Tersangka Absen Panggilan KPK Lima orang tersangka kasus dugaan suap pemilihan Dewan Gubernur Senior Bank Indonesia Miranda Gultom tidak hadir dalam pemeriksaan KPK, Jumat (28/1). Kelima yang tidak memenuhi panggilan KPK adalah Hengki Baramuli, Bobi Sudahirman, Willem Tutuarima, Rusman Lumban Toruan, dan Budiningsih. “Ya memang lima orang tidak hadir. Diantaranya Hengky Baramuli, Bobi Suhadirman, Willem Tutuarima, Rusman Lumban dan Budiningsih. Dua diantara itu alasannya sakit yaitu Boby Suhdirman dan Willem dikabarkan sedang dirawat dirumah sakit,” kata Juru Bicara KPK, Johan Budi, di Gedung KPK, Jumat, (28/01. KPK Pengalihan Isu KPK membantah penyidikan dan penahanan atas ke 19 tersangka kasus cek perjalanan sebagai bentuk pengalihan isu. KPK diduga berusaha melakukan pengalihan isu oleh salah satu tersangka yang ditahan Angelina Pattisiana. Bantahan ini disampaikan Juru Bicara KPK, Johan Budi dalam jumpa pers di kantor KPK, Jumat (28/1) malam. “KPK bekerja berdasarkan azas hukum dan tidak ada kaitannya dengan politik, pencitraan, maupun pengalihan isu,” tegas Johan Budi. Penyidikan dan penahanan ini, lanjut Johan, merupakan proses biasa dalam penyelidikan kasus. Penahanan ini dilakukan karena KPK punya alasan subjektif dan objektif. “ Ini proses biasa. Mereka ditahan karena ada alasan subjektif dari penyidik KPK, kalau-kalau ada yang melarikan diri, atau menghilangkan bukti. Ada juga alasan objektif, dimana ada kewenangan KPK untuk penahanan. Hari ini dirasa memang tepat untuk proses pengembangan kasus dan penahanan,” kata Johan. (vivanews/kps)

Karyawan PTPN II ....

mengaku kecewa dengan sikap ratusan karyawan karena secara membabibuta membabati tanaman para penggarap. “Sudah 15 tahun kami menggarap, mereka seenaknya saja membabati lahan kami,” jelasnya. Ketua kelompok penggarap Maju Bersama H. Rohmat Jumiran, 54, menjelaskan, saat kejadian itu, seluruh warga penggarap hanya bisa pasrah. ”Kami tak bisa berbuat apaapa karena ratusan karyawan tersebut dipersenjatai senjata tajam dan dikawal petugas Brimob,” ujarnya. Sementara itu, tokoh masyarakat Jalan Jermal XV Marlon Purba mensinyalir para pembabat lahan penggarap diduga oknun-oknum bayaran. “Seharusnya pihak PTPN II melakukan pertemuan dengan warga penggarap sebelum bertindak semenamena. Tindakan tersebut jelas bergaya premanisme karena menghilangkan mata pencaharian warga penggarap,” tegasnya. Usai membabat lahan warga di Jalan Jermal, ratusan karyawan PTPN II tersebut melakukan aksi serupa di kawasan Selambo Dusun III Desa Amplas, Kecamatan Percut Seituan.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Mh3+. 2. Rf2, Ge3+. 3. Re1, MxGf1+mat.

Jawaban TTS: TTS Topik

R E F I L K A M A N I T U N F O O R P R M H A S I

Infokom (Muat Ulang)

E R E N S I E N N T E K P U S T I F A T R P D A E S E R T O U O O F S T T R D W A R E A L R E P O

P K N O L O L M U U L I N I I F I K O A R S M I U L I P I T R E T

S A G I D T I N A T E R N E U T

Jawaban Sudoku: 2 5 7 9 8 1 6 0 3 4

1 8 2 6 7 0 3 4 9 5

9 7 8 0 4 3 5 1 6 2

0 4 3 5 2 6 7 9 8 1

3 6 4 1 9 5 8 2 0 7

4 1 5 2 0 8 9 3 7 6

8 9 6 3 5 4 1 7 2 0

5 0 9 4 6 7 2 8 1 3

6 2 1 7 3 9 0 5 4 8

7 3 0 8 1 2 4 6 5 9

Bukan hanya tanaman yang dirusak, satu rumah ibadah di lokasi itu ikut dirusak dan dibakar, termasuk salah seorang warga penderes tuak Parulian Sitanggang, 42, ikut dikejar dan sepeda motornya dibakar. Asisten Afdeling VI PTPN II Bandar Klippa Rasyid Dalimunthe, yang dikonfirmasi mengatakan, pihaknya telah berulang kali mengimbau masyarakat penggarap untuk keluar dari lahan PTPN II, namun tidak pernah diindahkan. Pihaknya terpaksa melakukan okupasi karena diatas lahan tersebut akan ditanami kembali kelapa sawit. “Lahan tersebut masih berada di areal HGU no 104 yang berlaku hingga 2028, sehingga tidak ada alasan warga yang mengklaim tanah tersebut milik mereka,” jelas Dalimunthe. (h04)

Lebih Dulu ....

Kota Tanjungbalai kembali jelas (definitif). Dr. Edwarsyah Syamsura sebagai Walikota pertama (Lembaran Negara No. 1091). Selanjutnya berdasarkan UU Darurat No. 9 Tahun 1956, lembaran negara No. 60 Tahun 1956 sebutan Haminte Tanjungbalai diganti dengan ‘Kota kecil Tanjungbalai’. Setahun kemudian, pada 1957 UU No. 1 Tahun 1957, sebutan Kota Kecil diganti dengan Kota Praja Tanjungbalai. Bersamaan dengan itu, Badan Perwakilan Rakyat Tanjungbalai menjadi Dewan Perwakilan Rakyat Daerah peralihan Kota Praja Tanjungbalai dengan jumlah anggota 10 orang dari hasil Pemilu 1955. Sejarah Sejarawan sekaligus mantan Ketua Pansus Hari Jadi Tanjungbalai, Drs H Arifin menjelaskan, hasil penelusurannya ke Aceh untuk mengungkap sejarah Tanjungbalai. Awal mulanya, Tanjungbalai lahir ketika orang pertama membuka perkampungan di tepi sungai Barumun dan keturunannya menjadi raja yang memerintah di wilayah Kota Pinang, Labuhanbatu, yaitu Batara Sinombah, putra Raja Pagaruyung, Sultan Alamsyah Syaifuddin. Pada abad XV, Batara Si-

Imam Hambali ....

Untuk memperdalam ilmu, Ahmad pergi ke Basrah (Iraq) menuntut ilmu pada Imam Syafi’i yang kebetulan waktu itu berada di Basrah. Ahmad juga menuntut ilkmu ke negeri Yaman, setelah itu ke Mesir. Di antara guru beliau yang ternama adalah Imam Syafii, Yusuf al-Hasan, Ibnu Abbas, Ibnu Humam,dan lainlain. Setelah merasa cukup punya ilmu, beliau mulai mengajar dan mengarang kitab

WASPADA Sabtu 29 Januari 2011

Kapolda Persiapkan 2/3 Personel Amankan Pemilukada 2011 ACEH UTARA (Waspada): Meskipun Pemilukada tahun 2011, masih cukup lama, namun Irjen Pol Iskandar Hasan, Kapolda Aceh, telah mempersiapkan 2/3 personel polisi untuk pengamanan pesta demokrasi itu. “Jumlah personel kita di Polda Aceh lebih dari 13 ribu prajurit. Jadi untuk pengamanan Pemilukada 2011, akan kita turunkan 2/3 kekuatan yang kita memiliki. Saya kira jumlah cukup besar juga,’ kata

Irjen Pol Iskandar Hasan. Pihaknya berharap, pemilukada Aceh 2011 dapat berjalan aman dan damai. Pemilukada merupakan hak rakyat dalam menentukan siapa yang pantas menjadi pemimpin bagi mereka. Untuk itu, jangan sampai ada seseorang atau kelompok membuat kekacauan. Jika terjadi, polisi akan menindak tegas sesuai dengan ketentuan hukum yang berlaku. Siapa pun yang menang

dalam Pemilukada 2011, diminta untuk menghormati pilihan rakyat. Yang kalah diminta untuk lapang dana dan tetap memberikan dukungan penuh demi pembangunan Provinsi Aceh di masa mendatang. “ Ya n g m e n a n g p a d a Pemilukada itu bukan kandidatnya, tapi rakyat yang menang, karena itu kehendak rakyat, maka kalah harus mendukung. ‘kan nggak mungkin menang semua,”

saran Kapolda. Untuk itu, Kapolda Aceh mengingatkan, semua pihak baik KIP, petugas keamanan dan pihak terkait lainnya agar dapat bekerja secara professional dan proposional untuk mengawal demokrasi berjalan dengan damai. Hal ini sengaja disampaikan jauh hari sebelum hari-H agar semua pihak memiliki kesadaran untuk mengawal pesta demokrasi yang bersih dan adil. (cmun)

Aburizal ....

Antara

TABRAKAN KERETA. Seorang pekerja membongkar lokomotif KA Kutojaya Selatan yang hancur akibat menabrak KA Mutiara Selatan di Stasiun Langen Kota Banjar, Jabar, Jumat (28/1). KA Kutojaya jurusan Bandung-Kutoarjo menabrak KA Mutiara Selatan jurusan Surabaya-Bandung di Stasiun Langen, Kota Banjar, Jabar, Jumat (28/1) dini hari yang menyebabkan 3 penumpang tewas, dan puluhan lainya luka-luka.

yang ditahan di Cipinang adalah mantan Menteri Negara Perencanaan Pembangunan Nasional/Kepala Bapenas Paskah Suzetta dan Ahmad Hafid Zamawi. Menurut Ical, Partai Golkar menghargai proses hukum atau penahanan tersebut. Namun Golkar akan menelusuri apakah ada tindak diskriminasi dalam penahanan tersangka tersebut. Paskah: Ini Pengalihan Isu Ke luar dari Gedung Komisi Pemberantasan Korupsi, air muka mantan Menneg PPN/Kepala Bappenas Paskah Suzetta tampak tegang. Di luar gedung, tiga mobil tahanan sudah menanti dia dan delapan politisi lainnya.

Danau Toba ....

Asahan. “Seluruh SKPD di tujuh Pemda bersama Otorita Asahan akan mengawal hasil kesimpulan dari rapat ini untuk diakomodir dalam Musrenbang tujuh Pemda pada 2011. Sehingga, hasil yang ingin dicapai dalam konsep LTEMP yang berkesinambungan dan berwawasan lingkungan bisa segera diterapkan,” kata Edward. Beberapa hal yang dikordinasikan dan dievaluasi untuk disimpulkan dan kemudian dimasukkan dalam Musrenbang 2011 oleh tujuh Pemda dalam rapat dua hari tersebut, antara lain menyang-

kut pengelolaan limbah (manusia dan kotoran lainnya) dari kapal yang beroperasi di Danau Toba. Kemudian limbah Keramba Jaring Apung (KJA) apakah dari makanan ikan (pelet) atau kotoran ikan itu sendiri, limbah perhotelan yang tersebar di bibir pantai Danau Toba, termasuk limbah restauran dan limbah dari pemukiman penduduk. Selain itu, dalam rapat juga dibicarakan tentang konservasi kawasan perbukitan Danau Toba yang mayoritas s u d a h g u n d u l . Me n u r u t Edward, gundulnya lahan perbukitan di sekitar Danau Toba,

tidak hanya menyebabkan daya serap tanah terhadap air hujan yang turun tidak maksimal, tetapi juga menyebabkan terbawanya berbagai jenis bahan kimia dari perladangan di lereng perbukitan ke air Danau Toba. “Berbagai hal yang menyebabkan terjadinya degradasi KEDT tersebut akan dirumuskan pemecahannya oleh masing-masing sektor terkait dari tujuh Pemda. Sehingga upaya menghadirkan Danau Toba sebagai Kawasan Strategis Nasional yang berkelanjutan dan berwawasan lingkungan hidup bisa benar-benar diwujudkan,” katanya. (m28)

PT PLN Bangun ....

yang ditargetkan selesai dibangun dan mulai beroperasi komersial pada 2013. “Pembangunan proyek PLTA Asahan III sudah cukup lama menjadi program PT PLN untuk mengatasi krisis listrik Sumatera Utara dan konsepnya tidak seperti dahulu lagi masa PLTA Asahan II milik PT Inalum, karena kebutuhan listrik masyarakat setempat juga disuplai dengan mesin pembangkit tersendiri,” kata Dahlan. Dulunya pasokan listrik hasil PLTA disuplai dulu ke gardu induk PT PLN Medan lalu disalurkan ke seluruh pelanggan listrik di Sumut, namun sekarang tidak lagi.

“Jadi bisa saja Kota Medan mengalami krisis listrik sehingga terjadi pemadaman, tapi di daerah lokasi PLTA tetap stabil,” katanya. Menurut Dahlan, PT PLN sekarang ini lebih mengedepankan pembangunan PLTA karena perhitungannya sangat hemat dalam operasional dan menghasilkan daya listrik cukup tinggi. “Untuk wilayah Sumut sudah ada rencana pembangunan PLTA kecil-kecil yang dikelola swasta dan jika ditotal keseluruhannya mencapai 300 Megawatt dan komitmen PT PLN akan membangun gardu-gardu listrik berdekatan dengan lokasi PLTA tersebut,” ujar Dahlan.

Tagih Bupati Tobasa dan Ketua DPRD Tobasa dalam sambutannya mengatakan pihaknya segera menagih daya listrik sebesar 2 Megawatt yang dihasilkan PLTA PT Inalum yang dulunya dijanjikan untuk kebutuhan listrik masyarakat setempat, namun kenyataannya telah dijual kepada PT PLN. “Berdasarkan perhitungan kami sejak beroperasi PLTA PT Inalum, maka daya listrik sebesar 2 Megawatt tersebut kompensasinya senilai Rp300 miliar dan rencananya DPRD Tobasa membentuk panitia khusus (pansus) untuk menagihnya untuk keperluan pembangunan daerah,” kata Bupati Tobasa.

Hal senada juga dikatakan Ketua DPRD Tobasa yang meminta Dirut PT PLN membantu dalam penagihan kompensasi daya listrik yang dihasilkan PLTA PT Inalum tersebut. “Kami mohon bantuan Dirut PT PLN Dahlan Iskan untuk menagih janji daya listrik 2 Megawatt tersebut, karena tidak ada realisasi di lapangan yang pemakaiannya diberikan kepada masyarakat setempat,” kata Ketua DPRD Tobasa. Dirut PT PLN Dahlan Iskan mengatakan, komitmen daya listrik 2 Megawatt dihasilkan PLTA PT Inalum kepada masyarakat setempat belum mengetahui pasti bentuknya seperti apa, karena dirinya baru satu tahun menjabat. (a33)

nombah dan dua saudaranya, Batara Payung dan Putri Langgani dan seekor anjing Cempaka Putih, meninggalkan negeri Pagaruyung karena melanggar aturan adat. Batara Payung tinggal dan m e n d i r i k a n k e ra j a a n d i Mandailing dan keturunannya menjadi cikal bakal raja-raja di sana. Batara Sinombah dan adik tirinya ke utara, dan sampai di Hutang Momo (Hutang Mumuk) di kawasan Kotapinang. Mereka berdua menikah, dan dikaruniai anak. Salah satu putra Batara Sinombah, yaitu Sutan Musa menjadi raja di Kampung Raja (sekarang Kampung Rakyat Kab. Asahan). Dia mempunyai 3 putra, Tengku Raja Tahir, raja di Bilah dan Sutan Segar Alam. Sibungsu, Syahrir Alamsyah gelar Maharaja Awan berkekuasa di Air Merah, Pinang Awan dan keturunannya menjadi Raja Sultan Kota Pinang. Syahrir Alamsyah dikaruniai anak dari istri pertama, yaitu Siti Ungu (Siti Unai), dan Tengku Husin serta Tengku Abas. Sementara dari istri kedua lahir seorang putra dan ibunya sangat berharap dia menjadi pewaris kerajaan. Putra istri kedua menyebarkan fitnah yang meyakinkan raja sehingga Tengku Husin dan Abas diusir dari kerajaan dan berlayar ke Aceh. Lama di sana, Husin dan Abas

rindu kampung halaman, makanya mereka kembali ke A i r Me r a h P i n a n g Aw a n dengan pengawalan tentara Aceh. Begitu memasuki kampung halaman, kedua putra mahkota itu dihadang tentara kerajaan Air Merah, sehingga terjadi pertempuran yang berujung tewasnya sang raja yang tak lain saudara tiri mereka. Tentara Aceh, menangkap Siti Ungu dan dibawa dijadikan istri Sultan Aceh. Begitu pemerintahan Air Merah pulih, Husin dan Abas menyusul Siti Ungu ke Aceh. Di tengah perjalanan, mereka singgah di Negeri Asahan dan meminta seorang ahli bahasa dan perdukunan, Bayak Lingga, ke Aceh. Di Aceh, Husin, Abas dan Bayak Lingga membantu Sultan Aceh memenangkan sabung ayam. Sultan pun bersedia memberikan Siti Ungu untuk dibawa pulang ke kampung halamannya. Hanya saja Sultan berpesan, Siti Ungu tidak boleh nikahi sampai melahirkan. Apabila anak Sultan dari Siti Ungu lahir, maka harus dinobatkan sebagai raja di Asahan. Beberapa bulan kemudian, Siti Ungu melahirkan seorang putra bernama Abdul Jalil. Akan tetapi, setelah Abdul Jalil dewasa, dia tak diangkat menjadi raja. Sultan Aceh pun

murka, dan menjemput anaknya yang diasingkan di Batubara. Mereka kemudian menuju pusat pemerintahan raja di Gunung Bayu (kini Pulo Raja). Rombongan sultan disambut dengan kebesaran, bukan perlawanan. Seluruh pembesar kerajaan dan rakyat disuruh berkumpul seraya mengangkat sembah kepada Sultan Aceh. Tempat itu kemudian dikenal sebagai Marjanji Aceh Desa Aeksongsongan, Kec. Bandarpulao, Kab. Asahan. Setelah acara di Marjanji Aceh, rombongan kemudian menuju hilir sungai Asahan, dan berhenti di sebuah Tanjung di sekitar pertemuan antara sungai Silau dan Asahan. Sultan memerintahkan agar tempat itu dibangun balai-balai, dan istana tempat menghadap. Di sanalah Abdul Jalil ditabalkan menjadi Sultan Negeri Asahan. Anjungan balai tempat penabalan Abdul Jalil itu selanjutnya dijadikan tempat pengawalan serta pengutipan upeti. Akhirnya, balai di ujung tanjung itu menjadi pusat keramaian, dan muncullah kata ‘ Tanjungbalai.’ “Sultan Iskandar Muda merupakan pendiri Tanjungbalai, dan wafat pada 27 Desember 1636. Sementara anaknya, Sultan Abdul Jalil, ditabalkan menjadi Sultan

untuk mewarisi ilmunya kepada manusia, di samping mencari pahala pada Allah SWT. Murid-muridnya yang paling terkenal antara lain; Ha s a n b i n Mu s a , Im a m Bukhari, Imam Muslim, Abu Daud (ketiganya perawi hadits), Ibnu Abi ad- Duniya, Abi Durrah ad-Dimasyqi, dan Imam Saleh Asy-Syaibani. Imam Hambali sangat kuat dalam mempertahankan keimanannya. Beliau pernah dipaksa oleh Kalifah AlMakmun bin Harun Ar-Rasyid

supaya mengakui paham Mu’tazilah yang dianut khalaifah dan pembesar-pembesarnya. Paham Mu’tazilah beranggapan bahwa al-Quran itu makhluk baharu, sedangkan paham Sunni yang dianut Hambali dan tiga imam mazhab sebelumnya berpendapat al-Quran itu qadim. Akibat penolakan itu Imam Hambali ditangkap dan dijebloskan dalam penjara. Dalam penjara diperlakukan secara sangat biadab oleh mereka yang buta agama dan

akhlak. Imam hambali disiksa dengan berbagai cambukan dan tendangan. Meski disiksa sang Imam tetap tidak merubah keyakinannya bahwa alQuran itu qadim. Imam Hambali wafat di Baghdad tahun 241 H. Mazhab ini dilanjutkan dan dikembangkan oleh murid-muridnya yang juga sangat alim. Mazhab Hambali berkembang di Arab Saudi,Kuwait, Qatar, Abudhabi, Iraq, Palestina, Indonesia, Malaysia, dan lainlain. ** ** **

pertama di Tanjungbalai pada 1620. Setelah dilakukan kajian dan penelusuran mendalam, maka ditetapkanlah hari jadi Tanjungbalai 27 Desember 1620,” jelas Arifin. Pendapat Arifin itu, bertolak belakang dengan sejarawan Asahan, Zasnis Sulung. Penetapan hari jadi Tanjungbalai itu, menurut Zasnis, perlu dikaji ulang karena belum mampu diper tanggungjawabkan. Berdasarkan majalah Deli Gids 1938, ayah Abdul Jalil bukan Sultan Iskandar Muda, melainkan Sultan Aceh Al Qahar. Sultan itu memerangi Raja Margolang dan kroni karena mengusir Abdul Jalil dari Istana Tangkahan Sitarak Pulo Raja. Setelah memenangkan peperangan, Sultan membawa anaknya dan Raja Simargolang serta raja lainnya ke hilir sungai Asahan dan berlabuh di sebuah tanjung (pertemuan sungai Asahan dan Silau). Di sanalah Abdul Jalil ditabalkan menjadi Sultan Asahan I. “Jadi 1568 itulah diduga hari lahirnya Tanjungbalai. Menurut situs Blogger Asahan Community, awal Kesultanan Asahan itu abad ke XVI (1500-an) bukan abad XVII ((1600-an),” ujar Zasnis. Menurut sejarawan, Drs H Arifin, Asahan sudah ada sebelum Tanjungbalai lahir. Ketua Forum Komunikasi Antar Lembaga Adat itu, memperkirakan Asahan lahir pada abad ke XVI, dan Tanjungbalai pada abad XVII (1620). Jika kata ‘Tanjungbalai’ berasal dari balai yang dibangun di ujung tanjung antara sungai Asahan dan Silau, namun kata ‘Asahan’ sampai kini belum diketahui asal usulnya. Pernyataan Arifin tentang Asahan lebih dahulu lahir daripada Tanjungbalai didukung oleh buku Tabal Mahkota Negeri Asahan yang disusun M Arsjad 1933. * Rahmad F Siregar/ Rasudin Sihotang

SKPD di tujuh Pemda yang terlibat dalam rapat Koordinasi dan Evaluasi BP-BKPEDT Tahun 2011 itu meliputi Badan Lingkungan Hidup (BLH), Dinas Pertanian, Dinas Perikanan dan Kelautan, Dinas Bina Marga, Dinas Kebudayaan dan Periwisata, Dinas Kehutanan, Dinas Perhubungan, Dinas Tata Ruang, Dinas Perindustrian dan Perdagangan, Dinas Perkebunan, Dinas Pertambangan dan Energi, Dinas Provisi Sumber Daya Air/Pengairan, Dinas Pendidikan, Dinas Peternakan, Dinas Kesehatan, Badan Perencanaan Pembangunan Daerah dan Otorita

Waspada/Maimun Asnawi

IRJEN POL ISKANDAR HASAN, Kapolda Aceh, Kamis (27/1) di Alue Reudang, Baktya, Aceh Utara, sedang memberikan komentarnya tentang persiapan menyambut Pemilukada 2011. Sembilan politisi ini dibawa ke Rutan Cipinang usai diperiksa sebagai tersangka kasus suap pemilihan Deputi Gubernur Senior Bank Indonesia. “Ini pengalihan isu,” tegas Paskah yang tampak gusar sekitar pukul 16:35 WIB, Jumat (20/1). “Ini bukan korupsi, ini langkah politik. Kita akan lakukan langkah politik lagi,” kata dia dengan lantang sebelum masuk ke mobil Kijang hitam bernomor polisi B 8638 WU. Pengacara Pertanyakan Penahanan Baharudin Pengacara Baharuddin Aritonang, Maqdir Ismail

mempertanyakan langkah penahanan KPK. “Ini kan kasus penyuapan, tapi sampai sekarang KPK belum menangkap penyuapnya. Ini yang jadi persoalan,” kata Maqdir di Gedung KPK, Jumat 28 Januari 2011 “Kami melihat ini politik pencitraan entah kepentingannya apa. Ini satu cara memberangus lawan-lawan politik. Ini nggak bagus cara seperti ini,” tambah dia. Ditambahkan Maqdir, pihaknya akan mempertimbangkan langkah hukum. “Kita lihat nanti,” kata dia.

Pesan Megawati ....

Megawati Soenarkoputri. Trimedya juga bertanya kepada Tjahjo Kumolo apakah Panda Nababan sudah didampingi kuasa hukum. “Saya disarankan untuk langsung berhubungan dengan kuasa hukum PDI Pejuangan Patra M Zain untuk mendampingi Pak Panda, dibawa ke kantor KPK,” katanya. Tr i m e d y a k e m u d i a n menghubungi Patra M Zein untuk segera memberikan bantuan hukum kepada Panda Nababan. Menurut dia, PDI Perjuangan menyiapkan bantuan hukum bukan hanya untuk Panda Nababan tapi untuk beberapa politisi PDI Perjuangan yang ditetapkan sebagai tersangka pada kasus cek pelawat pemilihan Deputi Gubernur Senior Bank Indonesia Miranda S Goeltom pada 2004.

Warga Enam Desa ....

buku nikah. Namun saat diperiksa warga, dari dompet Muhammad ditemukan selembar kartu BIN atas nama Adi (nama belakang tidak jelas karena sudah dicoret-red), bertugas di Bengkalis. “Karena masalah sudah semakin tidak jelas lagi dan diduga terkait kasus penipuan, keduanya diserahkan ke Polisi,” jelas warga. Kapolres Bireuen AKBP HR Dadik Junaedi, SH melalui Kapolsek Juli AKP Effendi ZA membenarkan anggotanya mengamankan pasangan itu. “Nama si pria Muhammad bin Abdullah, surat nikahnya dikeluarkan KUA Batu Balang, Bukit Tinggi, Sumatera Barat 10 Januari 2010 dengan nama Irwandi bin Saleh, dengan alamat Dusun Kemang Tanjong, Kec. Kota Mini, Kab. Pidie. (amh)

Kapal Angkut ....

selamat 425 orang, termasuk 31 awak kapal, korban meninggal dunia 13 orang,” tambah dia. Saat ini penumpang dan awak kapal sudah dievakuasi. “Sedangkan kapal dikandaskan di perairan Anyer Cigading,” kata Bambang. Sementara, korban meninggal dan luka dibawa ke RS Krakatau Steel dan RS Panggung Rawi. Ditambahkan Bambang, saat ini masih ada sejumlah kapal yang masih melakukan pencarian di sekitar lokasi yakni, Kapal Negara KN 333, KAL Tamposo milik Angkatan laut dan tiga kapal Polair. (vivanews)

penangkapan anggota DPR RI dari Fraksi PDI Perjuangan Panda Nababan oleh petugas KPK di Bandara SoekarnoHatta, Tangerang, Banten, Jumat, sekitar pukul 11:00 WIB. Menurut Trimedya, Megawati juga berpesan agar Panda Nababan berani menghadapi perkara yang dituduhkan kepadanya dan mengungkapkan kebenaran yang sebenarnya. “Ibu Mega juga bertanya, dimana Pak Panda ditahan,” kata Trimedya. Anggota Komisi III DPR RI ini menambahkan, dirinya mendapat informasi bahwa Panda Nababan ditangkap petugas KPK di Bandara Soekarno-Hatta dari Sekretaris Jenderal DPP PDI Perjuangan Tjahjo Kumolo dan kemudian melaporkannya kepada Ketua Umum DPP PDI Perjuangan Asriati, 27, asal Dusun Matang Guru, Kec. Madat, Aceh Timur. Saat ditanya siapa nama suaminya, wanita itu mengaku kurang tau. Selama ini menurutnya, bernama Irwandi bin Saleh, seperti tercamtum di surat nikah yang diduga kuat tidak jelas status perkawinannya. Karenanya, pasangan itu diamankan ke Mapolsek Juli. Informasi lain, Muhammad dan Asriati saat itu bertamu ke rumah kakaknya di Desa Juli Meunasah Tambo selepas maghrib, dan rencannya hendak menginap. Namun kakaknya mencari rumah tetangga karena rumahnya kecil dan sempit. Tetangganya mengizinkan, namun dia harus melaporkan diri kepada perangkat desa dengan memperlihatkan KTP dan Ditanya posisi oleh STC, saat itu, nahkoda mengatakan kapal berada di sekitar Pulau Tempurung. Mendengar ada sinyal bahaya, STC melalui channel 16 menginformasikan dan meminta kapal-kapal lain yang menuju Bakauheni memberikan pertolongan. Juga minta bantuan dari pihak-pihak terkait. Dijelaskan Bambang, saat kecelakaan, kapal mengangkut 567 orang yang terdiri dari 535 penumpang dan 32 anak buah kapal (ABK). Kapal juga mengangkut 93 kendaraan. “Jumlah penumpang yang berhasil dievakuasi 458 orang,

(kps/vivanews)

Berita Utama

A2 Karyawan PTPN II Tebas Tanaman Penggarap Masa Berlaku HGU Hingga 2028

Parapat Satu-satunya Andalan Wisata Simalungun SIMALUNGUN (Waspada): Kota turis Parapat, Kec. Girsang Sipanganbolon dengan pesona keindahan alam Danau Tobanya masih menjadi andalan tujuan wisata Kab. Simalungun. Demikian Kepala Dinas Kebudayaan dan Pariwisata Kab. Simalungun, Drs Oberlin Hutagaol, menyatakan itu kemarin. Dikatakan, selain Parapat, Pemkab Simalungun juga mengedepankan objek wisata alam lainnya, seperti Tigaras, Haranggaol, Tinggiraja, PAS (Pemandian Alam Sejuk) dan Pemandian Karang Anyer serta wisata cagar budaya Rumah Adat (Rumah Bolon) Simalungun di Kec. Purba untuk menarik kunjungan wisatawan mancanegara dan nusantara. “ Tahun ini kita targetkan kunjungan wisatawan mancanegara dan nusantara ke Parapat dan sejumlah objek wisata lainnya sebanyak 50 ribu orang,” tegas Oberlin. Lebih lanjut Oberlin menyatakan, pihaknya memfokuskan peningkatan kunjungan wisatawan dalam negeri, karena dinilai memberikan dampak langsung bagi peningkatan per-

ekonomian dan pendapatan para pelaku pariwisata di daerah itu, termasuk masyarakat di sekitar objek wisata. Promosi Sementara itu, untuk lebih mengenalkan sejumlah objek wisata yang ada di Simalungun tersebut kepada khalayak, Oberlin mengatakan pihaknya akan lebih mengoptimalkan promosi pariwisata baik melalui media maupun dengan cara mengikuti berbagai even-even pameran pariwisata baik dilaksanakan di daerah maupun skala nasional. Dari data yang ada jumlah kunjungan wisatawan nusantara dan mancanegara sejak tahun 2007hingga2008terusmengalami peningkatan.Tahun 2007 jumlah wisatawan domestik sebanyak 19.968dantahun2008meningkat menjadi 22.234. Sedangkan wisatawan mancanegara tahun 2007 sebanyak 12.592 dan tahun 2008 hingga 2010, rata-rata mengalami peningkatan antara 1000 hingga 2000 orang dari target yang ditetapkan. “Kita akan meningkatkan berbagai event-event budaya yang diharapkan mampu menjadi salah satu daya tarik wisa-

tawan datang ke Simalungun,” tambah Oberlin. Di sisi lain, upaya mengoptimalkan promosi pariwisata Simalungun itu mendapat dukungan dari anggota DPRD Simalungun, Evra Sassky Damanik. Menurut Evra, Pemkab Simalungun melalui Dinas Kebudayaan dan Pariwisata tidak hanya melakukan promosi pariwisata di tingkat nasional saja, tetapi lebih jauh lagi harus melakukannya di dunia internasional. Dengan demikian, kebudayaan dan pariwisata yang ada di daerah Simalungun akan lebih dikenal lagi. Politisi dari Partai Amanat Nasional itu juga meminta PemkabSimlunguntidakhanyamengandalkan Parapat, sebagai tujuan utama kawasan wisata di daerah itu.Tetapi potensi-potensi pariwisata lainnya yang tidak kalah menariknya juga diperkenalkan. Misalnya seperti kawasan perkebunan teh di Kec. Sidamanik, bila ditata dan dijalin hubungan denganpihakPTPN-IVselakupemilik kebun teh, maka keindahan lokasi perkebunan teh itu dapat menjadi objek tujuan wisata yang menarik, cetus Evra. (a15)

Al Washliyah Jangan ...

didikan Al Washliyah yang dahulunya sangat memiliki karakteristik, saat ini sudah sangat jauh tertinggal secara kualitas meskipun secara kuantitas pendidikan Al Washliyah masih diperingkat teratas di Sumatera Utara ini. “Oleh karenanya mari kita secara bersinergi untuk melahirkan madrasah-madrasah dan sekolah plus di Sumatera Utara ini, segeralah melakukan revitalisasi pendidikan ini melalui berbagai program nyata agar Al Washliyah ini tetap maju zaman ber-zaman,” ungkapnya. Dia meminta agar semboyan dan motto “Majulah Washliyah Zaman Ber Zaman” , diwujudkan dengan beberapa landasan perjuangan sebagaimana Khittah awal berdirinya organisasi Al Washliyah, yakni bergerak di bidang dakwah, pendidikan, amal sosial dan kaderisasi. “Sebagai organisasi kemasyarakatan Islam, Dakwah dan pendidikan merupakan ruh per-

juangan Al Washliyah, dengan dakwahlah dahulu para pendahulu kita mendapatkan amanah dan simpatik dari umat Islam di Sumatera Utara ini,” tuturnya. Rumah gerakan dakwah Sementara itu, Wagubsu Gatot Pujonugroho yang hadir mengharapkan agar Al Washliyah menjadi rumah besar gerakan-gerakan dakwah serta tempat silaturahim untuk memikirkan umat Islam. “Untuk itu, program kerja ke depannya harus disusun sesuai ketentuan zaman dan sesuia yang dibutuhkan Islam.” Sedangkan, PW Al Washliyah Sumut H. M. Nizar Syarif menambahkan, selain mempererat silaturahmi antar sesama, momentum Muswil ini pun menjadi media untuk kelangsungan suksesi organisasi di lingkungan Al Washliyah dalam siklus lima tahunan yang dikemas melalui Muswil 11 Al Washliyah. Hadir pada acara tersebut, Walikota Medan Rahudman Harahap, anggota DPRD dari Al Washliyah, Ketua Umum MUI Sumut Abdullah Syah, para pimpinan partai politik, pimpinan organisasi kemasyarakatan, beserta peserta Muswil XI, baik pimpinan daerah, cabang, wilayah serta PW organisasi Al Washliyah yang berjumlah enam ratus peserta. (h02)

MEDAN (Waspada): Ratusan karyawan PTPN II bersenjatakan kelewang, parang dan golok merusak dan membabat seluruh tanaman milik penggarap di atas lahan perkebunan milik negara mulai kawasan Jalan Jermal 15, Kelurahan Menteng, Kecamatan Medan Denai hingga Dusun III Desa Amplas, Kecamatan Percut Sei Tuan, Jumat (28/1) sekira pukul 08:00. Hal itu dilakukan setelah berulang kali dilakukan peringatan dari pihak PTPN II, namun tidak diindahkan oleh para penggarap. Di lahan HGU PTPN II Jalan Jermal XV, ratusan karyawan dikawal personel Brimob, menebas seluruh tanaman milik masyarakat penggarap siap panen, seperti jagung, pisang, ketela pohon (ubi), pepaya serta merusak bangunan rumah. Sedangkan, para penggarap yang selama ini mengusahai tanaman hanya bisa pasrah tanpa bisa berbuat apa-apa, menyaksikan tanaman milik mereka ditenbas habis oleh ratusan karyawan PTPN II yang mendapat pengawalan dari aparat keamanan tersebut. Wandi, 38, seorang penggarap di Jalan Jermal XV mengaku kecewa dengan sikap ratusan karyawan karena secara membabibuta membabati tanaman para penggarap. “Sudah 15 tahun kami menggarap, mereka seenaknya saja membabati lahan kami,” jelasnya. Ketua kelompok penggarap Maju Bersama H. Rohmat Jumiran, 54, menjelaskan, saat kejadian itu, seluruh warga penggarap hanya bisa pasrah.”Kami tak bisa berbuat apa-

apa karena ratusan karyawan tersebut dipersenjatai senjata tajam dan dikawal petugas Brimob,” ujarnya. Sementara itu, tokoh masyarakat Jalan Jermal XV Marlon Purba mensinyalir para pembabat lahan penggarap diduga oknun-oknum bayaran. “Seharusnya pihak PTPN II melakukan pertemuan dengan warga penggarap sebelum bertindak semena-mena. Tindakan tersebut jelas bergaya premanisme karena menghilangkan mata pencaharian warga penggarap,” tegasnya. Usai membabat lahan warga di Jalan Jermal, ratusan karyawan PTPN II tersebut melakukan aksi serupa di kawasan Selambo Dusun III Desa Amplas, Kecamatan Percut Seituan. Bukan hanya tanaman yang dirusak, satu rumah ibadah di lokasi itu ikut dirusak dan dibakar, termasuk salah seorang warga penderes tuak Parulian Sitanggang, 42, ikut dikejar dan sepeda motornya dibakar. Asisten Afdeling VI PTPN II Bandar Klippa Rasyid Dalimunthe, yang dikonfirmasi mengatakan, pihaknya telah berulang kali mengimbau masyarakat penggarap untuk keluar dari lahan PTPN II, namun tidak pernah diindahkan. Pihaknya terpaksa melakukan okupasi karena diatas lahan tersebut akan ditanami kembali kelapa sawit. “Lahan tersebut masih berada di areal HGU no 104 yang berlaku hingga 2028, sehingga tidak ada alasan warga yang mengklaim tanah tersebut milik mereka,” jelas Dalimunthe. (h04)

Napi LP T. Gusta ...

bengkel penduduk Jln Sei Mencirim, Pasar Mati, Gg Sadon, Desa Lalang, Kecamatan Sunggal, Kabupaten Deliserdang; IMP, 17, pelajar penduduk Penerbangan, Gg Tani Baru II, Kelurahan Sempakata, Kecamatan Medan Selayang; JS alias Jon, 30, (joki) penduduk Aceh Tenggara; Sdm, 18, penduduk Desa Lawejo, Kecamatan Bambel, Kabupaten Aceh Tenggara. Sedangkan seorang pria bermarga Purba, 32, yang diduga terlibat dalam pencurian se-pedamotor tersebut masih dalam pengejaran polisi. Tersangka diketahui sering mangkal di kawasanDesaPayageli,Deliserdang. Tiga tersangka pembongkaran rumah yang diamankan Polsekta Sunggal yakni, Snd alias Nardi, 38, pekerja bangunan penduduk Nuri Perumnas Mandala dan Jln Perjuangan, Gg Keamanan, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal; Fd alias Dian, 22, penduduk Jln Sei Batu Gingging, Pasar X, Kelurahan Padang Bulan (PB) Selayang I, Kecamatan Medan Selayang; Irw alias Iwan, 27, penduduk Jln Binjai Km 15, Dusun I Aman Damai, Desa Sei Semayang, Kecamatan Sunggal, Kabupaten Deliserdang. Sementara, tersangka lainnya MDS alias Dedi, 31, penduduk Jln Binjai Km 13,6 Pasar Besar, Desa Sei Semayang, Kecamatan Sunggal, Kabupaten Deliserdang masih dalam pengejaran polisi. Untuk kasus pencurian komputer di Antiq Net,polisi menangkap AP, operator warnet pendu-

duk Jln Setiabudi, Pasar II, Gang Bunga Dewi, Kelurahan Tanjungsari, Kecamatan Medan Selayang; Dmw, 33, satpam/penjaga malam penduduk Jln Setiabudi, Pasar I, Gg Keluarga, Kelurahan Tanjungsari; AS alias Andi alias Andi Borok, 28, penarik becak penduduk Jln Setiabudi, Pasar I, Gg Pribadi V Medan; AW, 34, PNS penduduk Jln Setiabudi, Gg Keluarga, Kelurahan Tanjungsari. Tersangka lainnya dalam kasus pencurian komputer yakni Sandi, 16, penduduk Jln Setiabudi, Gg Sejahtera, Kelurahan Tanjungsari dan Erwin, 16, penduduk Jln Setiabudi belum tertangkap. Terakhir, petugas Polsekta Sunggal menangkap tersangka Swt, 45, warga Jln Lembaga Pemasyarakatan, Tanjunggusta Medan yang diduga terlibat kasus pencurian beberapa karung beras. Sonny menjelaskan, beberapa di antara tersangka yang ditangkap tersebut ternyata sudah masuk dalam Daftar Pencarian Orang (DPO) Poldasu, Polresta Medan, Polsekta Medan Baru dan Polres Binjai. Polisi menyita barang bukti, 16 sepedamotor, 2 mobil, becak dayung, 4 kunci T, 2 kipas angin, 50 gram perhiasan emas, 3 televisi, alat hisap sabu dan lainnya. “Guna mengungkap sindikat pencurian sepedamotor ini, Polsekta Sunggal akan bekerjasama dengan Polda Aceh. Sebab banyak sepedamotor hasil curian yang dijual di Aceh,” demikian Sonny. (m36)

Peserta SNMPTN ...

mendasikan. Siswa pelamar yang telah didaftarkan oleh kepala sekolah membayar uang pendaftaran ke Bank Mandiri dengan menunjukkan nomor pendaftaran. Biaya pendaftaran sebesar Rp175.000. “Bagi siswa pelamar yang memenuhi persyaratan program Bidik Misi 2011 tidak perlu membayar biaya pendaftaran, sehingga siswa tersebut dapat langsung login untuk melakukan pendaftaran Jalur Undangan secara online,” ujarnya. Siswa pelamar dengan menggunakan nomor pendaftaran dan password mengisi biodata, pilihan PTN dan program studi, mengunggah (upload) foto resmi terbaru dan mencetak Kartu Bukti Pendaftaran, melalui laman SNMPTN http:/ /undangan.snmptn.ac.id. Mengenai program studi dan jumlah pilihan, dijelaskannya, setiap siswa pelamar dapat memilih sebanyak-banyaknya dua PTN yang diminati dan dapat memilih tiga program studi yang diinginkan serta disesuaikan dengan urutan pilihan. Program Bidik Misi Menyinggung program Bidik Misi, Prof. Zulkifli menyebutkan, pada tahun 2011, program Bidik Misi (Beasiswa Pendidikan Miskin Berprestasi) bagi siswa SMA/SMK/MA/MAK, diintegrasikan ke dalam pola seleksi SNMPTN melalui Jalur Undangan. Siswa yang akan mendapatkan program Bidik Misi adalah memiliki potensi akademik memadai dan kurang mampu secara ekonomi dan masuk dalam 25 persen terbaik di kelas mulai semester 1-5, selanjutnya mendapatkan rekomendasi dari kepala sekolah. (m41)

pencurian sepedamotor yang ditangkap Polsekta Sunggal. Dalam aksi pencurian sepedamotor tersebut, O mengatur penjualan hasil kejahatan tersebut ke wilayah Aceh. Usai melakukan pencurian sepedamotor, para tersangka menghubungi O untuk mengatur penjualannya. Kemudian, O memerintahkan tersangka JS mengantarkan sepedamotor curian itu ke Aceh dengan imbalan Rp500 ribu per unit. “Di Aceh sudah ada yang menampung sepedamotor curian tersebut,” kata Sonny didampingi Kanit Reskrim AKP Widi Sertiawan,SH; Kanit Binmas/Pjs Waka Polsekta AKP RE Samosir,SH; Kanit Sabhara AKP P Bangun,SH dan Kasi Humas Aiptu B Efendi Sirait, SH. Dari hasil pemeriksaan polisi, lanjut Sonny, tersangka JS mengaku sudah dua kali membawa sepedamotor hasil kejahatan ke Aceh. “Kita baru menangkap dua kelompok pelaku curanmor yang berjumlah delapan orang. Sedangkan kelompok lainnya masih dalam pengejaran,” tambahnya. Sonny mensinyalir, aksi pencurian sepedamotor yang terjadi di Medan, Deliserdang dan Binjai dilakukan oleh kelompok yang sama dengan jumlah pelaku delapan orang. “Mereka sudah ditangkap petugas Polsekta Sunggal dan kasusnya masih dalam pengembangan,” ujarnya. Para tersangka pencurian sepedamotor yang ditangkap di antaranya Iw alias Irwan alias Iwan alias Zidan, 28, karyawan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Mh3+. 2. Rf2, Ge3+. 3. Re1, MxGf1+mat.

Jawaban TTS: TTS Topik

R E F I L K A M A N I T U N O F R O P R M H A S I

Infokom (Muat Ulang)

E R E N S I E N N T E K U S P T I F A T R P D A E S E R T O U O O F S T T R D W A R E A L R E P O

P K N O L O L M U U L I N I I F I K O A R S M I U L I P I T R E T

S A G I D T I N A T E R N E U T

Jawaban Sudoku: 2 5 7 9 8 1 6 0 3 4

1 8 2 6 7 0 3 4 9 5

9 7 8 0 4 3 5 1 6 2

0 4 3 5 2 6 7 9 8 1

3 6 4 1 9 5 8 2 0 7

4 1 5 2 0 8 9 3 7 6

8 9 6 3 5 4 1 7 2 0

5 0 9 4 6 7 2 8 1 3

6 2 1 7 3 9 0 5 4 8

7 3 0 8 1 2 4 6 5 9

Bisru Hafi menyebutkan, dengan berlakunya Kepmendiknas No.34 tahun 2010 ini, peraturan dan syarat untuk mengikuti jalur undangan inipun sebagian besar berubah. Bahkan, lanjutnya kepala sekolah harus proaktif untuk mengajukan siswanya mengikuti jalur undangan terebut, karena panitia pusat maupun lokal tidak mengirimkan undangan secara tertulis yang dikirimkan langsung ke alamat masing-masing sekolah. Mengenai tata cara pendaftaran jalur undangan, kepala sekolah terlebih dahulu membuka laman website SNMPTN 2011 http://snmptn.ac.id, kemudian membaca dan memahami seluruh ketentuan dan prosedur SNMPTN Jalur Undangan yang termuat dalam laman website tersebut, terutama yang berkaitan dengan persyaratan dan daya tampung program studi di masing-masing PTN. Selanjutnya, kepala sekolah secara proaktif mendaftarkan profil sekolahnya melalui laman SNMPTN http://undangan. snmptn.ac.id untuk mendapatkan user name dan password serta jumlah siswa yang dapat diusulkan mengikuti SNMPTN Jalur Undangan. Setelah itu, kepala sekolah mengisi data prestasi akademik siswa dengan menggunakan user name dan password secara online melalui laman SNMPTN http://undangan.snmptn.ac.id. Kemudian kepala sekolah memberikan nomor pendaftaran dan password yang didapatkan dari sistem kepada siswa pelamar yang direko-

kata Ketua Umum PB Al Jam’iyatul Washliyah Prof. Dr. H. Muslim Nasution, MA dalam Resepsi HUT Ke-80 Al Washliyah dan saat membuka Muswil XI Al Washliyah di Asrama Haji Medan, Jumat (28/1) malam, Muswil berlangsung hingga Minggu (29/1). Dalam sambutan tersebut, Muslim juga mengakui dan menyadari kualitas pen-

Rusuh Di Mesir, ... Sampai saat ini, tujuh orang diberitakan tewas, terdiri lima pemrotes dan dua polisi, lebih 100 orang cedera. Seorang pejabat keamanan mengatakan kepada AFP sekitar 1.000 orang ditahan sejak protes itu dimulai. (m10)

Lebih Dulu Asahan ... kembali jelas (defenitif). Dr. Edwarsyah Syamsura sebagai Walikota pertama (Lembaran Negara No. 1091). Selanjutnya berdasarkan UU Darurat No. 9 Tahun 1956, lembaran negara No. 60 Tahun 1956 sebutan Haminte Tanjungbalai diganti dengan ‘Kota kecil Tanjungbalai’. Setahunkemudian,pada1957 UU No. 1 Tahun 1957, sebutan Kota Kecil diganti dengan Kota Praja Tanjungbalai. Bersamaan dengan itu, Badan Perwakilan Rakyat Tanjungbalai menjadi DewanPerwakilanRakyatDaerah peralihan Kota Praja Tanjungbalai dengan jumlah anggota 10 orang dari hasil Pemilu 1955. Sejarah Sejarawan sekaligus Mantan Ketua Pansus Hari Jadi Tanjungbalai, Drs H Arifin menjelaskan, hasil penelusurannya ke Aceh untuk mengungkap sejarah Tanjungbalai. Awal mulanya, Tanjungbalai lahir ketika orang pertama membuka perkampungan di tepi sungai Barumun dan keturunannya menjadi raja yang memerintah di wilayah Kota Pinang, Labuhanbatu, yaitu Batara Sinombah, putra Raja Pagaruyung, Sultan Alamsyah Syaifuddin. Pada abad ke XV, Batara Sinombah dan dua saudaranya, Batara Payung dan Putri Langgani dan seekor anjing Cempaka Putih, meninggalkan negeri Pagaruyung karena melanggar aturan adat. Batara Payung tinggal dan mendirikan kerajaan di Mandailing dan keturunannya menjadi cikal bakal raja-raja di sana. Batara Sinombah dan adik tirinya ke utara, dan sampai di Hutang Momo (Hutang Mumuk) di kawasan Kotapinang. Mereka berdua menikah, dan dikaruniai anak. Salah satu putra Batara Sinombah, yaitu Sutan Musa menjadi raja di Kampung Raja (sekarang Kampung Rakyat Kab. Asahan). Dia mempunyai 3 putra, Tengku Raja Tahir, raja di Bilah dan Sutan Segar Alam. Sibungsu, Syahrir Alamsyah gelar Maharaja Awan berkekuasa di Air Merah, Pinang Awan dan keturunannya menjadi Raja Sultan Kota Pinang. Syahrir Alamsyah dikaruniai anak dari istri pertama, yaitu Siti Ungu (Siti Unai), dan Tengku Husin serta Tengku Abas. Sementara dari istri kedua lahir

seorang putra dan ibunya sangat berharap dia menjadi pewaris kerajaan. Putra istri kedua menyebarkan fitnah yang meyakinkan raja sehingga Tengku Husin dan Abas diusir dari kerajaan dan berlayar ke Aceh. Lama di sana, Husin dan Abas rindu kampung halaman, makanya mereka kembali ke Air Merah Pinang Awan dengan pengawalan tentara Aceh. Begitu memasuki kampung halaman, kedua putra mahkota itu dihadang tentara kerajaan Air Merah, sehingga terjadi pertempuran yang berujung tewasnya sang raja yang tak lain saudara tiri mereka. Tentara Aceh, menangkap Siti Ungu dan dibawa dijadikan istri Sultan Aceh. Begitu pemerintahan Air Merah pulih, Husin dan Abas menyusul Siti Ungu ke Aceh. Di tengah perjalanan, mereka singgah di Negeri Asahan dan meminta seorang ahli bahasa dan perdukunan, Bayak Lingga, ke Aceh. Di Aceh, Husin, Abas dan Bayak Lingga membantu Sultan Aceh memenangkan sabung ayam. Sultan pun bersedia memberikan Siti Ungu untuk dibawa pulang ke kampung halamannya. Hanya saja Sultan berpesan, Siti Ungu tidak boleh nikahi sampai melahirkan. Apabila anak Sultan dari Siti Ungu lahir, maka harus dinobatkan sebagai Raja di Asahan. Beberapa bulan kemudian, Siti Ungu melahirkan seorang putra bernama Abdul Jalil. Akan tetapi, setelah Abdul Jalil dewasa, dia tak diangkat menjadi raja. Sultan Aceh pun murka, dan menjemput anaknya yang diasingkan di Batubara. Mereka kemudian menuju pusat pemerintahan raja di Gunung Bayu (kini Pulo Raja). Rombongan sultan disambut dengan kebesaran, bukan perlawanan. Seluruh pembesar kerajaan dan rakyat disuruh berkumpul seraya mengangkat sembah kepada Sultan Aceh. Tempat itu kemudian dikenal sebagai Marjanji Aceh Desa Aeksongsongan, Kec. Bandarpulao, Kab. Asahan. Setelah acara di Marjanji Aceh, rombongan kemudian menuju hilir sungai Asahan, dan berhenti di sebuah Tanjung di sekitar pertemuan antara sungai Silau dan Asahan. Sultan memerintahkan agar tempat itu dibangun balai-balai, dan

KPK Selkan Panda ... Soekarno-Hatta, Tangerang, Jumat (28/1) pagi. Hal itu dikatakan Panda saat akan meninggalkan Gedung KPK, Kuningan, Jakarta Selatan, Jumat malam menuju Rumah Tahanan Salemba. “Saya dijemput di Bandara Soekarno-Hatta, tapi bukan penjemputan paksa karena saya menggunakan mobil saya sendiri,” kata anggota Komisi III DPR asal Fraksi Partai Demokrasi Indonesia Perjuangan ini kepada wartawan. Panda dijemput penyidik saat akan terbang menuju Ba-

Lima Lagi Menyusul ... Empat orang dinyatakan sakit di antaranya, Hengki Baramuli, Bobi Suhardiman, Willem Tutuarima dan Rusman Lumban Toruan. Sedangkan salah satu tersangka, Budiningsih, sedang dalam perjalanan ke Solo. “Lima orang yang tidak datang ini empatnya sakit, sementara satunya Ibu Budiningsih ke luar kota ke Solo. Kami akan melakukan upaya penyelidikan yang sama bagi yang sakit pekan depan,” kata Juru Bicara KPK, Johan Budi saat jumpa pers di

Feri Terbakar ... Api Dari Dek Kendaraan Kementerian Perhubungan (Kemenhub) mengumumkan sumber api yang diduga penyebab terbakarnya KMP Roro Laut Teduh II di dekat Pulau Tempurung, Selat Sunda, pukul 03.59, berasal dari dek kendaraan di lantai bawah. “Api dilaporkan berasal dari dek bawah tempat kendaraan karena penumpang di dek atas,” kata Kepala Pusat Komunikasi Publik, Kementerian Perhubungan, Bambang S Ervan, menjawab pers di Jakar-

WASPADA Sabtu 29 Januari 2011

KPK, Jumat (28/01). Rencananya, KPK akan menelusuri di rumah sakit keempat orang yang dirawat. Agar diketahui kebenaran tersangka memang mengalami sakit. “ Bagi yang sakit, kalau memang serius sakit,akan kami lakukan penanganan untuk penyelidikan. Kami akan melakukan pembantaran kalau tidak benar,” tegas Johan. Kelima tersangka juga akan menghadapi penahanan yang sama setelah mengikuti pemeriksaan olah penyidik, seperti dengan 17tersangka yang sudah ditahan Jumat. (k/m09)

19 Ditahan 19 Tersangka kasus dugaan suap dalam pemilihan Dewan Gubernur Senior BI Miranda Goeltom, yang menjalani pemeriksaan sejak Jumat (28/1) pagi, akhirnya sekitar pukul 17.30 resmi ditahan oleh Komisi Pemberantasan Korupsi (KPK). Mereka meninggalkan Gedung KPK di Kuningan, Jakarta Selatan menuju tahanan dengan menumpang mobil yang berbeda. Menurut informasi salah seorang pengacara para tersangka dari politisi PDI Perjuangan, Robert Keytimu, keenam belas tersangka resmi ditahan di rumah tahanan yang berbeda. “Para tersangka ditahan dibeberapa rutan. Termasuk juga dari anggota kami, dari PDI Perjuangan. Mereka ditahan kurang lebih 20 hari, sampai dipanggil untuk pemeriksaan lebih lanjut,” kata Robert. Para tersangka dibawa dengan mobil yang berbeda dan mendapatkan pengawalan para petugas KPK. Ni Luh dan Angelina dibawa dengan menumpang mobil Avanza warna hitam dengan nopol B 1901 USR. “Ini hanya pengalihan isu dari kasus Century dan Gayus, hanya pencitraan,” ujar Angelina sebelum memasuki mobil yang membawanya ke Rutan Pondok Bambu. (k/j02/m09)

ta, Jumat (28/1). Menurut Bambang, kapal milik PT Bangun Putra Remaja tersebut berangkat dari dermaga satu Merak pada pukul 03.19 WIB dengan membawa penumpang sebanyak 567 orang, terdiri 535 orang dan Anak Buah Kapal (ABK) 32 orang. Saat ditanya apakah di dek tersebut, sumber api diduga dari sebuah puntung rokok, Bambang tidak bersedia mengkonfirmasikan hal itu. “Itu sudah masuk ke substansi penyelidikan oleh KNKT (Komite Nasional Keselamatan

Transportasi). Saya tidak berwenang menyampaikan karena hal itu terkait dengan penyebab kebakaran sebenarnya dan kini masih diinvestigasi,” katanya. Yang jelas, tambanya, total kendaraan yang diangkut sebanyak 93 unit. “Saat ini semuat penumpang dan awak kapal sudah dievakuasi dan kapal telah dikandaskan di perairan Anyer Cigading,” katanya. Korban meninggal dan luka, tambah Bambang, telah dibawa ke rumah sakit Krakatau Steel dan Rumah Sakit Panggung Rawi.

tam guna menghadiri Rakornas PDI-P. Menurut dia, dirinya sudah mengajukan izin penundaan pemeriksaan karena harus menghadiri acara tersebut. Setelah menjalani pemeriksaan sejak sekitar pukul 12.00, Panda dibawa ke Rutan Salemba, Jakarta Pusat, dengan mobil tahanan KPK bernomor polisi B 8593 WU. Ketua Departemen Hukum DPP PDI-P Gayus Lumbuun mengatakan, tidak ada urgensinya penjemputan oleh KPK terhadap Panda. “Ini tindakan penegakan hukum kasar untuk pencitraan KPK semata,” kata Gayus.

Imam Syafi’i ... Ibunya membawa Muhammad bin Idris ke kota Asqalan, beberapa bulan kemudian hijrah lagi ke kota suci Mekkah untuk belajar AlQuran dan hadits. Sejak berusia tujuh tahun, Syafi’i sudah mampu menghafal seluruh AlQuran, dan usia sepuluh tahun sudah menghafal kitab al-Muaththa’ (kitab hadits dan fiqh) karya Imam Maliki. Kecerdasan Imam Syafi’i mendapat pujian dari gurunya Imam Malik. “Saya belum menemukan seorang murid pun secerdas Muhammad bin Idris,” akunya. Dari Mekkah, Syafi’i menuju Madinah berguru kepada Imam Maliki yang sangat dikaguminya. Pada usia 20 tahun, Imam Syafi’i meninggalkan Haramain (Mekkah-Madinah) menuju Iraq untuk menuntut ilmu pada ulamaulama besar murid dari almarhum Imam Abu Hanifah yang masih ada. Sebagai pengembara yang haus ilmu beliau juga pergi ke Persia, Khurasan dan beberapa negeri lain. Di Yaistana tempat menghadap. Di sanalah Abdul Jalil ditabalkan menjadi Sultan Negeri Asahan. Anjungan balai tempat penabalan Abdul Jalil itu selanjutnya dijadikan tempat pengawalan serta pengutipan upeti. Akhirnya, balai di ujung tanjung itu menjadi pusat keramaian, dan muncullah kata ‘ Tanjungbalai.’ Kendati ditabalkan menjadi Sultan pertama di Tanjungbalai, namun menurut Arifin, Abdul Jalil mendirikan dan tinggal di Istana Kerajaan di Tangkahan Sitarak Pulu Raja. Malah, kata Arifin, ketika mangkat, Abdul Jalil dimakamkan di sekitar istananya tersebut. “ Makam Abdul Jalil dan ibunya Siti Ungu diTangkahan Sitarak Pulu Raja,” jelas Arifin. Hanya saja, menurut Ketua Forum Komunikasi Antar Lembaga Adat Tanjungbalai itu, keturunan Raja Simargolang kurang menyukai Abdul Jalil, sebab dianggap merebut kekuasaan kerajaan mereka. “ Simargolang anti dengan Abdul Jalil, karena dianggap merebut kekuasaan nenek moyangnya. Sejak dulu makam Abdul Jalil dikeramatkan orang, walaupun sebagian tidak mengetahui siapa Abdul Jalil itu,” jelas Arifin. “ Sultan Iskandar Muda merupakan pendiri Tanjungbalai, dan wafat pada 27 Desember 1636. Sementara anaknya, Sultan Abdul Jalil, ditabalkan menjadi Sultan pertama di Tanjungbalai pada 1620. Setelah dilakukan kajian dan penelusuran mendalam, maka ditetapkanlah hari jadi Tanjungbalai 27 Desember 1620,” jelas Arifin. Pendapat Arifin itu, bertolak belakang dengan sejarawan Asahan, Zasnis Sulung. Penetapan hari jadi Tanjungbalai itu, menurut Zasnis, perlu dikaji ulang karena belum mampu dipertanggungjawabkan. Menurut Zasnis, berdasarkan majalah Deli Gids 1938, ayah Abdul Jalil bukan Sultan Iskandar Muda, melainkan Sultan Aceh Al Qahar. Sultan itu memerangi Raja Margolang dan kroni karena mengusir Abdul Jalil dari Istana Tangkahan Sitarak Pulo Raja. Setelah memenangkan peperangan, Sultan membawa anaknya dan Raja Simargolang serta raja lainnya ke hilir sungai Asahan dan berlabuh di sebuah tanjung (pertemuan sungai Asahan dan Silau). Di sanalah Abdul Jalil ditabalkan menja-

man beliau mengajar Fiqh sebelum Khalifah Harun Ar-Rasyid memintanya untuk menetap di Baghdad. Filsafah hidup beliau harus seperti air yang mengalir, beliau kembali ke Mekkah, kemudian ke Madinah, dan terakhir memilih Mesir untuk tempat pengembaraan terakhir. Di Mesir beliau mengajar dalam Masjid Raya Amru bin Ash. Di negeri sungai Niel itu beliau menulis sejumlah kitab termasuk kitab “Al-Uum” induk segala kitab dalam mazhab Syafi’i. Imam Syafi’i wafat di Mesir tahun 204 H, dalam usia 54 tahun. Makamnya sampai sekarang masih diziarahi jutaan umat Islam. Ketika saya berziarah ke sana, 28 September 2009 saya melihat manusia seperti di pasar keramaian. Mazhab Syafi’i termasuk mazhab sunni (ahlussunnah wal jamamaah) yang paling banyak pengikutnya di dunia, termasuk Indonesia, Malaysia, Brunei, Thailand Selatan, Filipina Selatan, sebagian India, Mesir, Yordania, Iraq, dan lain-lain.

di Sultan Asahan I. “ Jadi 1568 itulah diduga hari lahirnya Tanjungbalai. Menurut situs Blogger Asahan Community, awal Kesultanan Asahan itu abad ke XVI (1500-an) bukan abad ke XVII ((1600-an),” ujar Zasnis. Menurut sejarawan, Drs H Arifin, Asahan sudah ada sebelum Tanjungbalai lahir. Ketua Forum Komunikasi Antar Lembaga Adat itu, memperkirakan Asahan lahir pada abad ke XVI, danTanjungbalai pada abad XVII (1620). Jika kata ‘Tanjungbalai’ berasal dari balai yang dibangun di ujung tanjung antara sungai Asahan dan Silau, namun kata ‘Asahan’ sampai kini belum diketahui asal usulnya. Pernyataan Arifin tentang Asahan lebih dahulu lahir daripada Tanjungbalai didukung oleh buku Tabal Mahkota Negeri Asahan yang disusun M Arsjad 1933. Di buku itu disebutkan, ketika Sultan Aceh tiba di hulu sungai Asahan, dia mencari keberadaan raja di wilayah itu. Berkat bantuan bangsa Karo-karo bernama Bayak Lingga, Sultan pun bertemu dengan penguasa Asahan, yakni Raja Simargolang yang beristana di Tangkahan Sitarak. Bayak Lingga kemudian diperintahkan Sultan tinggal di hulu sungai, dan Raja Simargolang hanya menurut supaya kekuasaannya tidak

terganggu. Bukti lainnya, di buku itu disebutkan, ketikaTengku Husin dan Abas hendak menyusul Siti Ungu ke Aceh, mereka singgah di Asahan untuk menemui dan membawa Bayak Lingga. Sementara saat itu, Abdul Jalil yang merupakan cikal bakal lahirnya Tanjungbalai, masih dalam kandungan. Diterangkan juga, Sultan Aceh berpesan ketika Husin dan Abas hendak membawa Siti Ungu pulang ke kampung halaman. Siti Ungu tidak boleh dinikahi sampai melahirkan. Apabila anak Sultan dari Siti Ungu lahir, maka harus dinobatkan sebagai Raja di Asahan. “Sebelum kamu sampai ke Asahan, hendaklah kamu dahulu singgah ke Pasai mengambil anak Sakmadiraja laki-laki yang keturunannya dari kampung Sungai Tarap Minangkabau, supaya dia boleh memangku anakku kelak menjadi Raja di negeri Asahan,” pesan Sultan kepada Abbas dan Husin seperti yang tertulis di buku Tabal Mahkota Negeri Asahan. “Sebelum Abdul Jalil ditabalkan menjadi Sultan, kata ‘Asahan’ itu sudah ada tapi kita tidak tahu asal usul kata itu. Ya tugasnya orang Asahan untuk menelusurinya,” ujar Arifin. Rahmad F Siregar/Rasudin Sihotang

Medan Metropolitan

WASPADA Sabtu 29 Januari 2011

A3

Rahudman Tunda Rombak Pejabat MEDAN (Waspada): Rencana pelantikan sejumlah pejabat di jajaran Pemerintah Kota Medan ditunda tanpa alasan yang jelas. Sebelumnya, Walikota Medan Rahudman Harahap berjanji pada akhir Januari akan melantik beberapa pejabat eselon II dan III untuk menunjang visi dan misinya pembangunan kota ini. Rahudman Harahap ketika diwawancarai Waspada di Balai Kota Medan mengatakan, rencana mutasi terhadap sejumlah Satuan Kerja Perangkat Daerah (SKPD) masih ditunda karena masih dalam penggodokan. Namun, mantan Sekda Tapsel ini tidak menjelaskan secara rinci apa penyebab tertundanya perombakan sejumlah pejabat tersebut. “Masih tertunda,namun dalam waktu dekat ini kita akan melakukan perombakan agar mutasi di jajaran Pemko tidak bisa tergesa-gesa. Kalau untuk eselon III mungkin bisa diputuskan di tingkat Baperjakat Kota Medan, namun kalau untuk eselon II harus melalui Baperjakat Provinsi,” kata Rahudman. Ketika ditanya berapa orang eselon II maupun III yang akan digeser, Rahudman tidak menjawabnya. Orang nomor 1 di Medan ini mengatakan, para wartawan tenang saja, nanti pada akhirnya pasti tahu sendiri siapa-siapa yang dimutasi. Yang jelas pejabat yang diganti karena mendapat rapor merah. “Tunggu saja tanggal mainnya. Nanti para wartawan tahu sendiri siapa-siapa kita geser. Menempatkan seseorang SKPD harus sesuai dengan program Pemko maupun visi dan misi Rahudman-Eldin dalam membangun kota ini,” ucapnya. Ditegaskan Rahudman, perombakan sejum-

Waspada/Surya Efendi

KOIN UNTUK PRESIDEN: Sejumlah mahasiswa dari berbagai elemen di Medan menggelar aksi keprihatinan dengan mengumpulkan sumbangan uang koin dalam aksi door to door ke ruang fraksi-farksi di gedung DPRDSU, Jumat (28/1). Aksi Koin Untuk Presiden sebagai bentuk keprihatinan masyarakat akan rencana kenaikan gaji Presiden dan aparatur negara lainnya di tengah kondisi ekonomi Indonesia belum stabil.

Kasihan, Warga Mengungsi Lagi MEDAN (Waspada): Warga Kampung Aur Kelurahan Aur dan warga Sei Mati di sekitar bantaran Sungai Deli terpaksa mengungsi ke mushalla dan ke rumah-rumah tetangga setelah air Sungai Deli meluap dengan ketinggian 1-2 meter menggenangi pemukiman penduduk, Jumat (28/1) sekitar pukul 01.00 Wib dini hari. Diana, salah seorang warga Kampung Aur, mengatakan arus air begitu deras naik kepermukaan rumah penduduk ketika hari mulai menjelang tengah malam.“Ketika saya lihat ketinggian air yang timbul ke permukaan masih sejengkal tetapi memasuki dini hari arus air terlihat begitu kencang,” ujarnya. Pantauan Waspada, kemarin, beberapa warga yang tinggal

berdekatan dengan bantaran sungai sibuk membersihkan lantai rumah dan halamannya yang dipenuhi lumpur akibat genangan air dari sungai yang meluap. “AiryangmengalirdariSungai Deli sangat deras dan bergelombang. Tanda-tanda air Sungai Deli bakal meluap sudah ada sejak pukul 12.00 dini hari ketika airsungaiyangmeluaptelahtum-

pah ke rumah-rumah penduduk,” ujar salah seorang warga. Sementara, Kepling IV Kelurahan Aur Yahdi Sabil mengatakan, air mulai surut ketika hari menjelang pagi sekitar pukul 05.00. “Memang kasihan warga yang belum lama direndam banjir, sudah terkena lagi dengan ketinggian air sempat mencapai 1 meter lebih ketika pukul 12.00 tengah malam. Sebagian warga ada yang sempat mengungsi dan melihat air sudah surut, kembali ke rumah untuk membersihkan lumpur. Air mulai surut ketika hari menjelang Subuh (28/1),” jelasnya. Warga setempat, lanjutnya, pada pukul 08.00 bergotongroyong membersihkan lumpurlumpur yang masih tersisa di

permukaan rumah warga korban banjir tersebut. Tetapi mengingat curah hujan masih tinggi, warga sudah siap mengungsi ke loteng dan tempat yang tinggi. “Kami sudah siap mengungsi lagi karena melihat curah hujan masih tinggi di hulu. Begitu pun kami beruntung punya mesin pompa air yang bisa membersihkan lumpur itu untuk mengatasi pasca banjir,” katanya. Sementara rumah warga di Gg Merdeka dan Gg Bidan Kelurahan Sei Mati juga terendam akibat air sungai yang meluap. “Kebanyakan yang tinggal di dekat bantaran sungai yang terendam. Lingkungan yang paling rentan terendam adalah lingkunganVII, VIII, IX, X, ,” jelas

Ahmad Auni Sekretaris Kelurahan Sei Mati. Lurah Sei Mati Ahmaddin Harahap ketika dihubungi Waspada mengatakan, salah satu penyebab terjadinya banjir adalah tingginya curah hujan di hulu. “Warga sempat mengevakusi barang-barangnya dan mengungsi ke dataran yang lebih tinggi saat itu. Sebab air telah menggenangi rumah penduduk mencapai satu meter lebih sekitar pukul 01.00 dini hari. Mengingat cuaca buruk saat ini kami dari pihak kelurahan tetap berjaga-jaga,” ujarnya seraya menambahkan dapur umum belum diperlukan sebab banjir tidak separah yang terjadi beberapa waktu lalu. (cba)

Keunikan Etnis Tionghoa Di Medan Saat Imlek ADA keunikan pada etnis Tionghoa menjelang Imlek. Mereka justru berkumpul dengan keluarga ketimbang pergi berlibur ke luar negeri. Ramai-ramai bepergian ke luar baru dilakukan etnis Tionghoa di Medan pada perayaan Natal dan Tahun Baru. Memang pada Imlek, terjadi booking seat pesawat pada rute Medan tujuan luar negeri, seperti ke Kuala Lumpur dan Singapura, tetapi tidak signifikan meski Imlek merupakan tahun baru mereka. Rahmad Iskandardinata, staf penerbangan Malaysia Airlines System (MAS) di Bandara Polonia mengatakan, melalui masakapai penerbangan asal Malaysia itu hingga, kemarin, penumpang yang

booking seat menjelang Imlek masih stabil. Bahkan Idul Adheman, kepala unit Tempat Pemeriksaan Imigrasi (TPI) Bandara Polonia menegaskan, Kamis (27/1), mengacu pengalaman tahuntahun sebelumnya, memang saat Imlek tidak terlalu padat penumpang ke luar negeri bahkan stabil, sebab orang-orang Tionghoa dari Medan lebih banyak berlibur saat Lebaran, Natal/Tahun Baru. Bahkan pada momen tersebut, mereka ramai-ramai meninggalkan tanah air berangkat ke luar negeri bersama keluarga yang membuat penerbangan menjadi padat. Bahkan data penumpang tujuan luar negeri tercatat pada Lebaran, Natal/Tahun Baru

rata-rata 3.000 hingga 3.100 penumpang/hari, diangkut 17 penerbangan dari pagi hingga malam. Berbeda Suasana Imlek jauh beda dengan suasana Cheng Beng. Cheng Beng biasanya lebih ramai bahkan lebih meriah dibanding Imlek, kata tokoh masyarakat Tionghoa saat dikonfirmasi, Jumat (21/1), di Bandara Polonia. Imlek yang jatuh pada 30 atau Sa Cap Me kalender China dan 3 Februari 2011, biasanya orang-orang Tionghoa hanya memeriahkan acara makanmakan bersama keluarga di rumah masing-masing. “Kebiasaa kami pada acara puncak Imlek melakukan

sembahyang di rumah pakcik di Medan, dia paling tua dari keluarga kami,” kata Anhar, salah seorang tokoh masyarakat Tionghoa. “Imlek pada intinya kumpul bersama keluarga di rumah untuk makan dan sebaiknya makanan yang dimasak sendiri di rumah,” ujarnya. Namun karena budaya sudah banyak berubah dan orangorang lebih senang membeli makanan yang siap saji, banyak juga yang pergi makan-makan ke restoran dan sebagian orang Tionghoa melancong ke luar negeri. Namun kalau pun ada sebagian melancong ke negara tetangga sifatnya hanya sementara sebab waktu liburan Imlek terbatas, kata Anhar.

Dia tidak membantah suasana Imlek di Hongkong dan negeri China benar-benar meriah karena jutaan orang China dari berbagai negara mudik melihat sanak saudara yang sudah lama mereka tinggalkan. “Kalau Cheng Beng bahkan lebih meriah lagi para pemudik Tionghoa dari berbagai penjuru dunia dan berkumpul bersama keluarga mereka,” ujarnya. Kenapa, kata Anhar, kalau suasana Cheng Beng atau ziarah kuburan, di mana pun kita tinggal harus datang dan berkewajiban mengunjungi orang tua dan ziarah kuburan para leluhurnya. * Abdullah Dadeh

lah pejabat di Pemko tidak ada intervensi maupun hal-hal lain, namun hanya untuk melakukan penyegaran terhadap jajaran Pemko Medan. Dengan mutasi ini diharapkan para pejabat yang baru nantinya dapat mencapai program yang baik dengan bekerja sungguh-sungguh. Ketika ditanya apakah ada deal-deal tertentu untuk calon SKPD yang akan dilantik, Rahudman menjawab memang ada. Dalam pelantikan nanti, pihaknya akan membuat programprogram yang harus dikerjakan oleh SKPD yang baru dengan ditandatangani. “Pada saat pelantikan nanti para SKPD itu harus berani menandatangani apa-apa saja program yang dilaksanakannya pada saat menjabat nanti. Mereka kita minta untuk membacakan apa-apa saja konsep yang dikerjakannya nanti,” ucapnya. Pantauan di Balai Kota, kemarin, sejumlah SKPD terlihat kasak-kusuk masuk ke ruangan Sekda Kota Medan. Ketika ditanya, para SKPD itu menjawab tidak ada apa-apa, dan hanya urusan tugas. Namun, SKPD tersebut dikabarkan akan mendapat jabatan baru menggantikan kepala dinas yang lama. Sementara Sekda Kota Medan Syaiful Bahri ketika dikonfirmasi mengatakan, untuk pelantikan sejumlah SKPD dalam waktu dekat akan dilaksanakan. “Pelantikan itu memang ada, tapi bukan hari ini (kemarin-red). Tunggu aja dalam waktu dekat ini,” ucapnya. Saat diwawancara berapa SKPD yang akan diganti, mantan Kepala Bappeda Kota Medan ini tidak menjawabnya. “Sabar saja adinda nanti tahu berapa orang dan siapa-siapa saja yang diganti,” ujarnya. (m50)

SPAN Kunjungi Harian Waspada MEDAN (Waspada): Sebanyak 30 Taruna Sekolah Mengengah Kejuruan (SMK) Penerbangan Angkasa Nasional (SPAN) Medan mengunjungi Bumi Warta Harian Waspada Medan, Jumat (28/1). Rombongan taruna SPAN yang merupakan sekolah SMK Penerbangan satu satunya di Medan ini, tiba di Bumi Warta Harian Waspada di bawah pimpinan Sekretaris Pelaksana Yayasan Pengembangan Pembangunan Nasional (YPPN) Komariah, SPd dan Kepala SPAN Medan Mariance Tambunan, SPd dan staf pengajar Ramli Tambunan, SPd. Komariah, SPd dalam kata pengantarnya saat berada di ruangan rapat reporter memperkenalkan SPAN yang merupakan SKM Kejuruan yang diasuh swasta dan satu satunya di Medan untuk memperkuat SMK Penerbangan Negeri yang hanya ada satu di Jakarta. SMK Penerbangan Angkasa Nasional, jelas Komariah, mempersiapkan siswa siswi untuk memiliki kemampuan di bidang penerbangan yang kini sangat dibutuhkan seiring dengan perkembangan dunia pernerbangan di tanah air dan dunia umumnya. SPAN Medan berdiri tahun 2006 beralamat di Kompleks Citra Garden Blok A-7 No 26 Jalan Letjen Jamin Ginting Padang Bulan Medan. Jurusan pendidikan yang ada di SMK Penerbangan Antariksa ini disesuaikan dengan kebutuhannnya adalah Teknik Mesin dan Teknik Kerangka Pesawat sehingga sejak SPAN berdiri banyak siswa diterima bekerja di berbagai usaha penerbangan yang ada di tanah air dan melanjutkan ke tingkat perguruan tinggi. Untuk lebih memberdayakan dan meningkatkan mutunya, SPAN Medan telah menjalin kerjasama dengan berbagai perusahaan penerbangan nasional di antara BataviaAir dan penerbangan interna-

sional AirAsia. Kepala Sekolah SPAN Mariance dan Ramli Tambunan menjelaskan tujuan dari kunjungan para tarunanya untuk menambah ilmu dan wawasan para peserta didik mengenai peran penting pers dalam masyarakat demokrasi dan cara kerja wartawan serta untuk lebih mengenal lebih dekat lagi dengan Harian Waspada Medan yang selama ini hanya mereka ketahui dari membacanya. Sementara itu, H Erwan Effendi selaku Kepala Humas Harian Waspada dalam pertemuan itu menjelaskan koran ini didirkan 11 Januari1947sebagaikoranperjuanganyangmempertahankan kemerdekaan dan mempersatukan bangsa melawan penjajah . Waspada kini berusia 64 tahun dan telah mengalami banyak peningkatan dan kemajuan terutana mutu pemberitaan dan mutu percetakan yang telah memasuki era komputerisasi mulai dari pra cetak hingga proses cetak. Sebagai Media yang mempunyai motto “Demi Kebenaran dan Keadilan” membuat koran mampu menjadi media bagi masyarakat banyak dengan pembaca mulai dari lapisan kecil masyarakat hingga cendekiawan. Para taruna dan taruni dalam pertemuan itu mempertanyakan perkembangan pers dari masa orde lama dan orba baru serta saat ini. H Erwan Effendi menjelaskan peran pers di masa saat ini sudah sangat baik dibanding masa orde lama dan orde baru yang diliputi banyak keterikatan dengan pemerintah dan berbeda dengan masa saat ini, dimana pers telah memiliki kebebasan dalam menyebarkan informasi kepada masyarakat, namun kebebasan pers saat ini harus dalam lingkup tanggung jawab dengan pengertian bebas yang betangggung jawab.(m35)

Waspada/Surya Efendi

KUNJUNGI WASPADA: Para taruna dan guru Sekolah Penerbangan Angkatan Nasional (SPAN) Medan mendengar penjelasan dari Kepala Humas Harian Waspada H Erwan Effendi (dua dari kiri) di Bumi Warta Harian Waspada Medan, Jumat (28/1).

Medan Metropolitan

A4

WASPADA Sabtu 29 Januari 2011

Muswil Al Washliyah Harus Lahirkan Pemimpin Berwatak Ulama MEDAN (Waspada): Muswil XI Al Washliyah diharapkan dapat melahirkan dan mewujudkan pemimpin yang berwatak ulama dan berkapasitas keilmuan ulama. Harapan ini dilatarbelakangi dengan kekhawatiran Rasulullah Muhammad SAW bahwa akan lahir nanti kelompok-kelompok manusia yang lari dari ulama, seperti larinya domba dari an-jing.” Jadi, kita tidak mau men-jadi orang-orang yang tanda-tanda seperti itu yang lari dari ulama,” kata Ketua Gerakan Pemuda Al Washliyah (GPA) Sumatera Utara H DTM. Abul Hasan

Maturidi (foto), di Kantor PW Al Washliyah Sumut di Jalan SM Raja, Jumat (28/1), dalam rangka Resepsi HUT Ke-80 Al Washliyah dan Muswil XI di Asra-ma Haji Medan, kemarin malam. Maturidi yang jugaWakil Ketua Komisi D DPRD Sumut menjelaskan, dengan pemimpin yang berwatak ulama, maka masih ada orang yang bisa menjelaskan Islam ini rahmatan lil alamin. Karena apa? Pada hari

Mahasiswa UMN PKL Ke LN MEDAN (Waspada): Program kerja lapangan (PKL) ke luar negeri (LN) bagi mahasiswa Program Pascasarjana (PPs) UMN sebelum penulisan tesis, banyak memberi pengalaman berharga termasuk tata cara pengisian formulir paspor. ‘’Kebanyakan mahasiswa adalah guru. Kunjungan semacam ini memberi banyak pengalaman. Dalam kesempatan ini, kita juga menjalin kerjasama dengan lembaga pendidikan di mancanegara,’’ kata Rektor Universitas Muslim Nusantara (UMN) Al Washliyah Hj Sri Sulistyawati didampingi Pembantu Rektor II Firmansyah dan Dekan Fakultas Pertanian Zulkarnaen Lubis, Rabu (26/1), di kampus Jalan Garu II. Menurut rektor, misalnya, kunjungan mahasiswa PPs UMN Al Washliyah ke Thailand dan Malaysia mengharumkan nama Indonesia di mancanegara. Sebab kehadiran mereka mendapat sambutan antusias di negara-negara yang dikunjungi. Rektor mengatakan, dalam kunjungan ke Prince of Songkla University di Pattani, Thailand Selatan, rombongan mahasiswa PPs dan dosen UMN disambut hangat oleh Vice Director of Administrative and Planning Osman Saree. Pimpinan universitas di Thailand ini juga menyebutkan tingginya minat mahasiswaThailand untuk mempelajari Bahasa Indonesia. Tak heran, mereka kekurangan dosen Bahasa Indonesia. Sementara itu, Kepala Humas UMN Zulkarnaen mengatakan, seorang mahasiswa UMN, Rido, terpilih menjadi utusan Sumatera Utara sebagai anggota kontingen program “The Ship for Stoutheast Asian Youth Program” ke Jepang. (m30)

UPDZ Perumnas Regional I Serahkan Zakat Profesi MEDAN (Waspada): Unit Pengelola Dana Zakat (UPDZ) Perumnas Regional I menyalurkan zakat profesi sebesar Rp21 juta kepada 18 mustahik di Kantor Perumnas Regional I Jalan Matahari Raya Helvetia Medan, Selasa (25/1). Pengurus UPDZ H. Suhadi menjelaskan, zakat profesi karyawan Perumnas yang disalurkan adalah zakat yang terkumpul pada semester II tahun 2010. “Mustahiq yang menerima sebanyak delapan belas orang. Mereka berasal dari lingkungan tempat tinggal yang telah disurvei sebelumnya, apakah layak menerima zakat atau tidak,” ungkapnya. Suhadi mengatakan, zakat tidak hanya disalurkan di Medan tetapi di seluruh wilayah Perumnas Regional I yang meliputi Aceh, Sumut, Sumatera Barat, Riau dan Kepri. GM Perumnas Regional I Daniel Iskandar, ST dalam sambutannya mendoakan muzakki yang memberikan zakat akan mendapatkan balasan pahala dari Allah SWT dan mustahik yang menerima mendapat manfaat dari zakat ini. “Saya berharap zakat yang akan datang akan lebih meningkat lagi,” ujarnya. Mantan Ketua UPDZ H. Bahril Datuk menyatakan kesyukurannya karena pengumpulan zakat ini masih terus berjalan dan berharap jumlah karyawan yang berzakat akan lebih meningkat lagi, sehingga jumlah yang terkumpul akan bertambah. (m05)

ini di era reformasi, eforia bangsa ini masih ter kotak-kotak dan faksi-faksi semakin besar, saling tuding dan merasa paling benar. “Harus ada jamaah. Harus ada kekuatan Islam yang netral agar bisa menjelaskan faksi-faksi ini tak perlu karena akan memecah belah bangsa ini, maka sesuai dengan sejarah lahir Al Washliyah itu, kita harapkan bisa menjadi mediasi dan tali penghubung faksi-faksi yang timbul di eforia reformasi ini,” ujar pria kelahiran 7 Agustus 1960 yang juga Ketua Forum Organisasi Kepemudaan Islam (OKI) Sumut ini. Menurut Maturidi, AlWashliyah yang mempunyai cita-cita seperti itu harus dipimpin oleh

ulama yang memiliki kapasitas kapabilitas dan kemampuan ilmu yang bisa menjelaskan bahwa Islam itu tidak perlu terpecah-pecah, agar Indonesia sejahtera. Di Indonesia harus terbangun keadilan dan kebersamaan. “Jadi, kita harapkan Muswil ini menjadi mediasi yang bening melahirkan pemimpin yang bening bisa membuat bening dunia ini dan bangsa ini,” ujarnya. Kembali ke sejarah Al Washliyah Maturidi mengajak semua pihak terutama warga Al Washliyah melihat sejarah lahir Al Jam’iyatul Washliyah pada 30 November 1930 agar mata kita terbuka bahwa pentingnya Ormas Islam ini dipimpin ulama dan orang yang berkapasitas keilmuan ulama. Masa itu ulamaulama prihatin melihat kondisi keumatan pada masa penjajah. Untuk menentang penindasan, lahir kekuatan ulama untuk menggerakkan kekuatan umat di Indonesia demi mengejar kemerdekaan. “Ketika itu Al Washliyah bangkit untuk mengusir penjajahsekaligusmencerdaskanbangsa melalui badan usaha pendi-

dikan dan dakwah. segera supaya bangsa ini terlepas dari imperialisme penjajahan,” ujarnya. Menurut Maturidi, dengan pendidikan dan dakwah, Al Washliyah melakukan gerakangerakan pencerdasan bangsa sehingga bangsa ini memahami penjajah secara keilmuan harus diusir dari muka bumi. “Penjajahan itu tidak sesuai dengan kaidah-kaidah pengetahuan yang normatif dan jauh dari keagamaan sendiri,” ujarnya seraya menambahkan AlWashliyah bangkit untuk mengusir penjajah sekaligus mencerdaskan bangsa ini dengan badan usaha pendidikan dan dakwah. Setelah bangsa ini merdeka, bangsa ini pun masih terpecah belah. Ketika terpecah belah itu, ada dua ketekuatan Islam yang di benturkan oleh penjajah yang disebut pada masa itu paham kaum tua, yakni NU dan kaum muda: Muhammadiyah. Untuk itu, lanjutnya, Al Washliyah sesuai namanya Al Jam’iyatul Washliyah yakni jamaah yang menghubungkan segalanya, baik vertikal dan horizontal menghubungkan manusia dan Khalik. Serta menghubungkan manusia dengan makhluk lainnya dan alam. (chr)

Sekolah Siap SNMPTN Melalui Online MEDAN (Waspada): Sejumlah sekolah SMA negeri dan swasta di Medan menyatakan kesiapan mengikuti pendaftaran SNMPTN jemputan secara online sejak 1 Februari mendatang. Sekolah-sekolah itu, yakni, SMAN 3 Medan, SMKN 10 Medan, SMA Swasta Eria dan SMA Swasta Dharma Pancasila. Hanya saja, SMAN 20 di Belawan memperkirakan siswanya tidak bisa mengikuti pendaftaran di 11 program pilihan di USU yang mensyaratkan peserta untuk ikut Tes Penjajakan Bidang Ilmu (TPBI) karena siswa di sana umumnya kurang mampu. Demikian disampaikan pihak sekolah kepada Waspada, Jumat (28/1), terkait akan diselenggarakannnya pendaftaran seleksi nasional masuk perguruan tinggi negeri (SNMPTN) tahun 2011 secara online jalur jemputan awal Februari mendatang. Kepala SMAN 3 Medan Sahlan Daulay melalui wakilnya Emir Harahap membenarkan jika siswa di sekolah ini telah

didata untuk mendaftar secara online. Kesiapan para siswa dan data yang dihimpun pihak sekolah terhadap siswa yang berhak mengikuti jalur itu telah dipersiapkan secara matang oleh sekolah. Demikian juga siswa di SMKN 10, seperti disampaikan Kepseknya Dahlia Purba, sejak pemberitahuan dari USU terkait pendaftaran on line ini, pihaknya telah melakukan sosialisasi dan mendata pringkat siswa yang berhak mengikuti sistem tersebut. Di tempat terpisah Kepala SMA Swasta Eria, Khoiruddin menyebutkan, telah ada beberapa siswa yang melaporkan kesiapannya untuk ikut jalur on line. Pihaknya sudah mempersiapkan berbagai data yang memudahkan siswa pada saat mengakses internet untuk melakukan pendaftaran. “Sejak mendapatkan informasi pendaftaran lewat jalur on line, para siswa sudah antusias membuka situsnya, tapi seringkali web yang dituju sukar terakses. Mudah-mudahan saat

pendaftaran nanti, situs tersebut tidak ada masalah, sehingga siswa mudah melakukan pendaftaran,” kata Khoiruddin yang terus memberikan motivasi kepada siswa agar tidak mudah menyerah dalam menentukan bakat dan kemampuan mereka dalam berbagai disiplin ilmu. Hal yang sama disampaikan Kepsek SMA Swasta Dharma Pancasila bahwa siswa di sekolah itu telah didata yang bisa ikut mendaftar. Bahkan, kata dia, ada beberapa siswa yang memastikan ikut dengan pendaftaran tes bakat yang diselenggarakan USU. SMAN 20 belum memastikan Sementara SMAN 20 di Belawan melalui Kepsek Ilyas, mengatakan para siswa di sekolah itu memang telah mempersiapkan diri untuk bisa ikut. Namun beberapa siswa yang ingin disertakan dalam 11 program pilihan di USU, karena mereka tidak mampu ikut Tes Penjajakan Bidang Ilmu (TPBI) yang mengaharuskan pesertanya membayar Rp.500.000. (m37)

Waspada/Ist

FOTO BERSAMA: Sejumlah Pimpinan Pendidikan Kader Ulama Dan Umaroh MUI Sumut berfoto bersama denganWagubsu gatot Pujonugroho, Kamis (27/1) sore, di rumah dinasWagubsu.

Wagubsu Bicarakan Krisis Ulama Dengan PKUU MUI Ikadi Harapkan Al Washliyah Cari Sosok Ulama MEDAN (Waspada): Pimpinan Pendidikan Kader Ulama Dan Umaroh atau PKUU MUI Sumut mengadakan pertemuan dengan Wagubsu Gatot Pujonugroho di Rumah Dinas Wagubsu Jalan Setia Budi Indah, Kamis (27/ 1) sore. Pertemuan tersebut diprakarsasi langsung oleh Wagubsu. Adapun yang hadir pada pertemuan tersebut, Ketua Koordinasi Pendidikan MUI Sumut Prof Dr. Ramli Abdul Wahid, Ketua Komisi Pendidikan Prof. Dr. Amroini Drajat, MA, Sekretaris Komisi Abdul Rozak M.Si serta Donator Pendidikan Dr. H. Maslim Batubara. Dalam pertemuan itu, Wagubsu menyampaikan keprihatinannya tentang kelangkaan ulama khususnya di Sumut. Untuk itu dia berharap, proses pengkaderan pendidikan ulama terus berjalan dan proses pengkaderan ini menjadi prioritas utama MUI. “Sumut mengalami kelangkaan ulama yang memahami agama dan pengetahuan-pengetahuan agama. Untuk itu, proses pengkaderan pendidikan ulama dinilai sangat penting,” katanya. Sementara itu, menanggapi hal ini, Ketua Koordinasi Pendidikan MUI Sumut Prof. Dr. Ramli Abdul Wahid mengatakan, saat ini pendidikan ulama angkatan kedua tahun kelima sedang berjalan di Kampus IAIN Sumut dengan jumlah peserta lebih kurang enam puluh orang. Dalam pertemuan itu, Ramli menjelaskan, staf pengajar dalam proses pengkaderan pendidikan keulamaan berasal dari kalangan doktor

dan profesor yang memiliki keilmuan syar’i dan mampu berbahasa kitab kuning. Dia berharap, para peserta yang sudah lulus dalam proses pengkaderan dan ingin melanjutkan ke jenjang sarjana dapat melanjutkan kuliah tidak hanya di UMSU. Basis keulamaan Di tempat terpisah, menanggapi Muswil XI Al Washliyah hari ini (29/1), Ketua Ikatan Dai Indonesia Sumut Sakhira Zandi berharap Al Washliyah mencari sosok ulama yang mampu memimpin AlWashliyah ke arah yang lebih baik lagi. “Al Washliyah ini besar karena dibesarkan oleh para ulama AlWashliyah seperti Tuan Syekh Sihabuddin, Tuan Syekh Abu Bakar Ya’kub dan lainnya,” terangnya. Untuk itu, Sakhira Zandi berharap, peserta Muswil dapat melihat jeli seorang tokoh yang mempunyai basik keulamaan atau setidaktidaknya punya misi dan misi keulamaan. “Kita berharap Al Washliyah kembali ke khittah perjuangannya, yakni pendidikan dan dakwah karena ini adalah tradisi para ulama,” jelasnya. Dia juga berharap momentum Muswil ini dapat digunakan seluruh peserta Muswil untuk mengevaluasi kerja Al Washliyah selama ini, serta membuat program kerja yang dapat mengangkat harkat dan martabat Al Washliyah lebih baik lagi. “Sehingga motto Al Washliyah zaman berzaman menjadi sebuah kenyataan, artinya bagaimanapun situasi zaman, Alwashliyah tetap eksis dan menunjukkan jati dirinya,” ungkapnya. (h02)

Minggu, Perpustakaan Tetap Buka

Waspada/ist

SERAHKAN ZAKAT: GM Perumnas Regional I Daniel Iskandar, ST didampingi Bahril Datuk memberikan zakat profesi karyawan Perumnas Regional I kepada 18 mustahik, Selasa (25/1).

MEDAN (Waspada): Ada yang baru di Perpustakaan Daerah di Jalan Sultan Ma’mun Al Rasyid, yakni pada hari Minggu di saat orang libur, perpustakaan itu ternyata tetap buka. “Karena banyak anak sekolah tidak sempat ke sini pada hari biasa. Jadi, atas masukan dari mereka kami buka hari Minggu dan ini juga program kami di tahun 2011.”Kata Eli, Jumat (28/1) di ruangannya. Menurut Kabid Pelayanan Perpustakaan dan TI Eli Suhaeriyah, hari Minggu perpustakaan tetap buka lantaran permin-

taan anak sekolah yang tidak sempat mengunjungi perpustakaan pada jam sekolah. Maka atas dasar itu pula maka Pusda tetap buka pada hari Minggu. Adapun jam bukanya pada pukul 09.00 hingga 15.00. Program itu mulai pada Januari ini dan sudah berjalan sejak seminggu yang lalu tanggal 23. Pada minggu pertama pengunjung yang datang sebanyak 15 orang. Selain itu dengan dibukanya perpustakaan pada waktu libur, menurut Eli, menjadi alternatif keluarga yang biasa menghabiskan waktu liburnya di mal.

Eva dan Elfiora mahasiswa IAIN Fakultas Syariah ini mengaku senang dan berencana akan mengunjungi Pusda pada hari Minggu. Pengunjung perpustakaan berdasarkan data Perpustakaan Daerah tahun 2010 terjadi peningkatan. Pengunjung terbagi dalam delapan golongan, yakni TK, SD, SLTP, Mahasiswa, pegawai, guru/dosen, dan umum. Dari total pengunjung itu meningkat sebesar 589.553 orang pada tahun 2010 bila dibandingkan dengan tahun 2009 berjumlah 440.804 orang. (cag)

Melihat Jejak Kelahiran NU Di Sumut NAHDLATUL Ulama adalah salah satu organisasi sosial keagamaan di Indonesia, didirikan 16 Rajab 1344 H/31 Januari 1926 di Surabaya atas prakarsa KH. Hasyim Asy’ari dan KH. Abdul Wahab Hasbullah, disingkat NU. Motif utama yang mendasari gerakan para ulama membentuk NU ialah motif keagamaan, yakni sebagai dakwah Islam dengan berlandaskan paham ahlus sunnah wal jama’ah. Selain itu, NU menganut empat mazhab dalam rangka melaksanakan amar ma’ruf dan nahi munkar serta meningkatkan ukhuwah islamiyah. Di bidang sosial, NU mengusahakan terwujudnya keadilan sosial dan keadilan hukum bagi seluruh rakyat untuk menuju kesejahteraan umat di dunia dan keselamatan di akherat. “Keberadaan NU tersebut telah diketahui oleh Syekh Mustafa Husein (Pimpinan Pesantren Mustafawiyah Purbabaru, Madina) melalui komunikasi beliau dengan banyak ulama di sana yang sama-sama alumni Mekah. Beliau juga sering mengadakan perjalanan ke Jawa untuk berdakwah di samping profesi beliau sebagai pedagang,” kata Ketua PWNU Sumut Ashari Tambunan, kemarin, terkait Harlah NU Ke-85 yang jatuh pada 31 Januari 2011.

Namun sebelumnya, lanjut Ashari, ulama-ulama di Sumatera Utara, khususnya di Tapanuli Selatan telah mempunyai perkumpulan akbar yang dinamai AII (Al-Ittihadiyah Islamiyah Indonesia), dipimpin oleh Syekh Mustafa Husein sendiri yang memiliki 62 cabang se Tapanuli. “Di sinilah jejak lahirnya NU di Sumatera Utara,” ujarnya. Kemudian, lanjutnya, hasil kesepakatan pada Tabligh Akbar AII di Madrasah Mardiyah Islamiyah Panyabungan pada tahun 1946, disepakati akan dibentuknya organisasi besar umat Islam dan ditugaskan kepada Syekh Mustafa Husein untuk merealisasikannya. Pembentukan organisasi ini adalah untuk menyebarkan paham Islam Ahlus Sunnah wal Jamaah untuk membendung gerakan Islam puritan dan menyatukan kekuatan Islam melawan penjajahan Belanda yang kembali datang ke Tanah Air setelah kemerdekaan Indonesia. “Atas restu dari Syekh Mustafa Husein diadakanlah Pertemuan Akbar ratusan ulama dan pemimpin Islam yang bermazhab Ahlus SunnahWal Jamaah dari seluruh daerah di Tapanuli seperti Mandailing, Padanglawas, Angkolasipirok, Natal dan Sibolga di Madrasah Tarbiyah Islamiyah Kampung Bukit, P. Sidimpuan pada 7-9 Februari

Waspada/Ist

PELANTIKAN: PK-III Mukhsini Moenir, menandatangani berita acara pelantikan didampingi PK-II Liza Novietta dan PK-I Dr.Tapi Rondang Ni Bulan, di hadapan Ketua STIE Harapan Medan dan Sekretaris-I Yaspendhar H.Syarifudin Alinafiah.

Ketua STIE Harapan:

Menjadi Pimpinan Tidak Mudah MEDAN (Waspada): Menjadi pimpinan dalam sebuah organisasi bukanlah hal yang mudah dan menyenangkan, apalagi sebuah organisasi perguruan tinggi yang sudah mempunyai nama cukup dikenal masyarakat. Perhatian masyarakat akan lebih terfokus terhadap segala kegiatan yang sedang dan yang akan dilakukan STIE Harapan. Hal tersebut disampaikan Ketua STIE Harapan H. Kersna Minan, SE.M.Si.Ak dalam acara pelantikan pembantu ketua (PK-STIE Harapan) di kampus Yaspendhar Jalan Imam Bonjol Medan, Senin (24/1). Kersna Minan menyebutkan, peningkatan mutu lulusan dan organisasi institusi yang sehat merupakan sasaran yang akan dicapai dalam periode kepemimpinan mendatang. Strategi yang akan dilakukan adalah restrukturisasi organiasai dengan pelimpahan wewenang yang cukup, fungsi dan tugas serta tanggung jawab yang jelas serta reposis pelaksanaan tugas.

“Penempatan petugas yang tepat dan sesuai dengan kemampuannya merupakan faktor pendukung keberhasilan pelaksanaan fungsi organisasi STIE Harapan,” ujar Kersna. Unsur pimpinan yang dilantik adalah Pembantu Ketua-I (PK-I) Dr.Tapi Rondang Ni Bulan, SE, M.Si., Pembantu Ketua-II (PK-II) Liza Nivietta, SE, M.Si, Ak, Pembantu Ketua-III, (PKIII) Mukhsini Moenir, BA, SH, MH. Sementara Pengurus HarianYaspendhar dalam sambutan yang disampaikan Sekretaris I Drs H Syarifuddin Alinafiah berharap, agar unsur pimpinan dapat bekerja sama dengan baik secara internal dan eksternal khususnya kepada pihak Badan Penyelenggara Perguruan Tinggi (Yayasan) agar dapat tercapainya visi dan misi yang diemban oleh perguruan tinggi tersebut. Acara pelantikan tersebut turut dihadiri oleh Sekretaris-IIYaspendhar H Saiful Nahar, SE, MM, Bendahara-I H Ramadhan, SE serta dosen tetap danpegawai di Aula STIE Harapan Medan. (m41)

Lima Menteri Akan Hadiri Rakernas BEM Se-Indonesia Di Medan

1947,” katanya. Pertemuan tersebut menghasilkan kesimpulan di antaranya para ulama yang berpaham “aswaja” sepakat untuk membentuk organisasi Islam yang bersifat nasional dengan nama Nahdlatul Ulama (NU), organisasi yang bersifat lokal dilebur ke dalam NU dan sebagainya. Kemudian dibentuk kepengurusan pertama yang terdiri dari Penasehat: Syekh Mustafa Husein (Purbabaru Mandailing), Ketua Umum: H. Burahanuddn Thalib Lubis (Sibolga), Ketua:

M. Nuddin Lubis (Mustafawiyah), Ketua Muda: M. Amin Awwal (Sibolga), Setia Usaha: Aminuddin Azis (Mustafawiyah), Setia Usaha Muda merangkap Bendahara: Alauddin Panggabean (Sibolga). Bagianbagian terdiri: Bidang Pendidikan: M. Amin Awwal, Penerangan: M. Nuddin Lubis, Fatwa: Syekh Dja’far Abdul Wahab (Mustafawiyah), Perencanaan: Sai Aman Nasution (Mustafawiyah), dan beberapa pembantu. Setelah NU dibentuk di Pa-

dang Sidimpuan, namun sesuai dengan pusat keresidenan Tapanuli adalah di Sibolga, lanjutnya, maka NU pun pertama sekali berkantor di Sibolga di kediaman Ketua Umum H. Baharuddin Thalib Lubis, kemudian pindah ke Padang Sidimpuan dan terakhir di tetapkan di Medan sampai hari ini. Kini, Kantor NU pertama di Medan terletak di Jalan Perdana, kemudian pindah ke Jalan Palang Merah dan sekarang di Jalan Sei Batanghari No. 52 Medan. (m13)

MEDAN (Waspada): Lima menteri Kabinet Indonesia Bersatu (KIB) Jilid II akan menghadiri Rapat Kerja Nasional (Rakernas) Badan Eksekutif Mahasiswa (BEM) se-Indonesia, 2-6 Februari mendatang, yang digelar di Asrama Haji Jl. Jenderal AH Nasution, Medan. Mereka, Mendagri Gamawan Fauzi, Meneg BUMN Mustafa Abu Bakar, Menteri Perumahan Rakyat Suharso Manoarfa, Menteri Pertanian Suswono dan Kepala Badan Pertanahan Nasional Joyo Winoto. Ketua panitia, Rosul Al Amin Harahap kepada wartawan, Kamis (27/1) mengatakan, kelima menteri itu sekaligus menjadi pembicara seminar nasional “Konversi Hak Guna Usaha Menjadi Tanah Untuk Rakyat” yang dilaksanakan 3 Februari. “Seminar membahas permasalahan tanah, berdasarkan keyakinan masyarakat bahwa semua lahan itu subur dan sangat berkualitas, sehingga produksinya bagus. Se-

lain itu, amanat warisan dengan ikatan genealogis teritorial yakni, tanah kelahiran dan mati pun disini,” kata Ketua BEM Universitas Panca Budi itu, didampingi Ketua BEM USU Paidi, Ketua BEM UISU M Ari Sugarna, Ketua BEM Unimed Irwan Lubis, Ketua BEM Universitas Amir Hamzah M Isa, Ketua BEM IAIN Sumut Muslim dan Ketua BEM ITM Fery Hixon. Dia menambahkan, tema Rakernas BEM se-Indonesia, yakni “Gerakan Mahasiswa Bukan Sekedar Retorika”. Sedangkan tujuan Rakernas untuk menggali berbagai input gagasan dan pemikiran yang diharapkan memberi kontribusi bagi upaya menyelamatkan kedaulatan hukum dan NKRI. Secara khusus, baik untuk seluruh anggota BEM seluruh Indonesia. “Kita panitia memohon dukungan masyarakat Sumut guna menyuk-seskan rakernas yang di gelar di Medan ini,” tandasnya.(m27)

Medan Metropolitan Polisi Pantau Pelajar Berseragam Sekolah

A5

WASPADA Sabtu 29 Januari 2011

Pria Bolos Ke Warnet, Wanita Bolos Ke Plaza MEDAN (Waspada): Kendati Operasi Sayang 2011 belum digelar secara resmi, namun petugas Polsekta Medan Baru mulai melakukan pemantauan terhadap pelajar berseragam sekolah yang berada di warung internet (warnet) pada jam belajar. “Selain pelajar berseragam sekolah, petugas yang telah diturunkan ke lapangan juga memantau warnet yang menyediakan fasilitas akses situs porno,� kata Kapolsekta Medan Baru Kompol Saptono, SH, SIK

kepada Waspada, Jumat (28/1) sore. Saptono didampingi Kanit Binmas AKP Supriadi YTO, SH mengatakan, pesonel Polsekta Medan Baru sedang bekerja di lapangan dan belum diketahui hasilnya. “Seluruh warnet yang berlokasi di wilayah hukum Polsekta Medan Baru terus dipantau,� tegasnya. Dalam waktu dekat, lanjut Saptono, Polsekta Medan Baru bekerjasama dengan Dinas Pendidikan Kota Medan akan melakukan Operasi Sayang (OS)

Reskrim Segera Panggil Mantan Kapolres Siantar MEDAN (Waspada): Direktorat Reserse Kriminal (Reskrim) Polda Sumut segera memanggil mantan Kapolresta Pematangsian-tar AKBP Fathori, tersangka kasus penganiayaan terhadap Andi Siahaan, kontributor salah satu televisi swasta. “Penyidik reserse kriminal yang menangani kasus pidananya. Karena itu, perlu melakukan pemanggilan guna pemeriksaan,� kata Kabid Humas Poldasu Kombes Pol. Hery Subiansauri, saat ditanya Waspada, Rabu (26/1). Menurut Hery, yang bersangkutan sudah diperiksa Propam terkait pelanggaran kode etik dan profesi. Tetapi yang berhak menghukumnya adalah atasan terhukum (ankum), yakni Kepala Biro Perencanaan dan Anggaran, tempat Fathori bertugas saat ini. Proses pemeriksaan yang dilakukan mengedepankan asas paraduga tidak bersalah sebelum ada putusan dari pengadilan yang menetapkannya. “Jika Fathori dinyatakan bersalah dan melanggar kode etik atau minimal pelanggaran paling kecil adalah meminta maaf, dan terberat akan dikenakan pemecatan tidak dengan hormat,� tandasnya. Evaluasi kerja Sementara, menindaklanjuti rapat kerja pimpinan TNI/ Polri, Kapolda Sumut Irjen Pol. Oegroseno membuka rapat evaluasi jajaran Poldasu selama dua hari sejak Selasa hingga Rabu (26/1) di aula Tribrata Mapoldasu. Kombes Hery Subiansauri menyebutkan, rapat evaluasi diikuti seluruh pejabat utama Poldasu dan Kepala Satuan Wilayah. “Rapat evaluasi sebagai tindaklanjut rapim TNI/Polri di Jakarta yang dibuka presiden,� tambahnya. Dalam rapat itu, seluruh kesatuan, baik Polres dan Poldasu membahas hambatan operasional dalam penanganan kasus selama 2010. “Jadi, apa yang menjadi hambatan pada 2010 dibahas dan dicari solusinya agar dapat berjalan baik pada 2011,� demikian Hery. (m27)

2011 dengan sasaran para pelajar berseragam sekolah yang berada di warnet saat jam belajar. Ketika disinggung soal lokasi mangkal para pelajar yang bolos sekolah, Kanit Binmas AKP Supriadi YTO, SH, hasil pantauan petugas di lapangan, banyak pelajar pria yang bolos sekolah memilih mangkal di warnet. Sedangkan pelajar wanita yang bolos sekolah memilih mangkal di plaza dan pusat perbelanjaan lainnya. Para pelajar ini dicurigai bolos karena berada di warnet

dan plaza pada jam belajar serta mengenakan seragam sekolah. “Selain warnet, petugas Polsekta Medan Baru akan melakukan razia terhadap pelajar berseragam sekolah yang berkeliaran di plaza dan pusat perbelanjaan lainnya,� tambah Supriadi. Mengenai adanya informasi dari masyarakat tentang warnet yang mengediakan fasilitas akses situs porno di kawasan Padang Bulan, Kapolsekta Medan Baru mengatakan, pihaknya segera melacak kebenaran informasi tersebut. Jika dite-

mukan warnet menyediakan fasilitas akses situs porno, pasti ditindak. Sedangkan pelajar yang bolos akan diberi pembinaan oleh Binmas Polsekta Medan Baru. “Saat ini, petugas Polsekta Medan Baru sudah melakukan sosialisasi dengan memasang stiker ke seluruh warnet. Stiker ini berisi tulisan larangan masuk bagi pelajar yang berseragam sekolah. Di samping itu, petugas juga melakukan sosialisasi melalui pengeras suara,� demikian Saptono. (m36)

Tim Kuda Laut Gerebek Koperasi KSU Pratama BELAWAN ( Waspada): Puluhan personel TNI/Polri dan Pertamina yang tergabung dalam tim Kuda Laut menggerebek Koperasi KSU Pratama di kawasan Bom Lama Lingk 24 persis bersebelahan dengan depot Pertamina (Persero) Unit Pemasaran Instalasi Medan Grup, Jumat (28/1). Namun petugas kecolongan dan tidak banyak mendapatkan barang bukti kejahatan yang terorganisir, kecuali satu drum berisi minyak tanah yang berada di belakang bangunan koperasi itu. Tidak ada keterangan yang diperoleh dari pengurus Koperasi KSU Pratama menanggapi pengerebekan tersebut. Namun, Yanto, warga setempat, mengatakan koperasi itu telah lama beroperasi dan warga membeli minyak di koperasi tanpa halangan. “Setahu aku koperasi ini resmi dan warga berlangganan beli minyak di sini. Tidak mungkin koperasi ini menjadi tempat penimbunan minah,� ucapnya Operasi tim Kuda Laut 2011 direncanakan berlangsung sela-

ma satu bulan di seluruh wilayah hukum Poldasu. Empat hari pelaksanaan sudah beberapa gudang pengoplosan digerebek diantaranya gudang milik Along di Jalan Sei Baru Kec. Hamparan Perak, gudang milik Adul Jalan Yos Sudarso Titi Papan Kec. Medan Deli dan beberapa gudang di Simpang Seruwai Kec. Medan Labuhan. Selanjutnya gudang milik P Sinaga di Kampung Samal Kec. Medan Belawan, gudang milik Saiful di JalanYoung Panah Hijau dan gudang milik Ganda Napitupulu di Kel. Terjun serta kawasan Siombak, Kec. Medan Marelan. Namun belum ada yang ditetapkan sebagai tersangka. Bahkan P Sinaga yang sebelumnya diamankan polisi telah bebas. “Tak ada tebang pilih dalam operasi ini, semua akan ditindak. Begitu juga kalau ada ditemukan oknum polisi yang terlibat. Kalau ada informasi keberadaan lokasi serta bos mafia BBM tolong diberitahukan pada kami,� kata Kombes Pol. Verdianto IB disela-sela memimpin razia di Depot Pertamina Labu-

han Deli, Jumat (28/1). Ditanya tentang pengamanan pada jalur pipa penyaluran minyak Pertamina di Belawan, Verdianto mengaku melakukan penyisiran di Bagan Deli yang kerap dibor pelaku selama ini. Selain menggerebek gudang koperasi tersebut, petugas juga memeriksa dokumen, isi BBM dalam tangki, locis atau segel yang digunakan mobil tanki yang sedang antri dan tanki timbun BBM yang berada di belakang depot. Namun, petugas belum ada menemukan bentuk penyelewengan yang diduga selama ini kerap dilakukan di dalam kawasan depot Pertamina. “Pencuri minyak bukan kami saja tapi oknum Pertamina juga terlibat dengan cara permainan DO palsu,� kata mantan pemain minyak yang tidak mau namanya disebut. Kepala Operasional Depot Pertamina Labuhan Deli Abdul Rachim, mendukung operasi itu. “Bila ditemukan penyimpangan yang melibatkan orang Pertamina maupun di luarnya akan ditindak tegas,� katanya. (h03)

Waspada/Surya Efendi

SAMBUT IMLEK: Pengunjung dan kendaraan melintas di depan pintu masuk Sun Plaza yang dihiasi dengan pernak pernik Imlek, Jumat (28/1). Sejumlah pasar perbelanjaan di Medan penuh dengan warna merah guna menyambut Hari Raya Imlek yang jatuh pada 3 Februari 2011 mendatang.

Perawat Tewas Ditabrak Truk MEDAN (Waspada): Seorang perawat yang bertugas di Puskesmas Pancurbatu Ernarita Br Sembiring, 36, warga Desa Namoriam, tewas setelah mengalami kecelakaan lalulintas di Jln. Jamin Ginting km 22-23 Desa Namoriam, Kecamatan Pancurbatu, Deliserdang, Jumat (28/1). Informasi diperoleh di kepolisian, kejadian itu bermula saat korban pulang dari Puskesmas sekira pukul 08:00. Usai tugas malam, korban bermaksud pulang dengan mengendarai sepedamotor Suzuki Spin warna hitam BK 4718 SS. Setibanya di depan rumah, korban membelokkan kendaraannya, namun truk Colt Diesel BK 9681 RD yang datang dari arah belakang menabrak sepedamotornya. Akibatnya, korban terpental dan tewas di tempat kejadian. Untuk pengusutan lebih lanjut, Polantas membawa jenazah korban ke Puskesmas Pancurbatu guna keperluan visum. Sedangkan supir truk, Erwin Simanjuntak, 38, warga Kuta Kepar, Kecamatan Tiga Panah, Kabupaten Karo, diamankan ke Pos Lantas Pancurbatu. Disenggol KA Di tempat terpisah, Rosmeta, 44, warga Pulo Brayan, Kecamatan Medan Timur kritis disenggol kereta api di lintasan Pulo Brayan Bengkel, Jumat (28/

1) sekira pukul 07:00. Sebelum dibawa ke RSU Dr. Pirngadi Medan, wanita tersebut sempat mendapat pertolongan pertama di RS Mitra Medica Medan. Karena luka yang dialami cukup parah, korban akhirnya dirujuk ke RSU Dr Pirngadi.

Gustina, kakak korban mengatakan, setiap hari adiknya sering jalan-jalan pagi. Insiden itu diketahui keluarga dari tetangga. Lalu, keluarga mendatangi lokasi kejadian.“Disana kami mendapati dia sudah tergeletak. Lalu kami bawa ke RS Mitra Medica,� jelasnya.(h04/h02)

4 € ‘Â’

                          Â Â? Â?Â? Â?  Â?

•        Â?

       Â?       Â?        Â?       Â? Â?Â? Â?­  Â?€

 Â?  Â?Â?

‚ ƒ         ‚„  €‚„  Â…‚†   ‡ ˆ    Â?‚ Â?Â?‚ Â?  Â?‚­

  ‘Â’          Â?  Â?€ Â?Â?  Â?­

 Â?

Â…  Â…  Â…   Â…  

€ –ÂŒ ÂŒ    Â?  Â? Â…  Â?Â?    Â?   Â? ‘Â’

 1. 2. 3. 4. 5.

 ‘Â’

1

       Â? Â?Â? Â?  Â?‚   ‘Â’

3 4

”   ÂŒ     Â?      Â?    ˆ  Â?Â?     Â?    

Â?

 Â?

­ ‹Â…    ‡    Â?Â… Â? Â?Â?  Â?   ‘ ‰     ‡   ‚  ‰     Â?  Â?  Â?Â?   Â? 



  

‰ Â…  Â? ­‚ Â?Â?­“ Â?‚ ­  Â?­Â?‚€

  ‘Â’

‘‡    Â?  Â? Â… Â?Â?   Â?  

  Â? ‰    Â? ‰    ‚Â? ‹   ­Â? ™   ‡   œ—   ‹  ›    ÂŒ  Â? ­›››‚ Â?Â?­›‚›› Â? ­››‚›  Â?­›‚››

 “  Â? ‹ ‡  Â? — ”   

  ‘Â’



–     Â?  Â?  Â?Â? Â…   Â?  

“ ” Â…   Â?Â?

‹ ‡    Â?  Â?Â? ‡ Â?   Â? 

2

‘       Â?  Â?Â? ‚ Â?   Â? ­

‰      Â? ‹ ‡  — ”    Â? ‹ ‡  — ”    Â?Â? ‹ ‡     —”   Â? ‹ ‡  —”  

“ ‘Â’

 �

‚ ‰   Â’

 Spirtus Minyak tanah Biogas LPG Biodiesel

‘       Â…  Â?   Â?   Â?Â? ˆ   Â?  

Â? ‘Â’

 

š     Â?››‚›­ Â?Â? ­›››‚ Â?›­››‚  Â? ­›‚››

  ‘Â’



  

‹ÂŒ ÂŒ     ÂŒ       Â?‚ Â? Â?Â?‚­  Â?‚

 � � ��  �

    Â? ‚ Â? ‚ Â?Â? ‚  Â? ‚­

­ ‘Â’

  

‹ÂŒ ŒŽ       Â…          ‚        ­        

‚ ƒ      Â?      Â?         Â?Â?        Â?     





­ ‰ ‰    ‰ ‚  ‰­ ‰Â…   Š   Â?  Â?Â?€­ Â?€  Â?Â?

   ÂŒ ‡  Â?  Â?    Â?Â?        Â?   

‹ÂŒÂ…    

 Â? ƒ  Â’ Â?       ˜€Â’ ‚Â? ™  Â’ ­Â? ƒ  Â…   Â’

            ‹    ‰  Â…   Â?         Â?         Â?Â?       ‹  Â?      

€ ‘ÂŒ    Â? ‹ ‹ Â? ž ‰  Â?Â?  ‘  Â? ‘ ‘  Â&#x; Â?  ‡   Â…

ƒÂ…     Â? Â?Â? Â? Â? Â’Â? Â?Â?   ÂŽÂ?  Â?  Â’Â?  Â? ÂŽÂ?Â?Â?

  ‹ÂŽ¤ÂĄ€ÂŽ ‹›¤ÂĄÂ… ‹ÂĄ

€ ‚ ¢Â…ÂĄ‚Â…

   

‚  †›‰ †‡   ‹     Â? † ‹  Â? ‹  › Â?Â? ‰    Â?     

   

‹‰ÂĄ  ÂŽ  ‘‘ÂĄ Â… → ‘‹ÂĄ ¢ÂĄ  ‘ÂĄ­Â… → ‹ÂĄ­¢ÂĄ  ‰ ÂĄ¢‘‹ÂĽ‹Â? ÂĄ¢ ÂĽ Â? ÂĄ¢‚ ÂĄ“  ‰   “  “  ­ÂĄ­¢­ÂĄ“  Â? ÂĄ¢“

  Â?  ÂĄÂŽ¢“ÂŽ ÂĄ¢“ÂĄ­

 ­›¢ Â?  ÂĄ“ ›¢­ÂĄ“ ›€ÂĄ­€                              ‰‘‰ÂĄ­¢‚ÂĄ­­             

€  ‹ ÂĄ     ÂĄ­   ÂĄ­ÂŽÂĄÂĄ ‹ ÂĄ   Â… ÂĄÂ… ‘     Â…

     

     

‰‘‰ÂĄ‚¢‚¢ ÂĄ€¢‚¢ ÂĄ ÂĄ ‘   ÂĄ­ ›¢‰‘‰Â? ÂĄ­ ›¢Â? ÂĄ­ ›­Â? ÂĄ­ 

Â?  ‡ÂĄ¢€ÂĄ   ÂĄ¢ÂĄ  €ÂĽ † ÂĄ‚­      †       ‚­                    





‘  Â…

‚ 

 

                



£‘ÂĄ­ÂĄ  ­   

  

‹   ‚

 

™   →  

™   → 

™  →  

™  →    

” → Â…  

” →  ”Â? →  ”  → 

‚ 

‹ →  

‹  →  

‹  →   ‡ ­    ÂĄ  ÂŒ     ÂĄ ÂŒ  ‡  ‚ ÂĄ  ÂŒ    ­ ÂĄ   ÂŒ   ÂŒ Â…    ‘             ˆ          ÂŚÂĄ →     ÂŚ  ÂĄ  →     ÂŽ •Â? ÂŽ   ‘  ÂŽ   ÂŽ       ÂŚ‚ÂĄ  →    ÂŽ ƒ  ÂŽ        ÂŽ   Â&#x; Â?  ÂŽ     ÂŚ­ÂĄ   “  ÂŚ  →     ‡   ÂŚ  →    ‡   ÂŚ ‚ →    ‡    ÂŚ ­ →    ‡   €  ÂŁ ÂŽ

 

Â…

ˆ  ˆ  Â? 

‰ Â&#x;  → Â…

‹    → Â… 

‰Â… ˆ  → Â…  †ˆÂ? → Â… ‡

   ‘      Â…  ‚™      

   Â?    —  Â…                  Â? ‚  ‘ ÂĄ  ÂĄ   ­          Â…Â?   —Â…  Â…  Â?     ƒ     ‘       Â…   “   †Â?ƒ Â…†‹™  †Â?‹™ †™ ‘  €  ‰ Š  ‡ ˆ   Â?  ‘ ÂĄ ƒ‹š  ™ • ‰  “     ‰        ‚    Â?  Â?  Â?Â? 



‰Š     

     

Medan Metropolitan

A6

Polisi Selidiki Pembelokan Sejarah Silsilah Raja Siantar-Simalungun MEDAN (Waspada): “Polisi segera menyelidiki laporan tentang upaya pembelokan sejarah atau silsilah keturunan Raja Siantar-Simalungun Sang Nawaluh oleh pihak tertentu yang mengaku Raja Siantar,� kata Direktur Pembinaan Masyarakat Poldasu Kombes Pol. Hery S, menanggapi laporan rombongan Ihutan Bolon Hasadaon Damanik, Boru Panagolan Siantar-Simalungun, yang beraudensi ke Mapoldasu, Kamis (27/1).

Rombongan Ihutan Bolon Hasadaon Damanik, Boru Panagolan terdiri dari Ketua Umum Panner Damanik, Sekretaris Umum Pandapotan Damanik, Sekretaris I Pdt. Juandaha R Purba, Pembina Tuan Djariaman Damanik dan Penasehat HM Idris Damanik. Kepada wartawan di Mapoldasu, Tuan Djariaman Damanik mengatakan, kedatangan mereka ke Polda melaporkan upaya pembelokan silsilah dilakukan seorang marga Damanik yang

bukan titisan darah Sang Nawaluh. Pihaknya juga menyerahkan bukti-bukti sejarah tentang Sang Nawaluh, Raja Siantar yang dibuang ke Bengkalis oleh penjajah Belanda. Menanggapi laporan dan fakta sejarah itu yang disampaikan Pdt. Juandaha R Purba, Kombes Hery mengatakan, akan mempelajarinya dan kelak mempertemukan kedua belah pihak yang berbeda pendapat. Sementara, sesepuh marga Damanik, Djariaman Damanik

mengatakan, tidak ada pihak yang berhak mengaku sebagai Raja Siantar-Simalungun kecuali Marsekal Tuan Sahalam Damanik, kemudian diteruskan putra beliau DF Sang Nalan Damanik, yang kini bermukim di Jakarta. Menjelang akhir hayatnya, Marsekal Tuan Sahalam Damanik telah membuat wasiat menetapkan Tuan Djariaman Damanik sebagai pemangku Raja Siantar (Tuan Raja Sidamanik) dan Tuan Zulkarnaen Damanik

sebagai Tuan Raja Bandar. “Wasiat ini dikeluarkan karena ketika itu putra beliu DF Sang Nalan Damanik masih berusia remaja,� kata mantan Ketua Pengadilan Tinggi Sumut, Bali dan Nusa Tenggara itu. Jadi, kata tokoh berusia 91 itu, tidak ada pihak yang bisa mengaku Raja Siantar-Simalungun selain titisan darah atau keturunan langsung Raja Sang Nawaluh. Pdt Juandaha R Purba menambahkan, kedatangan mereka

ke Polda dipicu keresahan sebagian besar marga Damanik atas terbitnya buku karangan Sahat Daulat Damanik, kelahiran 1955 yang mendaulat dirinya sebagai Raja Siantar-Simalungun. Padahal, kata dia, Sahat Daulat Damaik bukan keturunan langsung Raja Sang Nawaluh, tetapi keturunan Raja Anggi Anggi Sipolha Damanik. “Saya minta kepada pihak yang mengaku Raja Siantar berhenti membuat pembohongan publik,� tandasnya.(m27)

WASPADA Sabtu 29 Januari 2011

Pengedar Ganja Ditangkap MEDAN (Waspada): Petugas Polsekta Patumbak menangkap tersangka pengedar ganja dari Jln Brigjen Katamso, Gg. Al Fajar. Tersangka UAN, 36, penduduk Kampung Sekip, Desa Candi Rejo, Kecamatan Sibiru-biru, Deliserdang, kini mendekam di tahanan Polsekta Patumbak. Informasi yang diperoleh Waspada di Mapolsekta Patumbak, Jumat (28/1), tersangka menjadi pengedar ganja sejak dua bulan terakhir. Dia ditangkap di kediaman orang tuanya, Kamis (27/1) pukul 16:30, saat mengemas daun ganja kering ke amplop kecil untuk dijual. Saat itu, polisi mendapat informasi dari masyarakat, kemudian melakukan pengintaian. Dalam penggerebekan itu, polisi mengamankan barang bukti 2 ons ganja kering dan beberapa alat untuk membungkus ganja. “Saya baru dua bulan ini mengedar ganja untuk menutupi kebutuhan rumah tangga,� ujar UAN, usai menjalani pemeriksaan. Pengakuannya, ganja itu diperoleh dari S, 50, warga Tembung, kemudian diedarkannya di sekitar kediaman orang tuanya Jln. Brigjen Katamso. “Dua sampai tiga hari sekali, saya ambil ganja ke Tembung dengan harga Rp140 ribu per ons,� jelas UAN. Sementara, Kapolsekta Patumbak Kompol SW Siregar mengatakan, tersangka dijerat dengan UU No. 35 tahun 2009 tentang narkotika, dengan ancaman hukuman di atas lima tahun. (m27/h04)

Banyak Kasus Perampokan Bersenpi Belum Terungkap KASUS perampokan bersenjata api yang terjadi akhirakhir ini di wilayah hukum Polresta Medan sebagian besar belum terungkap. Meskipun sejumlah saksi korban sudah dimintai keterangannya dan telah memberi informasi mengenai ciri-ciri pelaku, namun hingga kini polisi belum berhasil mengungkapnya. Polisi pun berdalih masih mengumpulkan bukti-bukti yang kuat untuk mengungkap kasus perampokan tersebut. Alasan yang sangat klasik itu acap dilontarkan oleh aparat kepolisian manakala pelaku perampokan belum tertangkap. Begitupun, polisi terus melacak keberadaan para pelaku kriminal tersebut. Belum lagi hilang dari ingatan kita tentang aksi perampokan bersenjata api (senpi) di kompleks perumahan Perumahan Permata Hijau belakang Hotel Emerald Garden Jalan Yos Sudarso, Kelurahan Silalas, Kecamatan Medan Barat, Minggu 5 Desember 2010 sekira pukul 07:00. Enam pria bersenjata api jenis FN mengendarai mobil menyatroni rumah toke beras bernama Eddy Halim alias Lim Tiong, 45. Dalam tempo beberapa menit, para pelaku berhasil

menggondol uang Rp500 juta. Hingga kini, petugas Polsekta Medan Barat belum berhasil menangkap para pelakunya. Aksi serupa juga terjadi Minggu, 23 Januari 2011. Kali ini, giliran rumah seorang pengusaha show room sepedamotor Jhony Tuerah, 50, di perumahan Jalan Timor Baru I No 69, Kelurahan Gang Buntu, Kecamatan Medan Timur. Pengusaha show-room sepedamotor tersebut saat kejadian masih berada di Kuala Lumpur, Malaysia, sedangkan yang berada di rumah saat itu istrinya Sheren Johana, 40 dan keempat anak serta seorang pembantu rumah tangganya. Dari rumah Jhony Tuerah, lima kawanan perampok bersenpi jenis FN itu menguras sejumlah barang-barang-barang berharga yang nilainya berjumlah Rp300 juta. Modus operandi yang dilakukan para perampok mirip dengan aksi yang terjadi di Komplek Perumahan Permata Hijau tersebut, yakni di pagi hari dan mengendarai mobil Innova. Kasus perampokan tersebut sudah dilaporkan korban Ny Sheren Johana ke Polsekta Medan Timur. Jauh hari sebelumnya, kasus serupa juga dialami rumah

merangkap kantor perusahaan milik pengusaha reklame di Komplek Perumahan Madio Permai di Jalan Madio Santoso, Kecamatan Medan Timur. Setelah mengikat seorang petugas Satpam Rudi Suhendra, 38, empat pelaku bersenjata api menggondol uang puluhan juta. Kanit Reskrim Polsekta Medan Timur AKP Aprwin Nimrot Simanjuntak mengatakan, diduga pelaku yang beraksi di Komplek Perumahan Jalan Timor Baru I sama dengan pelaku yang beraksi di Komplek Perumahan Permata Hijau belakang Hotel Emeral Garden. “Dilihat dari persamaan waktu kejadian dan modus yang dilakukan hampir sama cara kerjanya. Kondisi seperti ini yang membuat polisi tengah serius mengungkap pelaku perampokan tersebut,� jelas AKP Simanjuntak kepada Waspada, Rabu (26/1). Menurutnya, berdasarkan keterangan semua saksi, ciri-ciri para pelaku sudah diketahui, namun saat diperlihatkan dengan foto-foto sejumlah ‘pemain lama’ yang sering melakukan aksi perampokan, para saksi mengaku tidak ada wajahwajah pelaku yang mirip dalam aksi perampokan tersebut.

“Namun demikian, kami tetap melakukan penyelidikan dan memburon para pelaku perampokan tersebut,� tegas Nimrot Simanjuntak. Ulah perampok bersenjata api juga dialami penjaga ternak di Jalan Peringgan Desa Kampung Kolam, Kecamatan Percut Seituan, Kamis 15 Desember 2010 sekira pukul 03:00. Sebelum beraksi, 10 orang perampok menganiaya Kalimin, 45, dan istrinya Misgiyati, 40, di gubuk tempat penyimpanan lembu tersebut. Para perampok datang ke lokasi ternak lembu sekira pukul 03:30, mengendarai dua mobil jenis truk Colt Diesel dan mobil Xenia warna hitam. Begitu sampai ke lokasi, kawanan perampok langsung mendobrak pintu gubuk sehinga Kalimin dan istrinya Misgiyati terbangun. Begitu pintu terbuka, kawanan perampok langsung memukul Kalimin dengan gagang cangkul dan parang babat yang mengakibatkan korban pingsan dan tak sadarkan diri. Setelah Kalimin roboh, lima perampok menodongkan pistol jenis FN ke tubuh Misgiyati. Dua anak korban masing-masing Lisnah ,13, dan Nazilah 2 tahun ketakutan melihat kedua

orangtuanya dianiaya hingga tak sadarkan diri. Setelah mengikat Misgiyati, Kalimin dan Lisnah, kawanan perampok mempreteli perhiasan milik Misgiyati seberat 20 gram. Lima lagi kawanan perampok yang berada di luar bergegas menggiring 9 ekor lembu naik ke atas truk Colt Diesel. Setelah berhasil menaikkan lembu tersebut, kawanan perampok melarikan diri meninggalkan korban dalam keadaan terikat. Kapolsekta Percut Seituan Kompol Maringan Simanjuntak mengaku pihaknya masih melakukan penyelidikan ke lokasi kejadian, setelah memintai keterangan saksi korban. Sementara itu, Kapolsekta Medan Barat Kompol Arke S Ambat mengatakan, pihaknya telah memintai keterangan 10 saksi masing-masing 5 petugas Satpam, 3 pembantu rumahtangga dan 2 suami istri yang menjadi korban perampokan. “Lima pelaku perampokan hingga kini masih dalam penyelidikan,� jelas AKP Arke S Ambat seraya menambahkan sesuai hasil pemeriksaan di layar CCTV milik tetangga korban tidak terlihat jelas wajah para pelaku yang terekam saat

masuk ke dalam mobil. Arke juga mengimbau agar pengelola komplek perumahan memasang kamera CCTV di pintu masuk atau di tempat

strategis untuk memantau para pendatang atau tamu yang keluar masuk komplek perumahan tersebut agar kejadian serupa tidak terulang kembali.

“Selain itu , petugas security juga harus jeli melihat siapa tamu yang datang dan ke luar dari lokasi perumahan,� ujar Kompol Arke. (h04)

Waspada/Andi Aria Tirtayasa

Rumah milik Jhony Tuerah yang berada di perumahan Jalan Timor Baru I No 69 Kelurahan Gang Buntu, Kecamatan Medan Timur, yang disatroni lima perampok bersenjata api, Minggu (23/ 1) sekira pukul 07:00.

4 ‘­  …Œ’             Â?   

         

 ™Â…  Â… ­ ­ ­        ­ Â? 

C

Š Â?““  ­Â…ˆ” Â? ­ ­ Â… Â…­ ”­ Â’       ˆ

P

   

B

A

     

  

  Â 

 Â? 

�� 

�ˆ

ƒ ‡    ­ Â’   ­   …Â?

Â?  ­­  €  ‚   Â?Â?

Â?Â?

 ƒ��

��ƒ�

˜     …Ž Â…Â…    ž   Â?   Â?ˆ    ˆ Â? Â?   ™ …Â…   ­ š Â&#x;  Â?–ÂŽÂ?Â?

Q

Â? „  Â…  †‡­   ∠ „  ∠†‡   ∠ „  ∠†‡   ∠ „  ∠‡† Â? ∠ „  ∠†‡ ˆ ‰… Â… ­  ­   ƒ   Â?   Â?  Â? Â? Â?  Â?Â… Â? ‡ Š      Â?      ‡  ƒ      ‡         ­  Â…   ‹    ‹  

 ‹ � ‹

� Œ  Ž − … 

 

˜ÂŽ ­ ­   ÂŽÂ…­­  

  Â?  Â? Â? Â?         –

™ …  Â?™ ……  ˜   Â…Â…  

  Â?   Â? Â? Â? Â? Â…  š ­  ›  ÂŽ   

‘Â…Â?Â…Â… Â…ÂŞ— §…¥ ˜…Â…Â…—Â…  Â…ÂŞ—„Â?­  Â…ÂŽ Â?   ÂĄÂ  ‡Â…ÂĄ Â?Â?” ‘š  § 

  Â…–Â?  Âœ Â?  ˆ§ ­  ­  ­   ž žÂ?žˆ  Â?žˆžž    žÂ?žˆž Â?ˆžÂ?žž 

‘ Š€  Š  Â? Â? ­ ‚ ƒ ­‚ Â?  Â? ­ ÂŚ ­  Ă— ­‚ ‚

‘™™  

 Œ…       Â… ÂŽ—ÂŚ  §Â…Â…——Â… Â…ÂŽ—   ÂŞÂ…Â…Â…Â……–   §ÂŽ—ÂŽÂŽÂ…  Â? ÂŞÂ…—Â…­Â…­

Â?  š­­    š   Â?Â…­            Â? š   Â… 

=

Â? Ă— Â? =   ƒ

Â… Â? ­€ ­ ÂĄ

3

R

B P

    

 � �  ��

  ­  –Â’

Â? 

A

ˆ Â… 

  ¤  –  ­ Â…Â… Â… Â…  Â…   Â?

 •   Â…Â…– …  —… Â’ Â? Â…   Â…   Â…Â? ˆ Â…

 

O

Âœ   Âœ     œ… ž  Â? Âœ    Â…Â…

   Â?

Â?  Â…  Â… …   – ­Â’           Â?  Š ­   Â’    Â…Â…Â? ƒ Â?ÂĄ 

 Â? Â…Â… ˆ ¢…  ­    Â’ ÂŁ ÂŁÂ?  ÂŁÂ?   ÂŁˆ Â?ÂŁ ÂŁÂ?ÂŁˆ

ÂŒÂĄž­¼  ž ­Â…­¼ž Â…­¼ž…–ÂĽžÂ…ÂĽž

 ÂŒ –…  – Â…­ Â… ‘­ ÂŚ  §    Âœ   §…­… Â? Â…Â?Â…

 ÂŒ ­     ÂŚ  §    Â?Â…   §…­… Â? Â…Âœ

Â?   –… Â… Â…Â…  ­…žžÂ…žžÂ…ž–ž  Â?ˆ Â? ¨žžÂ… Šƒ ž žÂ?žÂ?žƒžˆžŠž ž   ŠžÂ?žÂ?žƒžžˆžž ž

  žž žˆžŠž�ž�žƒž � žŠž�ž�žƒžˆžž ž

ˆ Â…Š  …–Â…… §‰  ÂŞ     Â…  Â…

 Â…Â… Â…­…– Â…– Â? ÂŒ…­ Â… ˆ —…   …–Â… ž ž žˆžÂ?  ž ž žˆžÂ?  ž žˆžÂ?ž

�ž ž�žˆž

Â? §Â… ÂĄ Â?­            Â?ÂĄ  §Â… ÂĄ  Â? ÂĄ § §Â… ÂĄ    Â…   Â? ÂĄ  Â?Â… ­     ­   š  Â?Â…   Â?­ šÂ…     Â? Â?­ Â? Â?­ ž 

Š ž ­     ­ ­   ­   ­­    Â? ­

ƒ ­Â…Â… Â…ÂŽ  Â?  Â? Â?       ˆ       Â?   ž žˆž žÂ?   žžˆž žÂ?  žÂ?ž žˆž  Â?Â?ž žˆž ž

� ­€ Berita

sinetron 58 − x

•X

43 − x

• 27

( ) =  (  âˆŞ ) +  (  âˆŞ )

    ƒÂŁŠÂŤŠÂŤˆÂ?ÂŁŠÂŤ Š     ƒÂŁŠ Š  ƒÂ… ­ Â… ­ ­  Â…Â…Â…  ƒž ƒ Â? Â… Â? ­€ E

14

50

14

B 30

40

C

44

 ­Â… Â? ˆ  ‚ Â? ­ Â?Â…Â… † Š ÂŹ ‰  ƒ ÂŹ      ÂŚ  =

— ×   Š   ×  = —

ƒ  

 ˆ  ƒ � ­„ � =

‡ Â? ­„ ÂŒ­­         ­ Š Â…  Â?

Â… ˆ Â? ­„ š — Â?ˆ ÂŹÂŽ ÂŽ  Â?ƒ  ¢    Â… Îť=

50

A

D

† Â? ­ •       Â…      ­         –   Â… ­       

   ­

Š  =

 Â Â Â Â Â 

— Â?ˆ   = =    =   ÂŽ Â?ÂƒÂ Â™Â˘

‰ Â? ­ Š‹ €ÂŒÂŽ …ÂŽ  Â?   ÂŽÂ…ÂŞ

 Â?    ÂŽÂ…ÂŞ   Â? Â?     Âœ   Âœ Š ‹ €ÂŒ Œ ÂŽ  ÂŽ  Â?    Â…ž…  ÂŽÂ…ÂŞ

 Â?ÂŽÂ… ÂŞ   Â? Â?  Âœ   Âœ

‰ � ­„

Â? ­€ ‚Â…ÂĄ ÂŽ šÂ…Â… ž   ÂŽ Â… ž   ÂŽ •Â…

Â? ­„ ÂĄ  —

 �    … ˆ … —   Ž …

‚ Â? ­€ ˜›  Â…  ­ÂŽ ÂŽÂŽÂ…Â…

ƒ Â? ­€ Â?Â…   

Â? Â? ­„ ˜›   ­ÂŽ   …   

Â?žžžžž  žž“Â’ž Â? Â?žÂ?ž žš ÂŽžÂ?Â…Â…žÂ?Â…ž ÂŞ—…Â…

Â? ­ ÂŞ ­ …   ÂŽ   Â…Â…­ Â? ­€ Â&#x;Â…… ­ ­  Â…Â…­      ­Â? Â…Â… ‚ Â? ­„ ž­       ‚           ƒ Â? ­ §        ‚    Â? Â? ­€  ­  Â…Â…  ­ –Â…Â…žÂ?

… � ­€

¤ÂŽ ÂĄ žž‘Â…žž ÂŒž‘žÂŒžž‘ž ž  – ž  ž  ­  ž  –ž ž ž  žÂ…ž ž  ž

† Â? ­„   ­    

Â… Â? ­€ š      ­              † Â? ­    …—   – 

‡ Â? ­€ –ÂĄ žÂ’žÂŒžžž ž §¢žÂŻ­Â…žž†Â… šÂ… ž Â… ž Â? ˜…–

ˆ Â? ­„Â? ­„ ÂŒ­ ÂŽš Š ÂŽÂ…–ž—Â… ÂŽšÂ…Â…ÂŽ– ÂŽš­– ÂŽ§Â…–  ÂŽ– ÂŽ–Â…

‡ Â? ­ š­    …   Â?   Â? Â?    Â? Â?  Â? Â?  ­   €‚ ˆ Â? ­„ ¨­    ­    ƒ Â? Â?    ‚‰ Â? ­€ ­ š Â…Â…ÂŽ  ÂœÂ&#x;Âœ ¨Â…  

Nusantara

WASPADA Sabtu 29 Januari 2011

Arthalita Bebas

KPK Periksa Ketua KPUD Simalungun JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) membenarkan meminta keterangan Ketua KPUD Kabupaten Simalungan Robert Ambarita terkait penyelidikan terhadap Bupati Simalungun, Jopinus Ramli Saragih. “Selasa kemarin kita memeriksa ketua KPUD Simalungun, itu kaitannya dengan penyelidikan KPK tentang kasus dugaan suap hakim konstitusi,� kata juru bicara KPK Johan Budi yang dikonfirmasi Waspada di Jakarta, Jumat (28/1). Mengenai cek Rp 50 juta yang diterima Ketua Kelompok Kerja (Pokja) Pencalonan Komisi Pemilihan Umum Daerah (KPUD) Simalungun Robert Ambarita dugaan sebagai suap dari JR Saragih, Johan belum bisa mengungkapkannya. “Masalah cek belum tahu. Sejauh ini apakah masuk penyelidikan atau belum,� ungkap Johan Budi. Pengakuan Robert Ambarita sebagaimana berita sebelumnya dia menerima cek dari JR Saragih yang kini menjabat Bupati Simalungun senilai Rp50 juta.

TANGERANG (Antara): Arthalita Suryani alias Ayin akhirnya bebas menghirup udara segar di luar penjara LP Wanita Tangerang, Banten, Jumat (28/1), setelah mendapatkan Surat Keputusan tentang pembebasan bersyarat. “Saya akan kembali ke keluarga dan berkumpul lagi dengan karyawan,� kata Arthalita Suryani di halaman LP Wanita Tangerang didampingi kuasa hukumnya OC Kaligis. Ayin merupakan terpidana kasus penyuapan terhadap jaksa Urip Tri Gunawan sebesar 660 ribu dolar AS sehingga divonis selama 4,5 tahun terkait perkara Bantuan Likuiditas Bank Indonesia (BLBI) yang melibatkan pengusaha Syamsul Nursyalim. Namun Ayin dipindahkan dari Rutan Pondok Bambu, Jakarta Timur ke LP Wanita Tangerang karena kedapatan memiliki fasilitas mewah oleh Satgas Pemberantasan Mafia Hukum saat melakukan sidak pada 10 Januari 2010 sehingga berbeda dengan tahanan dan narapidana lainnya. Sebelumnya, Menteri Hukum dan HAM Patrialis Akbar tetap menolak remisi untuk terpidana kasus Ayin sesuai batas waktu 27 Januari 2011

dengan status bebas bersyarat. Menurut Ayin dia akan pulang ke rumah menemui keluarga dan kembali berusaha setelah selama 3,5 tahun ditinggalkan. Ketika meninggalkan LP Wanita Tangerang, Ayin bersama OC Kaligis menggunakan kendaraan mini bus warna hitam dengan nomor polisi B1600-BK menuju kantor Kejaksaan Negeri Tangerang. Bahkan Ayin memberikan keterangan kepada wartawan selama lima menit dan tak kuasa ingin cepat pulang ke rumah dan setelah itu ke kampung halaman di Lampung. Selain itu, kata Ayin, setelah bebas akan mengurus anak yang masih kecil bertemu keluarga lainnya karena sudah rindu untuk pulang. Proses pembebasan bersyarat bagi Ayin itu sempat tertunda karena belum mendapatkan SK dari Dirjen Kemasyarakatan Kementerian Hukum dan HAM, Untung Sugiono.

Perlu Polsus Pantau Makanan Anak JAKARTA (Waspada): Anggota Komisi IX DPR Subagyo Partodiharjo (F-PD) mengatakan, perlunya polisi khusus (Polsus) dari BPOM RI untuk memantau makanan yang biasa dikonsumsi oleh masyarakat mengingat semakin maraknya makanan yang mengandung zat berbahaya yang dapat mengancam kesehatan warga. “BPOM perlu mengadakan semacam polisi khusus untuk memantau makanan serta kandungan zat yang ada di dalamnya. Ini penting karena akhirakhir marak terjadi makanan siap konsumsi (snack) yang mengandung bahan kimia seperti formalin. Institusi lain saja ada Polsus,

BPOM juga perlu. Ini menyangkut langsung pada kesehatan,� kata Subagyo pada rapat dengar pendapat Komisi IX DPR RI dengan Kepala BPOM Kustantinah di Jakarta, Kamis (27/1). Sementara, Muhammad Iqbal (F-PPP) secara khusus menyoroti kesiapan Indonesia menghadapi persaingan produk obat dan kosmetik dalam Asean Cosmetic Directive (ACD). Dia mempertanyakan pengawasan BPOM terhadap obat dan kosmetika yang masuk ke dalam negeri. Menurutnya, belum saatnya bagi Indonesia untuk menghadapi persaingan di lingkup Asean itu karena Indonesia belum memiliki regulasi yang jelas. (aya)

A7 Uang itu diduga diberikan Jopinus agar KPUD Simalungun menggugurkan dua pasangan dalam Pilkada Simalungun yang digelar Agustus 2010. Yakni, pasangan Zulkarnain Damanik-Marsiaman Saragih, juga pasangan jalur perorangan, Kabel Saragih-Muliono. Sebelumnya Robert menegaskan, kasus suap telah dilaporkan ke Komisi Pemberantasan Korupsi (KPK), 29 Desember 2010. Menurut Robert, pengungkapan dugaan suap ini guna menguatkan upaya Refly Harun membongkar mafia hukum di mahkamah konstitusi. “Saya merasa terpanggil untuk mengungkap kasus ini ketika kasus penyuapan di mahkamah konstitusi meledak,� kata Robert. Dikatakan Robert, cek itu diberikan langsung oleh Jopinus kepadanya di rumah sakit Efarina Etaham, di Kota Brastagi, Kabupaten Karo. “Itu terjadi 13 Juni 2010. Sehari sebelumnya saya dijemput utusan JR Saragih dan saya menginap di hotel (Mutiara), telah dipesan JR Saragih,� jelasnya. (j02)

Dinilai Langgar AD/ART Partai

Ketum DPP PPRN Digugat Antara

AYIN BEBAS: Terpidana perkara suap dan gratifikasi, Artalyta Suryani alias Ayin, memberi salam seusai keluar dari Kantor Kejaksaan Negeri Tangerang, Banten, Jumat (28/1).

Kemenakertrans Akan Tarik 3.360 Pekerja Anak JAKARTA (Waspada): Kementerian Tenaga Kerja dan Transmigrasi menargetkan penarikan sebanyak 3.360 pekerja anak. Mereka akan ditarik dari tempat kerja kemudian me-lalui proses pendampingan di shelter untuk mempersiapkan anak kembali ke dunia pendidikan. Pada tahun 2010, Kemenakertrans telah berhasil menarik sebanyak 3000 pekerja anak dari 13 Provinsi dan 50 Kabupaten/ Kota seluruh Indonesia. Kemenakertrans pun berhasil membentuk Komite Aksi Nasional Penghapusan Bentuk-bentuk Pekerjaan Terburuk untuk Anak (KAN-PBTA) di 6 Provinsi dan 20 kab/kota. Menurut Menakertrans sekaligus Ketua Komite Aksi Nasional Penghapusan Bentuk-bentuk Pekerjaan Terburuk untuk Anak (KAN-PBTA), Muhaimin Iskandar di Jakarta Kamis (27/ 1) pihaknya mengajak pemerintah daerah dan seluruh sector terkait agar serius melaksanakan program penarikan pekerja anak dan mengawasi pelaksa-

naannya di daerah masingmasing. “Pelaksanaan Program Penghapusan Pekerja Anak dari pekerjaan terburuk harus menjadi salah satu Program Prioritas Daerah yang melibat-kan kerja sama lintas sektoral dan partisipasi aktif seluruh komponen masyarakat,� katanya. Dijelaskannya, pemerintah Indonesia mempunyai komitmen untuk menghapus pekerja anak. Komitmen ini terlihat dengan diratifikasinya kedua Konvensi ILO Nomor 138 mengenai usia minimum untuk diperbolehkan Bekerja dan Nomor 182 mengenai pelarangan dan tindakan segera penghapusan bentuk-bentuk pekerjaan terburuk untuk anak. “Komitmen ini terlihat dengan diratifikasinya kedua konvensi ILO tersebut dengan Undang-Undang Nomor 20Tahun 1999 dan UndangUndang Nomor 1 Tahun 2000. Muihaimin menegaskan komitmennya untuk melaksanakan penghapusan pekerja anak. Menakertrans menyata-

kan orang tua yang mempekerjakan anak bisa diancam hukuman penjara. “Saya sekarang menyatakan warning kepada perusahaan dan orang tua yang memperkerjakan anak. Itu peringatan yang tegas, kami peringatkan sekali, lalu siapa saja yang melanggar akan segera ditindak sesuai hukum yang berlaku,� katanya. Para pelanggar bisa dijerat Undang-undang Ketenagakerjaan (UU No. 13Tahun 2003) dan UU tentang Ratifikasi Konvensi ILO pada Pekerjaan terburuk untuk anak (UU No.20 Tahun 1999 dan UU No 1. Tahun 2000) atau UU Kekerasan Dalam Rumah Tangga. Ditambahkan Muhaimin, pemerintah menyusun Rencana Aksi Nasional Penghapusan Bentuk-bentuk PekerjaanTerburuk untuk Anak (RAN-PBPTA) melalui Keputusan Presiden No. 59 Tahun 2002. RAN-PBPTA merupakan program terikat waktu yang dibagi dalam 3 (tiga) tahapandanakandilaksanakandalam kurun waktu 20 tahun. (j04)

Desember 2010 (tiga hari pasca Muswil dilakukan), menetapkan susunan pengurus DPW PPRN Sumut dengan mengangkat tergugat II sebagai Plt Ketua DPW dan tergugat III dan IV sebagai sekretaris dan bendahara DPW PPRN Sumut. Bukit mengatakan, tergugat I juga secara sepihak telah mengeluarkan surat keputusan DPP PPRN dengan No 071/A.1/DPP-PPRN/ XII/2010 tanggal 16 Desember 2010 tentang pencabutan dan pembatalan SK No No 020/ A.1/DPP-PPRN/SK/XI/2010 tanggal 24 November 2010, tentang kepengurusan DPW PPRN Sumut. “Perbuatan semena-mena dilakukan tergugat jelas sangat bertentangan dengan ketentuan partai dan hukum serta UU yang berlaku, di samping merugikan klien kami,� jelas Bukit. Kata Bukit, dalam pokok perkara gugatan, pihaknya menyatakan sah surat keputusan No Kep.09/MUSWIL-I/PPRN-SU/XII/2010 tentang ketua DPW PPRN Sumut terpilih masa bakti 2010-2015, dan memerintahkan tergugat I untuk menerbitkan SK tentang kepengurusan DPW PPRN Sumut, sesuai dengan hasil Muswil. Menyatakan SK No 071/A.1/DPP-PPRN/ XII/2010 tanggal 16 Desember 2010 tentang pencabutan dan pembatalan SK No 020/A.1/ DPP-PPRN/SK/XI/2010 tanggal 24 November 2010, tentang kepengurusan DPW PPRN Sumut, tidak sah dan tidak berkekuatan hukum. Kemudian menyatakan semua keputusankeputusan hukum yang dikeluarkan tergugat Is/d IV adalah tidak sah dan tidak berkekuatan hukum. “Dalam gugatan yang kita layangkan, merupakan keputusan dari dewan pengurus DPW PPRN hasil Muswil dan bukan secara pribadi ketua DPW,� tutur Bukit. (m49)

MEDAN (Waspada): Ketua Umum Dewan Pimpinan Pusat (DPP) Partai Peduli Rakyat Nasional (PPRN) Amelia A Yani digugat Dewan PimpinanWilayah (DPW) PPRN Sumatera Utara di Pengadilan Negeri (PN) Medan, Kamis (27/1). “Gugatan kami secara resmi sudah diregister di PN Medan,� kata Bukit Sitompul, SH kuasa hukum penggugat Ketua DPW PPRN terpilih Jumongkas Hutagaol dan Ir Mangatur Tobing, kemarin. Bukit mengatakan, selain Amelia A Yani (tergugat I), turut digugat Jikson P Manik selaku tergugat II dan Irwanto Tampubolon serta Rinawati Sianturi selaku tergugat III dan IV. Alasan gugatan, sebut Bukit, karena tergugat I diduga telah melakukan pelanggaran AD/ART kepartaian dengan tidak melantik dan mengesahkan kepengurusan Ketua DPW PPRN Sumut sebagaimana hasil musyawarah wilayah (Muswil) I PPRN, 14 Desember 2010, dengan No Kep.09/MUSWIL-I/PPRN-SU/XII/2010, masa bakti 2010-2015. Pada Muswil tersebut Jumongkas Hutagaol terpilih secara aklamasi sebagai ketua DPW PPRN Sumut. Muswil diselenggarakan berdasarkan hasil surat keputusan dari dewan pimpinan pusat PPRN No 020/A.1/DPP-PPRN/ SK/XI/2010, 24 November 2010, tentang kepengurusan DPW PPRN Sumut. Bukit mengatakan, Muswil digelar sesuai surat keputusan DPP PPRN, 1 Oktober 2010, tentang susunan kepanitian Muswil I DPW PPRN Sumut. Pertimbangan lain mengajukan gugatan, kata, Bukit, tergugat I secara semena-mena telah menerbitkan surat keputusan DPP PPRN No 077/A.1/DPP-PPRN/XII/2010 tanggal 17

4 ‚

Â?Â…  Â…  ‰ Â…  “ Indikator

     



Metil Merah Brom Kresol Hijau

          Â?  Â? Â?   Â?  Â?    

     

Phenol ftalein

”  …”  Â…      „ † 



  …” ≤ ‚   ‰  ≤ …” ≤



 

Â? …” ≤ ‰   ‰  ≤  …” ≤





 

Â? …” ≼ ‚   …” ≤



­           €      Â?€ Â?‚ Â?

P e rc o b a a n

Vo lu m e H C l y an g d ititra si 20 mL 20 mL 20 mL

Vo lu m e N a O H y an g d ig u n a k an 15 mL 14 mL 16 mL

ƒ„  Â…   Â…      Â…  †     Â?  ‡  Â?ˆ‡  ”  Â?‡‡‡  Â?ˆ‡‡‡  ž ž¥ž› Â?ž ›  ‡ˆ ‰ Â?ž ž¥‘› Â?ž ‰›  ž ž‚ž› Š   ‹†‹

‰

ŒŽ S en y a w a Q R

T itik L e leh (°C ) −1 1 5 810

ž

D a y a H a n ta r L ist r ik L e leh a n L a r u ta n T id a k M e n g h a n ta rk an M e n g h a n ta rk an M e n g h a n ta rk an M e n g h a n ta rk an

 Â?  Â… ŒŽ†   Â? Â…Â     Â?  Â?   Â…Â        ��? Â…  Â?Â…Â  Â?  Â?       Â?  Â?   Â…Â    

Â&#x;Â…¢ “ L a r u ta n pH aw al D itam b ah s e d ik it a s a m D itam b ah s e d ik it b a s a D itam b ah s e d ik it a ir

I 4 2 ,5 0

II 5 3 ,9 0

III 7 4 ,5 0

IV 8 7 ,8 0

6 ,6 0 5 ,2

V 10 5

6 ,1 0

10

8 ,1 0

12

5 ,9

6 ,5

7 ,6 0

85

ÂĄ

Â?       ‚  Â…   ‡  ‡‡‡ Â?ˆ Â?‡‡ Â?‡ˆ

¤     Â…“        ¢   †          ‰        Â… ‘      ¤       Â… Â…   Â? Â?Â… Â?    •        Â…     Â…   Â…¢   Â… Â?  Â…Â…    Â?  Â?  Â?     Â&#x;       Â?Â…™      Â&#x;   Â…™  Â…    Â…    Â? …  Â? Â?      Â’           Â?  Â?Â…  Â?     Â…     ™    Â…   Â…Â     Â…Â…Â…   

Â’  Â…  Â… “ ­” ‰  •– ‰—  ˜ ™–” — → ­”    ˜ ”–˜™•–‰— ÂŽ  Â…–š    ˆ        ­”         ­” ‰•– ‰ ›Âœ  ‚      Â?  ‰ Â?‘

�   ž



Â? Â…†     Â…          Â…‹       ÂŽ Â…     ˜”– →  –”—˜ ”  ­ ‡ƒÂ&#x; Â…        Â?       Â?   Â?   

ÂĄ

‘

Â?     ”   ­–”ž › 1 2 3





 ≤ …” ≤ ‚ ‘ ‰ ≤ …” ≤ 



Â?

 ≤ …” ≤ ‚   ‰  ≤ …” ≤







‘

Trayek Air pH b h Warna X i b h Y Merah − Kuning Jingga Kuning Biru Biru 3,8 − 5,4 Kuning− Biru Tidak Tidak Tidak 8,3 − 10,0 Berwarna Berwarna Berwarna − Merah 4,2 − 6,3

”Â… Â…    “  Sumber Mata Air K L M N O

Pengamatan Gelembung Nyala Lampu pada elektroda Tidak Menyala Tidak ada Terang sedikit Redup Sedikit Tidak Menyala Sedikit Terang Banyak

•         Â…     Â…   ¢ ™ÂŁ Â?ÂŁ­ Â?™› Â?­–  ÂŁ›

™ Â&#x;  Â…  Â… Â…  Â…• Â&#x;™    Â…   Â… ‹•  Â…Â…Â…Â&#x; Â&#x;™     € ™ Â…  ‹   ‹   Â…Â…Â  Â? Â…    Â…   Â?  Â…   Â? Â…

ž

Â?   Â? Â… 

Â? Â…       ¢ Â…       Â…     Â… ¢†¢                    Â?         Â?    Â?    

  �‰

�‘

„     Â…    

‡ �‡‡

Â?    Â…   Â…Â…Â 

 Â… Â?Â…  

 Â?

  ‡‡‡ �‡ˆ

�ˆ

¤ “ Â… ‰   ‘       …   ‡      ‰ ‘ Â? ‰ ‘    ‘   ‰  Â?     Â?  ‰  

  ‡     •  Â&#x;    Â? ‡    Â?  Â? Â…    Â? ‡       Â…            ›   Â…                      ”       Â…   Â…  Â?Â… 

Â?¢ ¢ ÂŚ ™Â… Â?   ‰‘Œ  ”   Â…   Â…  Â…­ •         Â…¢    §Â?     ¨Š      ‰ §Â?           ¨ Â?Â…    †   ‘ Š       Â… Â…        ÂŽÂ… Â…•Â…     ¨ Â?™  ÂŚÂ?      Â&#x;  ¨ÂĄ§Â?  € Â…Š‚§£        Â&#x;™Â…Š

  …     ……  …

 Â…  Â… †   Â… ™Â?  ÂŁ   Â…‹     ™ Â…     Â…   Â…        Â… Â…Â… ‹    Â…   Â?              Â?   Â?   Â…

      Â&#x;  ¢    Â… ™ …  Â… Â…Â…   ™   Â…    Â…   Â…  Â… 

 Â…     Â? Â? ­ • ‡ Â…Â… Â…   ™ …Â…   ‰ •Â…    Â? ™ Â…         Â…   Â?        … Š     Â…  Â…    Â…   

 … ¢   Â?    Â…  Â…  Â…  Â…   Â…Â…   Â…      Â…†           ™ Â…   Â…      Â…    Â?      Â…      Â… Â…Â… 

 Â… 

Â?      ‹  Â…   Â…Â…    Â… Â? ™ Â…  ‘ Â&#x;Â…­ •  ™ Â…   Â…   Â…  Â…    Â…Â… ‹ ¢    Â… Â…

  ‹Â? Â… Â? Â?       Â…  Â…Â… Â… Â?  ‹Â? Â… ‹  Â…†…   Â? ™ Â…      ‹‹ Â… ‹ Â?  Â…        Â… Â?  ‹‹ Â… Â?   Â…  

Â?        Â?  ‹Â? Â… ‹ Â…   Â…Â…   Â…        ÂŽ   Â… ž        Â&#x;   “ •     ÂŽ  Â?“•ƒÂ&#x;Â?Ž­–ˆ    Â…Â     Â’ †  Â&#x;“Â?Â?ÂŁ  ‡      Â&#x;“ŠÂ?    Â…   Š¢†ÂĄ“žž

™      Â…    ‡•Â?­“€¥€†€ ‘¥†ž†  Â…Â… Â… Â&#x; “    “‚   ¢  ™ Â… “ ŠÂ?  …  Â?  ÂĽ¢ Â?Â?  Â…  Â…Â     Â?Â…“    •  Â…¢ ™      Â… Â?Â&#x; Â… Â…        Â…      Â?Â&#x; Â…  Â… žž ™  Â…  Â…   •   ¢ ÂĄ         Â…    Â&#x; Â… “ ÂŚ Â…   Â…¢   ŠÂ?   …   Â…Â  Â&#x; “ ™  ¢    ¢     Â…        Â…     ™    Â…     Â? ŠÂ?   …   Â…Â   Â?       Â&#x; Â… “ ÂŁ Â…   Â?           ¨       Â…  Â?ÂŁ  Â?Â? Â? Â&#x; “         Â…  Â&#x; Â… “       ŠÂ?   …   Â…Â  Â…¢      ÂŚ         Â… ¢     ¢   Â… Â… Â&#x; “ › Â… Â? ­ Â?Â? Â? Â? Â? ŠÂ?   …   Â…Â  ÂŁ      •            ¢ Â&#x; Â… “ „   Â…��¨    Â…Â ‡       Â&#x; “ ”   Â… ¢     Â? ŠÂ?   …   Â…Â   Â…   ­ Â? Â? Â?           Š Â?   Â…    Â…Â   ‡  ™    Â…   Â…     Â…     Â… Â?  Â? ­ Â?Â? Â?Â?ÂŁ  

Â?Â&#x;•  ¢    

  Â?     Â…¢   Â…  Â?Â?         Â?›  Â… Â… ¢   Â? ­ Â? Â? Â?    ‚    ­ €  Â…      †      Â…  ¢    ‹  ‹  Â&#x;  ª  Â…       ™Â?  ÂŁ ¢Â…  ÂŤ  Â… ¢    Â…    Â…   









p B B  S S

 Â’  Â… Â…   Â…  Â…   “   ‹ÂŹÂŽ Â?  → ÂŞ     ‹ÂŹÂŽ„‡™£• →  Â…  ™“  Â… →   Â…      ‡  “  Â&#x;¢ →  Â…      ÂŁ  Â…              Â…     Â…     –  “ Â…     Â…Â  Â…     Â… 

q B S B S



  ‡ §ŠÂ… Š  Â…  Š • §•Â…    •Â… Š ‡  §Â?Â…   Â… Š 

(

 − ‘ )(  + ‘ )

Âœ ˜ ‘ ÂŻ ‘ ÂŻ‘

â‹…

− 

 Âœ¯‘  

 ™ Â?     



 ›     ¢ Â…  Â…     ¢   Â…   ‡‹   Â… ¢Â…Â… ‹†   †   ‚



 Â&#x;    Â… Â…      ¢  ƒ„‡‹    Â…Â… ‹†  †       ¢Â… 



 ‡  ¢      ‡‹    Â… Â…¢ €       

 

 Â?  ´‰ žž Â…         ¨ Â?  ¢ ‹       Â…      ‘ž¾                   …†‡ ˆ   Â?  Â?     Â…  Â…       ´‰

  ´

 

 Â&#x; Â…‘ž¾           

 

 •             Â…¢ Â…‡‹    Â…  Â… ‹ †‘

 †



Parenkim palisade

 Š    ‹ÂĽÂœÂĽÂŻ˜

Parenkim spons

ž ‘Âą‘ÂœÂŻ˜ ⇒ Âœ

Epidermis bawah

∴ ‹ÂĽÂœÂœÂĽÂŻ‰¼˜‘

Kutikula Stoma Berkas pembuluh

Floem



œ (‰ )− ‰ ⋅ (−‘ )− ‘

Kolenkim



Xilem

 Â&#x;   ¢      ¢       Â… Â…Â…



− ‰



 ‹²ÂĽÂœ¯‰¼˜‚Âœž ÂĽÂœ ‹ÂœÂŻ˜‚˜žÂœ‚

 

 Âœ²Âœ‚¼˜Âœ‚˜Âœ Â&#x;    “



ÂŻ Âœ ÂĽÂŻÂĽ    ‰ ‘



 

•    Â? Â? •   ⇒  Â…      

ÂŻÂœÂĽÂŻ ÂœÂĽÂŻž ÂĽÂŻÂœž  ÂœÂĽÂŻÂĽÂŻ‚

ÂłÂœÂĽÂŻÂœž ⇒ ÂĽÂœ  Â’  Â…Â?   ÂœÂŻÂŻ‚Âœ¯€  Â…   ‹ –     –   ¯€    –    Â…       

 ÂŽ        ‹     ‹ Â…

ÂĽ →∞

 €¼  − ž¼ +  − ( ÂĽ + )

 −ž −  œ

Â… 

œ  €

−ž −

−

−‚ œ œ

 

 Â&#x;   Â… ‹ †    Â…    Â…        Â… ƒ Â…  Â…¢‹ 

­  Â?                   Â?



œ˜ ‘

Âœ‚Âœ‰Âœ

Epidermis atas

Sel penjaga

¢‹ † Â… ‹ †   Â?      Â?            

(p ∨ q) → ~q S B S B

 Â&#x;      ÂœÂŻ°Âœ ‰ ÂĄ ÂŚ Kutikula



(p ∨ q) B B B S

~q S B S B

 

3

    “    Â…   Â&#x;     Â?„Â?   ‡     •  Â&#x;    Â? ‡    Â? • Â? Â&#x;   

 Â?    ¢“ ™   ™ Â…¢

 ‡     ƒ­  Â…  ‡‡ •ƒ­  Â…  ∴ •

 Â&#x;   ¢       Â&#x;  

Agenda

A8 07:00 Film Keluarga Brother Bear 0 9 : 0 0 D A H S Y AT Weekend 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 DAHSYA nya Awards 2011 16.00 BEDAH RUMAH 17:00 Seputar Indonesia 17:45 Lagu CInta Nirmala 19:30 Putr i Yang Ditukar 21:30 AFC ASIAN CUP 2011 24:00 BOM: CONNECTED

CATATAN

07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:00 Get Married Series 17:00 Liputan 6 Petang 17:30 Uya Emang Kuya 18:00 Islam KTP 19:30 Bintang Untuk Baim 20:00 SL Liputan 6 Terkini 21:00 Arini 2 22:33 Film LAyar Lebar

07.00 Animasi Spesial 08.30 Santapan Nusantara 09.00 Cerita Pagi 10.00 Cerita Pagi 11.00 Jendela 11.30 Sidik Kasus 12.00LAyarKemilau 14.00 Layar Spesial 16.00 Lintas Petang 16.30 Zona Juara 17.30 Animasi Spesial 18.00 Upin Ipin 18.30SinemaSpesial 19.30 Keluarga Z 2 0 . 0 0 Ta w a r Tawaran Tawa 21.00 Sinema Malam 23.30 Jendela 00.00 Lintas Malam

07.00 Star Kids 08.00 Sinema Pagi 10.00 Kabut Cinta 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 15.00 Djarum Indonesia 17.00 Topik Petang 17.30 Katakan Katamu 18.30 Super Family 19.30 Super Deal 2 Milyar 21.00 World Most Amazing Video 22.00 Mohon Ampun Aku 23.00 Telisik 00.00 Topik Malam

07.00 Sinema Keluarga 09.00 KiSS Plus 10.00 Arti Sahabat 12.00 FTV Siang 14.00 Fokus 15.00 Liga Premier Indonesia 17.00 1 Lawan 100 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri Season 2 21.00 Gebyar BCA 22.00 Just Dance 00.00 Liga Italia serie A 01.00FokusMalam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.30 Metro Xin Wen 11.05 Oprah Winfrey 13.05 Spirit Football 13.30 Expedition 1 4 . 3 0 Te t a p l a h Bersamaku E l f a Secioria 16.05 Super Nanny 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Metro Files 20.05 Face To Face 21.05 Top Nine News 21.30 World Cinema 22.05 World Cinema 23.30 Metro Sports

WASPADA Sabtu 29 Januari 2010

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Extravaganza 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 20.00 Primitive Runaway 21.15 Bioskop TRANS TV 23.15 Bioskop TRANS TV 01.30 Reportase Malam 23.30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

06.30 Apa Kabar Indonesia 08.30 Chevrolet Spark Amazing Kiss 09.30 Tinju Legendaris 10.30 Soccer One 11.00 Prediksi 12.00 Kabar Siang 13.30 Bangkitlah Indonesiaku 15.00 Documentary Indonesia 16.00 News Bus 17.00 Tepi Jaman 17.30 Kabar Petang 19.00 Tokoh 20.00 Apa Kabar Indonesia 21.00 Local Documentary 22.00 Ketemu Pepeng 23.00 Kabar MAlam 23.50 Liga Spanyol (live) Real Sociedad vs Almeria

08.30 The Penguin 09.00 One Piece 10.00 Danamon Semangat Bisa 10.30 MuppetTreasure Island 12.30 Kabaret Show 13.30 Genie 14.00 One Cubed 14.30 Petualangan Panji 15.00 Ill Feel 15.30 Ugly Betty 16.30 Berita Global 17.00 Spongebob 18.00 Super Hero Kocak 19.00 FA CUP 20102011 21.30FACUPm20102011

07.30 Selebrita Pagi 08.00 Tom & Jerry 09.00 Scooby Doo 10.00 Mariam Mikrolet 11.00 Rahasia Sunnah 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Bintang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Asal Usul Fauna 18.00 Selebrita Sore 18.30 Pintu Kejutan 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Mata Lelaki 00.00 Jam Ma 19.00 Vicky & amp-amp 20.00 Sinema Asia **m31/G

Seribu Personel Jaga Sidang Vonis Ariel

Ariel/etdah.com

Seiringrencanapuluhanartis akan ‘menyerbu’ sidang vonis Ariel, aparat kepolisian tak mau kalah dalam menempati jumlah personelnyadiPengadilanNegeri Bandung. Demi mengantisipasi membludaknya masyarakat, terdiri dari kelompok massa kontra dan para penggemar Ariel serta Luna Maya,yangdiprediksiakanmemadatigedungPNBandung,koordinasi antara aparat kepoli-sian, kejaksaan, dan PN Bandung pun telah dilaksanakan Jumat (28/1).

Aora Gandeng FSI Gaet Pecinta Film Nasional Aora, penyedia layanan televisi satelit, mengukuhkan diri sebagai yang pertama menyajikankontenfilmIndonesiadengan menggandeng Saluran Film Indonesia (SFI) untuk menarik para pecinta film nasional. “Aora kini menjadi satu-satunya layanan televisi satelit yang mempunyai saluran khusus film Indonesia,” kata Guntur Siboro, DirekturMarketingdanSalesAora dalam acara peluncuran ‘aora TV Satelit’ di Grand Indonesia Jakarta. Dengan saluran televisi khu-

susfilmIndonesiaitu,Aorahendak menunjukan komitmennya untuk menjadi layanan televisi satelit utama bagi keluarga Indonesia. “Ini menunjukan komitmen dan inovasi Aora untuk menjadi pilihan utama televisi satelit bagi keluargaIndonesia,”paparGuntur lebih lanjut. Sementara itu pihak SFI menyatakan telah mempersiapkan sekitar 200 judul film untuk ditayangkan selama 2011 ini. “Kami akan menayangkan sekitar 200 judul film pertahun termasuk

pada 2011,” ucap Agus Ichwanto dari SFI. Dari jumlah itu akan terdapat tiga kategori film yakni klasik, vintage, dan baru. Film klasik meliputi film-film lama karya penulis Asrul Sani atau Chaerul Umam. Film jenis ‘vintage’ meliputi karya-karya keluaran tahun 1970an sampai 1990 awal. Selain juga film-film terbaru. “Untuk kategori film baru akan ditayangkan dua judul perbulan sementara sebagian besar tayanganakanmenampilkanfilmfilm dari era 1970an,” (ant)

Rencananya, aparat Polrestabes Bandung dibantu Polda Jawa Barat, akan menyiagakan 1000 personel keamanan demi menjaga keamanan di dalam ruang sidang, gedung, dan juga di jalan-jalan sekitar gedung Pengadilan Negeri. Sidang vonis Ariel akan digelarSenin,(31/1)akandiperketat keamanannya. Sama halnya seperti sidang perdana digelar 22 November 2010 silam. “Kita siapkan personel sekitar 956 orang yang melakukan pe-

ngamanan secara tertutup dan terbuka,” ujar Kapolrestabes Bandung Kombes Pol Jaya Subrianto, kepada wartawan, ditemui di Mapolrestabes Bandung, Jumat (28/1). Dari jumlah tersebut, sebanyak 556 orang dikerahkan dari Polrestabes dan jajarannya. Sementara Polda Jawa Barat akan menurunkan sebanyak dua Satuan Setingkat Kompi (SSK) dari Satuan Dalmas. “Kita juga dibantu personel

Ayah Syahrini Meninggal Dunia

Penelope Cruz Jadi Ibu Aktris berkebangsaan Spanyol Penelope Cruz saat ini mendapat predikat sebagai seorang ibu. Menurut sumber, aktris juga bintang model kelahiran Madrid, Spanyol ini masuk rumah sakit Cedars-Sinai Medical Center di Los Angeles awal pekan ini dan melahirkan pada Selasa lalu. Kabar Cruz melahirkan itu dimuat di surat kabar El Pais terbitanSpanyol.Jikamemangkabar itu benar, bayi itu ternyata lahir bersamaandenganharilahirsang ayah, Javier Bardem. Juru bicara Cruz pernah membeberkan cerita pada September tahun lalu menyatakan bahwa aktris berusia 36 tahun itu dan suaminya, Bardem memang menanti kelahiran anak pertama mereka pada awal 2011 ini. Ketika sedang hamil, bintang bernama asli Penélope Cruz Sánchez menjadi wanita terseksi, menempati posisi teratas di salah satu poling situs pria dewasa. Situs ini membagi poling menjadi dua, dengan responden pria dan wanita. Penelope dipilih

Penelope Cruz/contactmusic.com

para responden wanita mengikutipolingini,mengalahkanAngelina Jolie, Halle Berry dan Jennifer Aniston. Sedangkan, juara bagi para pria adalah aktris baru saja bertunangan, Natalie Portman, mengalahkan Halle Berry dan Angelina Jolie. Sejak 1988, Cruz berkarier di dunia film dan terkenal saat ber-

main di film utamanya seperti Blow, Vanilla Sky, dan Bandidas. Sebelum menikah dengan Bardem, Cruz pernah menjalin cinta dengan aktor film Matt Damon ketika satu scene dalam film All The Pretty Horses, tahun 2000. Berikutnya Cruz jatuh ke pelukan aktor ganteng Tom Cruise, setelah sama-sama main dalam film Vabilla Sky. Meski mampu bertahan hampir tiga tahun, hubungan mereka akhirnya tidak dapat bertahan dan berakhir dengan perpisahan. Kemudian, ketika beradu akting dalam film Sahara bersamaMatthew McConaughey,lagilagi Cruz terlibat cinta asmara. Tapi cinta mereka kandas pada Mei 2006. Cruz menikah dengan Bardem (nominator Aktor Terbaik dalam Academy Award atas perannya di Biutiful) dalam upacara pernikahan tertutup di Bahamas, Juli tahun lalu. Rencananya, mereka akan mengadakan upacara memandikan bayi di rumah Cruz di Los Angeles bulan ini juga.(ananova/ ajekoi)

dari Polda Jabar dua SSK Dalmas Polda Jabar, satu unit APC, satu unit AWC (water canyon), satu unit Public Adress, dan satu SSK PHH Brimob, totalnya sekitar 400 orang. Jadi kalau dengan kita hampir seribu personel,” terang Jaya. Pihaknya memberlakukan pengamanan seperti itu lantaran mengantisipasi hal-hal yang tidak diinginkan. “Kita hanya jaga-jaga agartidakterjadiapa-apa,”ungkap Jaya.(okz)

Syahrini/blogspot.com

Penyanyi Syahrini sedang berduka, ayahnya, Dadang Zaelani meninggal dunia Jumat, (28/1) pukul 05.45. Menurut manajer sekaligus adik Syahrini, Rani, ayahnya memang sakit sejak lama dan sempat sembuh. Tetapi kembali jatuh sakit lagi dan harus menjalani perawatan di rumah sakit MMC, Kuningan, Jakarta Selatan. “Ayah memang sempat

menjalani perawatan di MMC. Ayah sempat koma tiga hari,” kata Rani saat dihubungi VIVAnews melalui sambungan telepon, Jumat (28/1). Syahrini mengaku sangat berduka dengan kepergian ayahnya tersebut. Mantan teman duet Anang ini mengungkapkan perasaan berdukanya melalui akun twitter pribadinya. “Inalilahi waina ilaihi rajiun’ selamat jalan papah’,”

Angie Virgin

ucap Syahrini di twitter. Sementara Rani mengatakan ayahnya akan dimakamkan di Bogor, Jawa Barat.

Angie Virgin Tinggalkan Suami Di London

Jangan Tinggalkan Shalat Syahrini terlihat terpukul di hadapan jenazah ayahanda, Dadang Jaelani, yang menutup mata di usia 60 tahun. Sebelum meninggal, Syahrini pun sempat diberi pesan oleh sang ayah. “Ya, papa pesan agar jaga keluarga baik-baik. Jangan lupa shalat lima waktu,” papar kakak kandung Syahrini, Iwan kepada wartawan di rumahnya, Jalan Bitung I, NO 12 Haur Jaya, Kebon Pedas, Tanah Sereal, Kota Bogor, Jumat (28/1). Mungkin inilah alasan Syahrini yang tidak hadir dalam acara malam penganugerahan ‘Dahsyat Awards 2011’, Rabu, (26/1). Saat itu, Syahrini dikabarkan kurang sehat. Namun dari kakak kandung Syahrini, Iwan, ayahanda telah koma sejak dua hari sebelum tutup usia, yakni sejak Rabu lalu. Almarhum Dadang Jaelani meninggal dunia di RS MMC Jakarta pukul 04.50 setelah dirawat selama dua bulan. Syahrini sendiri belum bisa dimintai komentar. Sejak tiba di rumah, Syahrini terus menangis di hadapan jenazah ayahanda. Almarhum Dadang Jaelani meninggalkan tiga anak, Iwan, Syahrini.(vvn/okz)

BERDALIH demi kelancaran berbicara putri pertamanya – Serra Abbie (3 th) sekaligus menghapus kerinduannya ber-aktingria, artis Angie Yulia yang akrab disapa Angie “Virgin” terpaksa meninggalkan sang suami – Habibi Syaaf yang bekerja sebagai Polisi Inggris di London. “Hingga berusia dua setengah tahun, Serra belum bisa berbicara lantaran masih bingung harus bicara bilingual (dua bahasa). Karena suami saya dalam berkomunikasi sehari-hari menggunakan bahasa Inggris sementara saya bahasa Indonesia. Nah, demi masa depan dan kelancaran berbicara sang putri, saya terpaksa meninggalkan suami di London,” papar Angie Virgin kepada Waspada di Jakarta, baru-baru ini. Ditemui selepas jumpa pers Disney On Ice “Worlds of Fantasy” 2011 yang bakal digelar Big Daddy Productions di Istora Senayan Jakarta(14-18April)danJatimExpo–Surabaya(22-25April)mendatang, bintang filmVirgin kelahiran Serang, 25 Juli 1983 ini menambahkan, suaminya tak mungkin bermukim di Jakarta lantaran terlanjur mendapat Green Card di Inggris dan diangkat resmi menjadi Polisi di London dua tahun terakhir. “Yang penting, suami saya mengizinkan saya sementara kembali ke tanah air bersama anak-anak. Pasalnya, kalau di London – selain lingkungannya kurang kondusif untuk kelancaran bicara Serra, saya pun agak kerepotan mengasuh dua anak di negeri orang,” tandas Angie yang melahirkan putra keduanya Eliyas Aidan Dude Syaaf secara cesar di London, 16 Agustus 2010 silam. “Keputusanberanisayaberpisahdengansuami,kinimembuahkan hasil. Berkat tinggal lingkungan keluarga besar kami di Jabodetabek, Serra tumbuh pesat dan sehat serta mulai lancar berbicara walau lebih banyak menggunakan bahasa Inggris sesuai anjuran psikiater. Lebih menggembirakan lagi, dia kini secara bertahap mulai bisa menghafal beberapa kata-kata Indonesia dan berkomunikasi singkat dengan bahasa Ibunya,” tambah . Tentang kesehariannya kembali disibukkan ber-akting-ria dengan membintangi Sitkom Sketsa ditayangkan stripping di TransTV, Angie berkilah dirinya punya kiat jitu dalam membagi waktu. “Kembali berakting-ria, memang bagian dari upaya saya untuk menghapus kerinduan melakoni karir keartisan. Tapi, kegiatan back to basic ini tak bakal mengganggu peran saya sebagai orangtua tunggal sementara waktu. Bahkan, agar si kecil yang belum genap enam bulan tetap mendapat ASI teratur, Eliyas kerap saya bawa ke lokasi syuting,” kilah Angie. “Kebetulan, ketika masih tinggal di London, Oktober lalu saya dan suami serta anak-anak berkesempatan nonton Disney On Ice. Selain mampu membuat penonton terpukau dan berdecak kagum terhadap karakter Princess yakni Snow White dan Rapunzel serta Cars, tontonan di atas panggung es raksasa itu bagus untuk merangsang daya imajinasi dan fantasi para anak. Karenanya, saat Disney On Ice menggelar pertunjukkan di Jakarta medio April 2011 nanti, saya kembali mengajak Serra dan Eliyas menonton langsung,” tekad Angie menutup pembicaraan. * (AgusT)

Luar Negeri

WASPADA Sabtu 29 Januari 2011

A9

Ribuan Orang Lakukan Protes Di Jordania, Tuntut PM Mundur

Pasukan Irak Siaga Setelah Serangan Bom Di Baghdad Yang Renggut 53 Jiwa

AMMAN, Jordania (AP): Ribuan pendukung oposisi Jordania turun ke jalan di ibukota Amman Jumat (28/1) guna menuntut agar PM mengundurkan diri dan mereka melampiaskan kemarahannya pada kenaikan harga, inflasi dan pengangguran. Kira-kira 3.500 aktivis oposisi dari kelompok oposisi utama Islamis, serikat buruh dan organisasi sayap kiri berkumpul di Amman. Kerumunan itu mengecam kebijakan tak populer PM Samir Rifai’s. Banyak di antara mereka meneriakkan: “Rifai pergi, harga-harga terbakar di Jordania.” 2.000 Pemrotes di beberapa kota Irbid dan Karak telah membuat imbauan yang serupa. Rapat umum Jumat itu menandai hari ketiga aksi protes tersebut di Jordania itu terinspirasi oleh kerusuhan di Tunisia dan Mesir yang menuntut dijatuhkannya pemerintah. Raja Abdullah II telah menjanjikan beberapa pembaruan.(m10)

BAGHDAD, Irak (Antara/AFP): Pasukan keamanan Irak berada dalam siaga Jumat (28/1) setelah serangan bom mobil pada satu acara pemakaman di distrik Syiah Baghdad, menewaskan 48 orang dalam hari paling berdarah di Irak dalam lebih dari dua bulan. Ledakan Kamis itu adalah peristiwa terbanyak menelan korban jiwa dalam serangkaian serangan bom yag menewaskan 53 orang di seluruh ibukota itu dan membuat massa marah dengan melemparkan batu ke pasukan keamanan ketika mereka tiba di lokasi kejadian itu. Itu adalah serangan terbaru dalam aksi kekerasan 10 hari belakangan ini yang menewaskan lebih banyak korban ketimbang serangan-serangan dalam tiga bulan dan terjadi kurang dari sebulan setelah Perdana Menteri Nuri al Maliki membentuk pemerintah koalisi, yang mengakhiri kebuntuan politik setelah pemilu Maret. “Pemerintah menahan para teroris, mereka mengirim ke penjara dan kemudian mereka membebaskan mereka pada ha-ri berikutnya,” teriak Abu Mohammed Saadi, 56, salah seorang yang mengikuti acara pemakaman itu. Seorang pejabat kementerian dalam negeri mengatakan bom mobil itu, yang meledak di luar satu tenda di mana acara itu diselenggarakan Kamis petang, menewaskan 48 orang dan mencederai 121 orang. Saadi dan para saksi mata lainnya mengataan bom mobil itu dilakukan seorang penyerang bunuh diri. Ledakan itu menyebabkan bagian dari tenda itu ambruk dan menimbulkan percikan darah dan potongan-potongan pakaian dan sepatu-sepatu bertebaran. Beberapa mobil juga hancur, sementara jendela rumah-rumah dekat lokasi itu berantakan. Pasukan keamanan menutup banyak jalan utama menuju lokasi ledakan itu dan memberlakukan jam malam bagi kendaraan. Polisi dan tentara yang dikerahkan ke lokas itu menghadapi massa yang marah yang menyerang mereka dengan lemparanlemparan batu, dan pasukan keamanan mundur dari lokasi itu. Pejabat kementerian dalam negeri mengatakan “pria-pria bersenjata” menembaki pasukan yang pertama tiba, yang menyebabkan tentara dan polisi mundur sampai resimen tentara lainnya tiba.

Seorang Warganegara AS Yang Kagumi Gandhi Mati Bakar Diri JAIPUR, India (AP): Pada malam yang dingin di kota yang tenang Jaipur, seorang pria AS berusia 71 tahun, Jeff Knaebel, merayap ke dalam reruntuhan kuil kuno yang sering digunakan untuk meditasi Buddhis di India Utara. Dia kemudian menyiramkan bahan bakar ke tubuhnya, kemudian menyulut api guna memprotes apa yang disebutnya kekejaman di Amerika Amerika dan India. Itu adalah suatu akhir politik bagi seorang politisi: seorang pengagum perjuangan kebebasan Mohandas K. Gandhi dan seorang pensiunan insinyur pertambangan yang telah mencerca perang pimpinan AS di Irak dan Afghanistan dalam berbagai pidato dan blognya. Pada tahun 2009, dia berdiri di tugu memorial Gandhi di New Delhi dan merobek paspor Amerikanya, yang secara simbolis dia membatalkan kewargaan Amerikanya. “Saya bukan seorang warga dari pemerintah manapun. Saya meninggalkan mereka semua, “ katanya dalam satu pernyataan. Namun kemudian usahausaha untuk memperoleh suaka di India dan kewarganegaraannya ditolak dan dia menghabiskan waktunya sepanjang bulan lalu hilir mudik di utara India, berpindah-pindah tempat untuk menghindarkan penangkapan karena dia tidak memiliki dokumen sah, kata teman-temannya. “Penolakan kewargaannya dan buronan polisi membuatnya sangat berputus-asa, namun dia terus untuk meyakini prinsip Gandhi dan selalu mengatakan dia tidak akan kembali ke AS dan akan mati di India,” kata temannya sesama insinyur VK Desai. Dia ingat Knaebel sebagai seorang intelijen dan orang terhormat, bahkan dia termasuk seorang dermawan yang senang memberikan uangnya kepada orang miskin. Rabu sore, para penduduk desa menemukan mayat Knaebel yang hangus di dalam satu kuil kuno Buddha di Virat Nagar, satu kota 150 km utara Jaipur, ibukota negara bagian Rajasthan, kata polisi. (m10)

Reuters

PEJABAT AS DIHADAPKAN KE PENGADILAN PAKISTAN. Seorang pekerja konsulat AS (tengah) dikawal polisi dan sejumlah pejabat setelah menghadap seorang hakim di Lahore, Pakistan, Jumat (28/1). Satu pengadilan Pakistan Jumat menetapkan pekerja konsulat AS itu harus tetap di bawah tahanan polisi selama enam hari untuk menjalani penyelidikan setelah dia dituduh membunuh dua orang dalam satu tembak menembak di timur Lahore Kamis. Medis Pakistan menyebut pejabat konsulat AS sebagai Raymond Davis namun tidak ada konfirmasi dari Kedubes AS.

Kamboja Tolak Permintaan Thai Agar Turunkan Bendera Di Pagoda Yang Disengketakan

Presiden Nazarbayev Bertekad Akan Berkuasa Selama Mungkin

PHNOM PENH, Kamboja (Antara/XinhuaOANA): Kamboja Jumat (28/1) menolak permintaan PM Thailand Abhisit Vejjajiva untuk menurunkan bendera di pagoda dekat kuil Preah Vihear, menurut pengumuman dari Kementerian Luar Negeri dan Kerja sama Internasional Kamboja.

ASTANA, Kazakhstan (Antara/RIA Novosti-OANA): Presiden Kazakhstan Nursultan Nazarbayev Jumat (28/1) berikrar akan tetap memerintah sepanjang kesehatannya memungkinkan. “Saya telah menerima isyarat dari rakyat - untuk tidak meninggalkan jabatan, terus bekerja. Jika kesehatan saya memungkinkan saya, jika saya memiliki dukungan rakyat, saya akan bekerja selama saya diperkenankan,” kata Nazarbayev, 70, Jumat dalam pidato tahunannya di hadapan parlemen. Awal bulan, legislatif Kazakhstan dengan suara bulat mendukung penyelenggaraan referendum untuk memperpanjang masa jabatan Nazarbayev sampai 2020, melewati pemilu yang jatuh tempo pada 2012. Nazarbayev, yang memerintah negara Asia Tengah itu sejak runtuhnya Uni Soviet, memveto seruan parlemen untuk mengadakan referendum, tetapi pemungutan suara baru-baru ini mengesampingkan keberatannya. Uni Eropa telah mengecam rencana untuk referendum itu, dan mengatakan hal itu akan bertentangan dengan komitmen Kazakhstan terhadap demokrasi. Uni Eropa juga mendesak Kazakhstan, yang akan menjadi presiden OSCE berputar pada tahun 2010, untuk “terus memperjuangkan pemilihan secara reguler, bebas dan adil sesuai dengan konstitusi dan komitmen OSCE.” Sekelompok organisasi non-pemerintah Kazakhstan telah membuat daya tarik publik agar Nazarbayev untuk terus maju dengan pemilu 2012. Juni, gelar ‘Pemimpin Bangsa’ diberikan kepada Nazarbayev oleh anggota parlemen negaranya. Gelar itu memberinya berbagai keistimewaan setelah berakhirnya masa jabatan presiden.

Penolakan tersebut menyusul permintaan Abhisit pada Kamis bahwa Kamboja harus menurunkan bendera itu dari pagoda Keo Sikha Kiri Svara di Kamboja. “Kementerian Luar Negeri dan Kerja sama Internasional ingin menekankan bahwa pernyataan Perdana Menteri Thailand tidak dapat diterima dan Kamboja dengan tegas menolak terhadap permintaan meng-

OTTAWA, Kanada (Antara/ AFP):Tunisia meminta pihak berwenangKanadaagarmenangkap miliarder dan saudara ipar presiden terguling Tunisia Zine El Abidine Ben Ali, kata Kedutaanbesar Tunisia di Ottawa. “Kedutaan hari ini secara resmi telah meminta pihak berwenang Kanada agar menangkap Belhassen Trabelsi,” kata penasehat kedutaan Nejemeddine Lakhal kepada AFP Kamis (27/1). Belhassen Trabelsi, saudara tertua dari istri Ben Ali, Leila Trabelsi, dilaporkan tiba di Montreal dengan istri, anak-anak dan pengasuh mereka dengan satu pesawat jet pribadi pekan lalu. Satu sumber pemerintah mengatakan kepada AFP bahwa statuskependudukanTrabelsidan keluarganya di Kanada telah dicabut karena mereka gagal memenuhi persyaratan kependudukan, namun mereka masih dapat mengajukankeberatanataskepu-

TOKYO, Jepang (Antara/AFP): Layanan kereta api dan penerbangan ke Miyazaki di baratdaya Jepang mengalami penundaan Jumat (28/1) karena Gunung Shinmoedake meletus dan mengeluarkan asap dan debu ribuan meter ke udara. Gunung berapi setinggi 1.421 meter di dekat kota Kirishima antara prefektur Kagoshima dan Miyazaki telah menyemburkan asapdandebukeudarasejakRabumalam,menurutBadanMeteorologi Jepang. Erupsi menyebabkan maskapai All Nippon Airways dan Japan Airlines membatalkan sejumlah penerbangan dari dan ke Miyazaki, sementara perusahaan kereta api JR Kyushu Railway telah menghentikan layanan kereta api di wilayah yang terkena dampak. DikotaTakaharuyangdekatdengangunungberapi,31orangmenghabiskan malam di pusat evakuasi pada Kamis.

TAHUN KELINCI

Merah adalah warna yang melambangkan peruntungan dan nasib baik dan keberuntungan

Tahun Baru Imlek dimulai 3 Februari, yang tahun ini adalah Tahun Kelinci , binatang yang menduduki urutan ke-4 di antara 12 bulan dalam kalender China

can

SEBELUM TAHUN BARU

Kelinci 5

Ma

Na

ga

Harmonis dengan Babi dan Anjing Tak cocok dengan Tikus dan Ayam

Sap

6 7

Tikus

2

r

Ula

Bersihkan dan hiasi rumah dengan harapan datangnya nasib baik dalam tahun baru Pangkas rambut, beli baju, sepatu baru untuk disiapkan bagi awal hidup baru

4

Mengenai Tahun Kelinci Orang yang lahir pada tahun ini tipenya bersahabat, sosial, penyayang, mengasihi keluarga dan teman-teman.

i

3

1

Kuda

12

Kam

bin

g

MALAM TAHUN BARU Makan malam dalam reuni tahunan dengan keluarga

Bab

11 HARI PERTAMA Mengunjungi anggota keluarga tertua, biasanya kakek atau kakek buyut

Tabu menyapu lantai karena diyakini keberuntungan juga akan tersapu HARI KETIGA Hari Anjing Merah (Chi kou) Pada umumnya, masyarakat menghindari kunjungan pada hari ini yang diyakini roh jahat bergentayangan HARI KELIMA Hari lahir Dewa Kekayaan China, bisnis biasanya dibuka kembali pada hari ini

8

i

Shousui, di mana anakanak tetap bangun sampai larut malam, berdoa bagi kelanjutan usia orangtua

et

ny

Anji

ng 10

Ayam

Kumquat ungkapan bahasa China untuk kemakmuran dan untung baik sementara buah melambangkan persatuan

9

Mo

telah dihilangkan pada Rabu. Reth Sitha, wakil kepala staf umum pasukan pengawal dan komandan pasukan tank Kamboja, mengatakan pada Jumat bahwa Kamboja telah memulai memperkuat kapabilitas militer di wilayah perbatasan. Kuil Preah Vihear di Kamboja terdaftar sebagai Situs Warisan Dunia pada 7 Juli 2008. Seminggu setelah terdaftar, Kamboja dan Thailand mempersengketakan perbatasan karena Thailand mengakui kepemilikan wilayah seluas 4,6 kilometer tepat berdekatan dengan kuil tersebut, menyebabkan pembangunan militer di sepanjang perbatasanm dan secara berkala terjadi pertikaian tentra yang menyebabkan kematian serdadu pada kedua negara.

Nian gao adalah kue manis Tahun Baru, nama yang kedengaran seperti ‘makin tinggi setiap tahunnya’. Itu melambangkan kemajuan

HARI KETUJUH Renri (hari lahir pria) adalah hari ketika semua orang tumbuh satu tahun lebih tua. Sop spesial dimasak dengan tujuh jenis sayuran yang dimakan pada hari ini. Sementara yang lainnya merayakan dengan melemparkan salad w fish salad

(m10)

Hong Bao adalah amplop merah berisi uang yang diberikan oleh pasangan yang telah menikah kepada anak-anak , orang dewasa yang belum menikah, anak buah

Kembang api dinyalakan untuk mengusir roh jahat dan nasib buruk. Namun, dilarang memainkannya di beberapa tempat karena khawatir akan terjadi kebakaran

Barongsai penyajiannya memberikan nasib baik bagi rumahtangga dan kegiatan bisnis yang dikunjunginya. Tarian itu diiringi dengan suara musik khas HARI KELIMABELAS Festival lampion (Yuan Xiao) Penganan ringan terbuat dari tepung beras diberi sirup yang harus dimakan pada hari ini. Simbol persatuan. Graphic: Kinyen Pong

tusan itu, atau meminta suaka. “Ini merupakan sinyal jelas bahwa mereka tidak diterima di Kanada, tetapi mereka masih punya waktu (beberapa bulan setidaknya) sebelum mereka dapat diusir dari negara,” kata sumber itu tanpa menyebut nama. Interpoltelahmengeluarkanperingatan untuk penangkapan Ben Ali dan enam anggota keluarganya atas permintaan dari Tunisia setelah pemberontakan memaksa orang kuat yang berkuasa itu untuk mengungsi ke Arab Saudi. Badan polisi lintas batas mengatakan bahwa negara-negara anggota Interpol telah diminta untuk “mencari, menemukan dan menangkap Ben Ali dan saudara-saudaranya,” dan menunggu permintaan resmi ekstradisi dari Tunisia. Namun polisi federal Kanada pekan ini menolak dengan mengatakan bahwa pihaknya tidak mendapat surat perintah penangkapan

di bawah hukum Kanada. “Badan penegak hukum Kanada memiliki yurisdiksi hanya akan terlibat manakala ada permohonan resmi untuk menyelidiki telah diterima melalui jaringan Interpol atau jalur formal lainnya,” kata juru bicara Kepolisian Kanada Lucy Shorey. Kedutaan Tunisia di Ottawa mengatakan mereka belum menerima tanggapan permintaan terbaru dari pihak berwenang Kanada. Sebelumnya PM Kanada Stephen Harper mengatakan saat berkunjung ke Rabat, Maroko, bahwa mantan anggota rezim Tunisia yang digulingkan oleh protes massa jalanan tersebut tidak diterima di Kanada. “Kanada akan menggunakan semua alat yang ada untuk bekerja sama dengan masyarakat internasional dalam menangani anggota rezim sebelumnya,” katanya. “Mereka tidak kami terima. Kami tidak menyambut

mereka di negara kita.” Menlu undurkan diri Dari Tunis, Menteri Luar Negeri Tunisia Kamel Morjane mengundurkan diri dari posisinya di pemerintahan bersatu sementara di tengah ketegangan konsultasi terkait perombakan kabinet, menurut kantor berita pemerintah TAP. Morjane yang berlatar belakang pendidikan di Amerika Serikat sempat diragukan karena keterkaitan keluarganya dengan presiden terguling Zine El Abidine Ben Ali dan merupakan anggota terkemuka dari Partai Gerakan Demokratik KonstitusionalyangmendominasiTunisia selamabeberapadekade.Diamerupakan salah satu dari delapan menteri termasuk PM ohammed Ghannouchi dari pemerintahan Ben Ali yang bertahan di pemerintahan sementara setelah Ben Ali mundur dan lari ke Arab Saudi pada 14 Januari lalu.

Pengadilan Myanmar Tolak Cabut Pembubaran Partai Suu Kyi YANGON, Myanmar (Antara/Reuters):Pengadilan tinggi khusus Myanmar Jumat (28/ 1) menolak satu usaha pemimpin pro demokrasi Aung San Suu Kyi untuk menghidupkan kembali partainya yang dibubarkan karena memboikot pemilu tahun lalu. Pengadilan Tinggi Khusus di Naypyidaw memutuskan Liga Nasional untuk Demokrasi (NLD) yang kemenangannya dalam pemilu tahun 1990 diabaikan junta militer, akan tetap satu organisasi “tidak sah” karena tidak mendaftar bagi pemilu 7 November. Keputusan itu menyebabkan kekuatan oposisi terbesar

Myanmar terpinggir dalam satu sistem politik baru yang dikuasai militer dan menimbulkan pertanyaan tentang kemampuan pemenang hadiah Nobel Perdamaian itu untuk memprakarsai perubahan di bekas koloni Inggris itu, kendatipun dia dibebaskan dari tahanan rumah 13 November lalu. NLD memboikot pemilu karena apa yang disebutnya peraturan-peraturan “yang tidak adil dan tidak jujur” yang melarang ratusan anggotanya yang ditahan ikut mencalonkan dari untuk menjadi anggota-anggota parlemen. Parlemen baru itu menurut rencana akan melakukan sidang pertamanya, Senin.

TOKYO, Jepang (Antara/AFP): Pemimpin Korea Utara Kim Jong-il menentang suksesi generasi ketiga kekuasaan, namun memilih putra bungsunya sebagai pemimpin mendatang untuk menjamin stabilitas nasional, menurut putra sulungnya kepada suratkabar Jepang. Dalam wawancara yang disiarkan Jumat (28/1), Kim Jongnam, yang tinggal di luar negeri selama beberapa tahun setelah tampaknya tidak mendapat perhatian ayahnya, juga menyebut saudara tirinya, pewaris Kim Jong-un, tampaknya untuk memperbaiki kehidupan warga Korea Utara (Korut). “Suksesi turun-temurun tidak terjadi bahkan di China di bawah Ketua Mao Zedong,” kata Jong-Nam, 39 tahun, dalam wawancara 90 menit dengan Tokyo Shimbun yang dilakukan pada awal bulan ini di China Selatan. “Pergantian kepemimpinan turun-temurun tidak cocok dengan sosialisme dan ayah saya menentangnya,” katanya dalam komentar yang diterjemahkan ke dalam bahasa Jepang. “Saya mengerti bahwa hal itu dilakukan dalam rangka menstabilkan kerangka bangsa,” katanya. “Ketidakstabilan Korea Utara akan menyebabkan ketidakstabilan kawasan di sekitarnya.” Kim Jong-il, 68, dipandang sedang menyiapkan pengalihan kekuasaan ketiga kepada anak nya Jong-un, yang diyakini berumur 27 tahun dan yang menemani ayahnya di sekitar seperlima dari kunjungan tahun lalu. Pada September Jong-un diangkat menjadi jenderal bintang empat dan diberi kedudukan pos senior di Partai Buruh. Sejak itu, dia sering dicatat atau difoto menyertai ayahnya.

Ahmadinejad: Iran Negara Penting Dalam Sejarah Dunia

Tunisia Desak Kanada Tangkap Keluarga Ben Ali

Gunung Berapi Sebabkan Penerbangan Ditunda Di Jepang

MENYOROTI BEBERAPA TRADISI TAHUN BARU

hina itu,” menurut deklarasi itu. Deklarasi itu menambahkan bahwa pernyataan oleh PM Thailand berseberangan karena latihan militer mereka di perbatasan Kamboja yang jelas merupakan provokatif dan berarti casus belli (aksi atau insiden yang memicu peperangan) untuk tindakan agresi di masa depan terhadap Kamboja. “Kamboja memiliki hak sah untuk mempertahankan kedau-

latan dan persatuan wilayah,” lanjut pernyataan itu. Menurut peta yang dibuat oleh komisi bersama Perancis-Siam pada periode tahun 1905 dan 1908, pagoda Keo Sikha Kiri Svara, yang dibangun oleh warga Kamboja pada 1998, jelas dibangun di wilayah Kamboja. Ketegangan antara Kamboja dan Thailand mengenai perbatasan terjadi Kamis setelah ada laporan bahwa Kamboja telah mengibarkan benderanya di pagoda Wat Keo Sekha Kiri Svarak di kuil Preah Vihear dan pihak Thailand meminta diturunkan, namun ditolak oleh Kamboja. Bendera dilaporkan dikibarkan pada kuil itu meski batu bertuliskan “Disini Kamboja” yang mengundang perdebatan

Putra Sulung: Kim Jong-il Menentang Suksesi

Permohonan itu disampaikan pada 13 Januari setelah Mahkamah Agung pada 22 November memutuskan bahwa NLD adalah organisasi ilegal karena tidak mendaftarkan kembali sebagai satu partai untuk ikut pemilu, yang pertama sejak tahun 1990. Banyak pakar memperkirakan NLD mungkin akan menjadi satu organisasi sosial dan mengingatkan bahwa setiap tindakan menentang pemerintah baru yang menurut rencana akan dibentuk dalam beberapa minggu ke depan dapat mengakibatkan penahanan kembali banyak anggotanya termasuk Suu Kyi.

TEHERAN, Iran (Antara/IRNA-OANA): Presiden Iran Mahmoud Ahmadinejad mengatakan bahwa dalam sejarahnya Iran telah memainkan peranan penting dalam mempromosikan budaya ke seluruh dunia. Menurut laman internet kepresidenan, Ahmadinejad menyampaikan pidato tersebut dalam upacara khusus yang memperingati 17 tahun penerapan bahasa Persia sehari-hari Iran Kamis (27/1). Merujuk kepada lanjutan tantangan antara keadilan dan kekuatan arogan di dunia, dia mengatakan bahwa Iran telah mengatasi arogansi global itu dan berhasil melaksanakan keadilan di seluruh dunia. “Iran yang pemberani telah menghadapi berbagai masa pasang surut dan tidak memiliki rasa takut terhadap musuhnya,” katanya. Ahmadinejad mengatakan bahwa selama satu abad ke belakang, media yang terkait dengan kekuatan kolonial membuat dan menyebarluaskan berita palsu dan menyimpang untuk mencapai tujuan sinis mereka, namun media independen dan bebas seperti harian Iran berhasil menggagalkan rencana mereka dan kini mengenalkan pola baru kepada dunia.

Polisi Kejar Dua Pelaku Pengeboman Bus Filipina MANILA, Filipina (Antara/AFP): Kepolisian Filipina Jumat (28/1) mengedarkan sketsa dua orang yang diduga berada di balik pemboman bus yang menewaskan lima orang di pusat keuangan negara, dan menawarkan hadiah untuk membantu mengatasi kejahatan itu. Orang-orang bertindak mencurigakan dan buru-buru turun sesaat sebelum bom mortir itu diledakkan dari jarak jauh dan merobek bus tersebut Selasa, kata Kepala Polisi Metropolitan Manila Nicanor Bartolome pada konferensi pers. “Mereka duduk persis di baris keenam di mana bom itu diletakkan” oleh kedua orang itu, menurut Bartolome. “Mereka membawa tas ketika naik bus, tetapi saksi tidak bisa mengatakan apakah mereka masih memiliki tas itu ketika mereka turun. Tas itu cukup besar untuk menyembunyikan bom mortir 81 milimeter.” Bartolome merilis sketsa-sketsa itu dan komputer yang menghasilkan gambar laki-laki tersebut, berdasarkan pada uraian yang diberikan oleh para korban, termasuk sopir dan kondektur bus. Namun, Bartolome menjelaskan bahwa kedua pria itu belum resmi dianggap tersangka, melainkan adalah “orang-orang penting” yang mungkin dapat membantu meng-gerakkan penyelidikan ke depan. Pihak berwenang Jumat juga menawarkan hadiah satu juta peso (sekitar AS$22.200) kepada setiap informasi yang mengarah pada identifikasi dan penangkapan terhadap mereka yang berada di balik serangan itu. Bartolome mengatakan, polisi tidak mengesampingkan keterlibatan gerilyawan Islam dari Filipina selatan, tetapi pihak berwenang belum dapat mengatakan dengan pasti siapa yang berada di belakang pengeboman itu. Tak lama setelah serangan itu, Presiden Benigno Aquino mengakui pemerintahnya tahun lalu diperingatkan oleh pihak yang tidak disebutkan namanya, bahwa kelompok Muslim garis keras merencanakan akan mengadakan pemboman di Manila.

Malaysia Grebek ‘Suami Sewaan’

Pesawat Antariksa Barang Progress M-09M Diluncurkan Menuju ISS

KUALA LUMPUR, Malaysia (Antara/AFP): Pihak berwenang Malaysia mengatakan pada Jumat (28/1) mereka mengambil tindakan terhadap “suami sewaan”, lelaki setempat yang menikahi perempuan asing demi uang, mengizinkan mereka tinggal di dalam negeri dan bekerja secara ilegal. Para ‘suami,’ biasanya lelaki tengah baya miskin seperti petani karet dan nelayan, sepakat untuk memalsukan pernikahan su-

MOSKOW, Rusia (Antara/RIA Novosti-OANA): Sebuah pesawat antariksa barang, Progress M-09M diluncurkan menuju Stasiun Antariksa Internasional (ISS) Jumat (28/1) pukul 04.32 waktu Moskow, kata Badan Antariksa Rusia, Roscosmos. Pesawat itu diluncurkan dari pusat kendali antariksa Baikonur di Kazakhstan dengan roket pendorong Soyuz-U. Roket dan pesawat tersebut akan berpisah sepuluh menit kemudian dan berhasil memasuki orbit yang telah direncanakan. Pesawat antariksa barang itu akan mengantarkan bahan bakar, oksigen, bahan pangan, sejumlah buku dan kado ulang tahun bagi kapten Ekspedisi 26, Scott J. Kelly dari Amerika Serikat yang berumur 47 tahun pada 21 Februari. Pesawat antariksa itu akan bergabung dengan stasiun antariksa pada 30 Januari pukul 05:40 waktu Moskow.

paya memperbolehkan perempuan mendapatkan izin satu tahun menetap di Malaysia, kata seorang pejabat imigrasi. “Kami telah menahan beberapa perempuan bekerja di bidang hiburan dan mereka memberitahu kami bahwa mereka disini dengan izin kunjungan sosial,” kata direktur imigrasi negara bagian Perak, Mohamad Shukri Nawi, kepada AFP. Menurut laporan suratkabar menyatakan perempuan

tersebut, yang kebanyakan dari Vietnam dan China, bekerja di klab malam tetapi Shukri tidak menjelaskan mereka melakukan kegiatan ilegal seperti prostitusi. “Saat suami mereka datang untuk menghadapi penyelidikan, kami menjadi curiga kenapa ada jeda usia yang demikian lebar dan bagaimana mereka dapat membayar badan-badan terkait karena menikahi perempuan asing membutuhkan biaya besar,” katanya.

Sport

A10

WASPADA Sabtu 29 Januari 2011

Nyonya Tua Kalah Kelas totalbarca.com

Hercules ingin menjadi satu-satunya tim yang mampu mengalahkan Barcelona musim ini.

Para pemain AS Roma merayakan keberhasilan lolos ke semifinal Coppa Italia pasca menumbangkan tuan rumah Juventus di Olympic Stadium, Turin, Jumat (28/1) dinihari WIB. -AP-

TURIN, Italia (Waspada): Semakin berkurang saja peluang Juventus untuk meraih gelar musim ini. Setelah tersingkir di ajang Liga Europa, Juventus juga harus menerima fakta terjungkal di ajang Coppa Italia musim ini, setelah kalah dari Roma 2-0, Jumat (28/1) dinihari. Pelatih Juventus Luigi Del Neri, mengakui Bianconeri kesulitan menghadapi AS Roma di perempatfinal. Sang pelatih mengakui timnya tak mampu menciptakan peluang dan kebobolan dua gol tanpa balas hingga tersingkir dari per-

saingan gelar. “Kami memang tidak mampu mengeluarkan kemampuan terbaik kami. Kami membuat sedikit peluang dan jika Anda tak mau membuat peluang Anda tak bisa mencetak gol,” urai Del Neri sembari meminta

pemainnya kini fokus ke Seri A. Del Neri juga merasa sedikit sial tidak mendapat hadiah penalti di menit-menit akhir setelah Alessandro Del Piero dijatuhkan di kotak terlarang. “Itu seharusnya penalti. Untuk saat ini, kami tidak beruntung di beberapa pertandingan. Kini kami harus fokus sepenuhnya di liga,” tuntas sang allenatore. Tak hanya Del Neri, kapten Juventus Alessandro Del Piero pun mengutarakan kekecewaannya yang mendalam. “Kami pastinya sangat kecewa dan meninggalkan pertandingan ini

dengan kekecewaan yang amat besar,” katanya, Jumat (29/1). “Kami bermain di kandang sendiri dan merupakan kesempatan yang bagus untuk melenggang ke babak berikutnya, tapi kami tak mengambil kesempatan itu,” tandas Del Piero lesu. Berstatus sebagai tim tamu, Roma sendiri tak menampilkan permainan menarik bagi para penonton. Bahkan, pertandingan dua tim besar Italia ini berjalan lambat di awal babak pertama. Pertandingan ini sendiri cenderung kasar. Beberapa pe-

Barca Waspadai Ancaman Hercules langgaran terjadi dan membuahkan satu kartu kuning bagi kedua tim, yakni untuk Philippe Mexes (Roma) dan Marco Motta (Juventus). Melihat penyerangnya kurang gereget, kedua pelatih memasukkan pemain andalannya. Allenatore Juventus, Luigi Del Neri, memasukkan Milos Krasic dan Pelatih Roma Claudio Ranieri mengganti Jeremy Menez dengan Marco Borriello. Usaha Roma pun akhirnya membuahkan hasil. Pada menit 65, tendangan keras Mirko Vucinic dari sisi kiri setelah mene-

rima umpan Daniele De Rossi tak mampu dihentikan kiper Juve, Marco Storari. Saat pertandingan diramalkan akan berakhir dengan skor 1-0, Roma berhasil menambah keunggulan lewat Rodrigo Taddei di menit-menit akhir. Tendangan voli spektakuler dari pemain asal Brazil tersebut membuat Juve dipastikan tersingkir. Atas kemenangan ini, Roma akan berhadapan dengan juara bertahan, Inter Milan, di semifinal yang juga mempertemukan Palermo versus AC Milan. (m33/ini/ap)

Momentum Australia Ukir Sejarah

AP

Tim Cahill dan kawan-kawan santai menjelang laga final Piala Asia 2011 di Doha, Sabtu (29/1) ini.

DOHA ( Waspada): Australia akan berhadapan dengan Jepang pada final Piala Asia 2011, Sabtu (29/1) ini. Duel ini merupakan momen terbesar bagi tim berjuluk Socceroos itu di pentas sepakbola Internasional. Perjalanan terjauh Australia pada sebuah turnamen internasional bergengsi sebelumnya adalah Piala Dunia 2006. Saat itu, Socceroos untuk pertama kali berhasil melewati babak penyisihan grup dan tampil di babak knock out. Sayang, Negeri Kangguru tak mampu melangkah jauh karena terhenti di babak 16 besar oleh Italia. Prestasi ini kini telah terlampaui. Pasalnya, Australia untuk pertama kali akan tampil di final sebuah turnamen internasional bergengsi, yakni final Piala Asia 2011 yang digelar di Doha, Qatar. Australia sendiri baru dua kali tampil di Piala Asia setelah resmi berada di bawah Konfederasi Sepakbola Asia (AFC) pada 2006 lalu.

“Ini (pertandingan lawan Jepang) adalah partai yang berat, namun sangat menarik bila bisa memenangkannya. Ini merupakan sesuatu yang sangat realistis bisa kami menangkan,” kata geladang Aussie, Luke Wilkshire di sela-sela latihan tim, Jumat (28/1). “Korea Selatan belum sekalipun pernah menang selama 51 tahun tampil di event ini dan kami mampu mencapai final hanya dalam dua kali penampilan. Ini sedikit berbeda dari Piala Dunia, namun turnamen ini merupakan salah satu turnamen bergengsi juga,” sambung Wilkshire. Dari kubu Jepang, skuad Samurai Biru akan melakoni laga final tanpa pilarnya di lapangan tengah. Gelandang Shinji Kagawa dipastikan absen karena dibekap cedera. Pemain Borussia Dortmund yang sedang dipantau Manchester United ini mengalami retak tulang metatarsal. Alhasil,

Milan Jamin Van Bommel ROMA (Waspada): Pemain rekrutan baru AC Milan, Mark van Bommel, akan membuat penampilan pertamanya dalam kompetisi Serie A saat bertandang ke Catania, Minggu (30/ 1) dinihari WIB. Pemain internasional Belanda yang masih menjabat kapten Bayern Munich di awal pekan, kini resmi bergabung dengan Milan dalam kontrak lima bulan sebelum kontraknya di Jerman berakhir dalam status bebas transfer. Mantan pemain tengah Barcelona dan PSV yang pernah ikut memperkuat timnas Belanda sebanyak 66 kali, membuat

debut untuk Milan bersama Urby Emanuelson di ajang Coppa Italia dalam kemenangan atas Sampdoria, Kamis (27/1) lalu. Dalam pertandingan di Piala Italia itu, Van Bommel ikut andil besar bagi terciptanya gol yang dibuat Pato ketika Milan menang 2-1. “Van Bommel melakukan sebuah pekerjaan bagus,” kata pelatih Milan, Massimiliano Allegri, Jumat (28/1). “Di babak pertama, dia harus bisa mendapatkan tempat di lapangan karena harus bermain di posisi yang tidak biasa ditempatinya. Dia tampil lebih baik pada babak kedua bersama

Jadwal Sabtu (29/1)

(m33/ant/afp)

Juventus vs Udinese *Indosiar Live pkl 02.45 WIB

Adebayor Ingin Hapus Trauma “Impianku telah menjadi kenyataan, yaitu bermain sepak bola di level tertinggi lagi, terutama dengan Real Madrid. Benar aku mengalami pasang surut dan hampir tewas dalam perjalanan menuju tempat gelaran Piala Afrika,” ujar Adebayor pasca lulus tes medis, Jumat (28/1). “Saya telah berbicara dengan Jose Mourinho. Saya sangat bahagia berada di sini, terutama setelah apa yang telah terjadi dalam enam bulan terakhir,” tambah Adebayor sembari membantah memiliki perselisihan dengan pelatih City, Roberto Mancini. “Saya pesepakbola dan perlu bermain. Aku hanya ingin ikut bertanding dan Madrid memberikan saya kesempatan ini,” akunya. (m33/ini/as)

AP

Didier Drogba (kanan) dan Nicolas Anelka menjadi kunci Chelsea malam ini.

LONDON (Waspada): Chelsea enggan meremehkan Everton dalam duel babak keempat Piala FA, Sabtu (29/1) malam ini. Meski calon lawannya itu baru meraih satu kemenangan di paruh kedua Liga Premier, The Blues memastikan bakal tampil sekuat tenaga demi kemenangan. Duel panas itu sendiri akan dilangsungkan di Goodison Park yang notabene kandang Everton. Pertandingan nanti pun layaknya ulangan final Piala FA 2009 di mana saat itu pasukan Stamford Bridge menang tipis 2-1. Walaupun sang lawan te-

Jadwal Senin (31/1)

MADRID (Waspada): Penyerang anyar Real Madrid, Emmanuel Adebayor (foto), menyatakan akan berlatih dan bermain sebaik mungkin supaya pengalaman jarang dimainkan semasa di Manchester City tak terulang. Adebayor baru didatangkan Madrid dalam status pinjaman sampai akhir musim dengan opsi pembelian permanen di akhir musim. Ia dilepas City setelah hanya bermain delapan kali, dengan enam di antaranya sebagai pengganti di pentas Liga Premier. Menurut Adebayor, hilangnya jam terbang itu merupakan akibat penurunan performanya dan itu terjadi setelah mengalami penembakan teroris dalam perjalanan bersama timnas Togo ke Piala Afrika 2010.

Jadwal Minggu (30/1) Arsenal vs Huddersfield Town Wolverhampton vs Stoke City Notts County vs Man City West Ham vs Nottingham Forest Fulham vs Tottenham Hotspur *MNCTV Live pkl 23.30 WIB

Blues Enggan ‘Sepele’ Everton

Lazio vs Fiorentina *Indosiar Live pkl 00.00 WIB Catania vs AC Milan *Indosiar Live pkl 02.45 WIB Brescia vs Chievo Bologna vs AS Roma Cagliari vs Bari Genoa vs Parma Inter Milan vs Palermo Lecce vs Cesena Napoli vs Sampdoria AP

Everton vs Chelsea *Global Live pkl 19.30 WIB Swansea City vs Leyton Orient Aston Villa vs Blackburn Rovers Birmingham vs Coventry City Bolton Wanderers vs Wigan Athletic Burnley vs Burton Albion Sheffield Wednesday vs Hereford Stevenage vs Reading Torquay United vs Crawley Town Watford vs Brighton Southampton vs Man United

Emanuelson sembari menunjukkan bahwa mereka memang berguna bagi kami,” tambahnya. Sementara itu, Catania berjanji akan bertanding ketat menghadapi Milan, meskipun mereka berstatus hanya tim lemah yang kini berada di urutan ke-16 klasemen sementara. Tim yang bermarkas di Sicilia itu kini mengemas 19 dari 22 poin di kandang dengan kemenangan atas Parma, Cesena, Udinese, Bari dan Brescia plus mengimbangi Bologna, Napoli, Fiorentina dan Chievo.

Jadwal Minggu (30/1)

Mark van Bommel (dua kiri) membuktikan pantas berada di tim inti AC Milan.

kejadian ini sedikit menguras pikiran pelatih Alberto Zaccheroni. Cedera ini diperoleh saat Jepang menaklukkan Korea Selatan di semifinal. Padahal Kagawa menjadi salah satu pemain yang sangat dihandalkan Zaccheroni. Kagawa menjadi pahlawan Jepang saat menaklukkan Qatar 3-2 di perempatfinal dan juga menajdi bagian penting sepanjang turnamen. “Shinji mengalami retak tulang metatarsal dan direncanakan akan terbang ke Jerman untuk mendapat penanganan lebih,” ujar pernyataan klub seperti dilansir Bild. Cedera Kagawa ini tentu juga menjadi pukulan bagi kubu Dortmund. Pasalnya, ia langsung menjadi bintang di musim pertamanya bersama Dortmund. Torehan delapan gol dalam 17 gol musim ini juga membuktikan kualitas Kagawa. (m33/vvn)

AP

ngah dalam kondisi karut marut, kapten Chelsea John Terry memperingatkan rekan-rekannya untuk tidak menganggap enteng Tim Howard cs. “Grafik Everton saat ini naik turun. Namun jika melawan tim besar di kandang, mereka selalu tampil habis-habisan. Pertandingan nanti bakal jadi tes sulit bagi kami,” tutur pemain 30 tahun itu seperti dilansir situs resmi klub, Jumat (28/1). Mental The Blues saat ini sedang bangkit. Sebelumnya, skuad asuhan Carlo Ancelotti itu melumat Ipswich Town 7-0 di babak ketiga dan menang telak 4-0 atas Bolton Wanderers

di pentas Liga Premier. Kebangkitan ini membuat The Blues kembali diperhitungkan sebagai kandidat juara liga musim ini. Padahal, saat Blues terpuruk, banyak pihak menilai Terry cs sudah terlempar dari persaingan. Di kandangnya sendiri, The Toffees memang punya trek rekor bagus untuk musim ini. Everton yang diasuh David Moyes ini tercatat mampu mengimbangi Manchester United 3-3, menundukkan Liverpool 2-0 serta mengandaskan Tottenham Hotspur 2-1. (m33/ini/sky)

BARCELONA, Spanyol Jadwal Minggu (30/1) (Waspada): Dalam lajunya Levante vs Getafe di La Liga Primera musim Malaga vs Real Zaragoza ini, Barcelona baru sekali Real Mallorca vs Sporting Gijon mengalami kekalahan. Kini Hercules vs Barcelona Barca punya kans membaReal Sociedad vs Almeria las dendam atas kekalahan *TVOne Live pkl 00.00 WIB memalukan dari Hercules Deportivo vs Sevilla di jornada 2, September *TVOne Live pkl 04.00 WIB 2010 silam. Atl Madrid vs Athletic Bilbao Kala itu, sang juara *TVOne Live pkl 23.00 WIB bertahan dipermalukan di Nou Camp setelah keok dua Jadwal Senin (31/1) gol tanpa balas. Usai hasil Osasuna vs Real Madrid buruk itu, Barca langsung *TVOne Live pkl 01.00 WIB bangkit sampai masih meEspanyol vs Villarreal muncaki klasemen semen*TVOne Live pkl 03.00 WIB tara dengan keunggulan empat poin dari Real MaJadwal Selasa (1/2) drid yang menjadi rival terRacing Santander vs Valencia dekat sekaligus abadinya. *TVOne Live pkl 03.00 WIB Pada pekan ke-21, Minggu (30/1) dinihariWIB, Barca berkesempatan revans dari satu-satunya lawan yang sejauh ini sudah mengalahkan mereka di pentas liga saat melawat ke Jose Rico Perez Stadium. Selain faktor revans, tentunya tambahan tiga angka penting bagi Barca yang juga hendak menyamai capaian Madrid. Jika Lionel Messi cs memetik tiga poin atas Hercules, maka itu akan menjadi 15 kemenangan beruntun di liga. Menurut catatan statistik, prestasi itu akan menyamai rekor Madrid pada musim 1960-1961. Menilik catatan rekor tandang musim ini, bukan tak mungkin Barca kesulitan nantinya. Pasalnya, Barca sejauh ini selalu mampu memenangi seluruh sembilan laga tandang dengan catatan 33 gol dan hanya kemasukan empat kali. Sebaliknya, Hercules percaya diri mampu menekuk Barca untuk kedua kali. Bermodal kemenangan yang disumbangkan Nelson Valdez dan David Trezeguet itu, Hercules sendiri tengah mencoba untuk memperbaiki peringkatnya di klasemen dengan tampil impresif di kandang. Sementara ini, tim promosi itu telah menang empat laga terakhir di kandang. “Mengalahkan Barca bukanlah hal yang yang tidak mungkin. Saya pikir kami memiliki kesempatan yang lebih baik saat tampil di sini (Jose Rico Perez) karena didukung fans. Kami akan kembali membuat kejutan,” kata Valdez kepada AS, Jumat (28/1). (m33/ini/ap)

Pazzini Tambah Armada Inter INTER Milan dikabarkan telah berhasil mendapatkan striker Sampdoria, Giampaolo Pazzini. Pemain berusia 26 tahun tersebut akan memperkuat Inter dengan durasi kontrak hingga Juni 2015 mendatang. Menurut Sky Italia, Jumat (28/1), Pazzini didatangkan dengan nilai transfer 10 juta euro atau setara Rp123 Miliar. Selain itu, Inter juga harus menyerahkan AP dua pemainnya, yakni Jonathan Biabiany dan Luca Caldirola. Kesepakatan ini dicapai kedua tim melalui negosiasi dalam beberapa hari terakhir ini. Menurut Presiden Sampdoria, Riccardo Garrone, Pazzini akan meninggalkan klubnya pada penghujung transfer window nanti. Perwakilan Pazzini, Davide Torchia dan Tullio Tinti sudah tiba di Milan untuk menyelesaikan kesepatakan kontrak. Inter sendiri sedang butuh striker setelah cedera yang menimpa Diego Milito dan Dejan Stankovic. Pazzini menjadi pemain besar kedua yang meninggalkan Sampdoria pada bursa transfer Januari 2011. Sebelumnya, Antonio Cassano telah lebih dulu memutuskan bergabung dengan rival sekota Inter, AC Milan.

Diarra Berlabuh Di Monaco REAL Madrid mengumumkan melalui situs resminya telah menyepakati transfer gelandang Mahamadou Diarra dengan AS Monaco. “Real Madrid CF dan Monaco FC telah mencapai kesepakatan untuk transfer Mahamadou Diarra. (Transfer) bergantung kepada hasil tes medis dan kontraknya dengan klub barunya,” demiAP kian kata Real Madrid, Jumat (28/1). Diarra bergabung dengan Madrid dari Olympique Lyon pada 2006. Ia ikut membawa Madrid menjuarai Liga BBVA 2007 dan 2008. Dari 20 pertandingan La Liga yang sudah dilakoni Madrid musim ini, Diarra baru bermain tiga kali sebagai pengganti. Menurut Transfermarkt, Diarra masih terkikat kontrak sampai akhir musim ini dan bernilai potensial sebesar sembilan juta euro atau sekitar Rp111 miliar. (m33/ini/goal)

Sport

A11 Affan Cs Harus Konsentrasi

WASPADA Sabtu 29 Januari 2011

Percayakan Kembali Hari Syahputra PELATIH PSMS Medan, Suharto, harus berani kembali mempercayai posisi libero kepada Hari Syahputra (foto) karena Putra Habibi kurang memiliki kecepatan dan enggan berkomunikasi dengan rekan lainnya. Akibatnya dalam dua laga tandang terakhir di Aceh menghadapi PSSB Bireuen dan PSLS Lhokseumawe, Putra Habibi nyaris menjadi penyebab Ayam Kinantan pulang tanpa hasil. Andainya kepiawaian penjaga gawang Andi Setiawan tidak menyebelahinya, akan tertutup kemungkinan PSMS memperpanjang rekor tidak pernah kebobolan di empat laga terakhir. Namun keberhasilan Andi Setiawan yang baru berdiri di bawah mistar PSMS sejak Suharto menjadi arsitek berbanding terbalik buruknya koordinasi pemain belakang di dua laga

tersebut. Demi menyelamatkan pertahanan PSMS, pelatih Suharto harus segera membenahi barisan tembok The Killer. Suharto sendiri mengakui, pemain bawah PSMS kurang koordinasi dan komunikasi pada dua laga itu. Di waktu tersisa ini, mantan striker PSMS itu pun menegaskan akan segera melakukan pembenahan. Namun, Suharto mengakui dirinya tidak mau menyalahkan salah seorang pemain atas lemahnya koordinasi pemain belakang. Menurutnya, pertahanan merupakan tanggungjawab seluruh pemain. “Saya tidak mau menyalahkan secara perorangan, karena di dalam sepakbola daerah pertahanan jadi tanggungjawab semua pemain di lapangan. Yang jelas ada evaluasi atas buruknya koordinasi lini belakang,” ungkapnya.

MEDAN (Waspada): Asisten Manajer PSMS Medan, Drs Benny Tomasoa, meminta kepada M Affan Lubis dan kawan-kawan, agar lebih bertanggungjawab memainkan peranannya masingmasing dalam laga kontra Persipasi Bekasi, Senin (31/1) nanti.

Waspada/Austin Antariksa

Pembenahan itu terlihat mulai digelarnya pada latihan Jumat (28/1). Selain lini belakang, lini tengah dan depan tampaknya juga mendapat perhatian Suharto dan asistennya Edy Syahputra. “Ya, kami mengakui lini tengah juga kurang kontribusi. Jadi, lini tengah dan depan juga akan dievaluasi di sisi waktu ini,” beber Suharto. *H Syahputra MS

Wahidin, Methodist 2 Buktikan Lebih Baik Honda DBL 2011 MEDAN (Waspada): SMA Wahidin Medan melaju ke semifinal setelah menumbangkan tim unggulan SMA Sutomo 1 Medan 42-35 pada babak delapan besar Honda Development Basketball League (DBL) 2011 North Sumatera Series di GOR Angsapura, Jl Logam Medan, Jumat (28/1). Sukses tim asuhan pelatih Hidayat Natasasmita itu tidak diraih dengan mudah. Meski hingga kuarter ketiga berakhir memimpin 24-17, Sutomo memberikan perlawanan ketat di kuarter keempat dan mampu membalik keadaan unggul 3130 di sisa waktu satu menit. NamunWahidin tidak patah semangat dan usaha Ricky cs berbuah hasil setelah Andy sukses melakukan three point. Beruntung, keberuntungan masih berpihak kepada Sutomo kala Juniardi berhasil melakukan shooting untuk menyamakan kedudukan hingga memaksa overtime. Pada tambahan waktu itu, Sutomo langsung mengejutkan Wahidin lewat tembakan Juniardi. Namun lagi-lagi Wahidin bangkit dan memanfaatkan waktu tersisa untuk mencetak sembilan poin sekaligus memenangi bigmatch sarat gengsi itu. “Ini laga yang sangat menegangkan dan saya pikir layak disebut final dini. Dari segi materi pemain, harus diakui Sutomo lebih unggul tapi anak-anak

Waspada/Khairil Umri Batubara

Yuhar San (tengah) tampil gemilang bagi SMA Methodist 2 Medan saat mengalahkan Methodist Binjai pada laga delapan besar Honda DBL 2011 North Sumatera Series di GOR Angsapura, Jl Logam Medan, Jumat (28/1).

Jadwal Semifinal, Sabtu (29/1) 12.00 Sutomo 1 Medan vs Wahidin Medan (Pi) 13.30 SMAN 5 Medan vs Methodist 2 Medan (Pa) 15.00 SMAN 2 Medan vs SMAN 5 Medan (Pi) 17.30 Panca Karya Stabat vs Wahidin Medan (Pa) memiliki keinginan menang lebih besar hingga berjuang maksimal,” ucap Hidayat, pelatih Wahidin. Sebelumnya, SMA Methodist 2 Medan membuktikan diri lebih baik pada bigmatch menghadapi juara bertahan Methodist Binjai. Tim asuhan pelatih Freddy M Gorey itu memimpin perolehan angka pada setiap kuarternya dan mengakhiri laga

dengan kemenangan fantastis 56-33. Yuhar San menjadi suksesor Methodist 2 dengan torehan 29 angka. SMAN 5 Medan turut melaju ke semifinal setelah mengejutkan SMA Prime One School 31-26. Tiket semifinal terakhir menjadi milik SMA Panca Karya Stabat hasil kesuksesan mengalahkan SMAN 1 Medan 51-24. (m42)

Empat Pemuda Magang Di Inggris JAKARTA (Waspada): Janji Indonesia Football Academy (IFA) mencetak pesepakbola handal mengisi skuad timnas senior Indonesia bukan sekedar isapan jempol. Hal tersebut terlihatsetelahIFAmemastikan untuk mengirim empat pemain terbaiknya magang di pusat pelatihan klub Inggris, Leicester City.

Menurut Presiden Direktur IFA, Iman Arief, Jumat (28/1), keempat pemain U-16 Tahun yang semuanya kelahiran 1995 itu terpilih melalui proses seleksi cukup ketat. Mereka adalah, Yogi Rahardian (winger/Palembang), Rico Adriyanto (bekakang/Yogyakarta), Maldini Pali (gelandang/Makassar) dan

Riau Tekad Sukseskan PON 2012 JAKARTA (Waspada): Tekad Provinsi Riau menyukseskan pergelaran Pekan Olahraga Nasional (PON) XVIII pada 2012 nanti tidaklah main-main. Bukan saja mencanangkan target sukses, Riau juga memiliki misi menjadikan PON XVIII sebagai PON Green dan pelopor modernisasi pelaksanaan pesta olahraga empat tahunan itu. “Kami juga siap menyajikan modernisasi dalam pelaksanaan PON. Bahkan, kami telah memikirkan untuk membangun sport city, sehingga usai pelaksanaan PON nanti sarana yang ada tidak terbengkalai,” ujar Gubernur Riau HM Rusli Zainal SE MP di Jakarta, Kamis (27/1). Rusli menjelaskan tekad PON Hijau itu sudah mulai dilaksanakan dengan kerjasama PB PON dan Universitas Negeri Semarang. Dari pencanangan ini, diharapkan PON nanti bisa menghadirkan kehijauan dan kesejukan bagi para tamu dan masyarakat Riau. (j07)

Problem Catur

Mochammad Fahmi Al Ayyubi (striker/Pasuruan). “Keempat pemain tersebut dipilih dengan melihat beberapa aspek penting dalam sepakbola sesuai standar di Eropa. Karena itu, kami berharap keempatnya bisa memenuhi kualifikasi, sehingga mendapat kontrak permanen dengan Leicester. Dengan begitu, pemain muda kita akan bertambah merumput di Eropa,” beber Iman. “Ini adalah komitmen IFA sejak awal dengan melakukan pembinaan usia muda. Salah satunyamengirimpemainterbaik ke Inggris,” jelas Iman menambahkan keempat pemain itu nantinya akan turun pada kompetisi yang digelar Leicester. Masih kata Iman, keempat pemain terbaik hasil seleksi IFA ini dijadwalkan terbang ke Inggris antara 12-15 Februari mendatang. Hal ini disesuaikan beresnya masalah perizinan dan visa dari Kedutaan Inggris. (yuslan)

TTS TOPIK

Menurutnya, Jumat (28/1), kondisi kondusif yang dibangun semenjak kehadiran pelatih Suharto diharapkan bisa membuat seluruh punggawa Ayam Kinantan lebih konsentrasi pada pertandingan berikutnya. Manajemen PSMS berharap bisa menutup putaran pertama dengan raihan 20 poin. “Itu artinya dua laga terakhir putaran pertama ini harus bisa meraih poin sempurna untuk memperbesar peluang lolos ke Liga Super. Dengan 20 poin di putaran pertama, hitung-hitungan di putaran kedua bisa lebih jelas. Jadi kami harap pemain lebih konsentrasi,” sebut Benny. Apalagi, hasil di dua pertandingan tersebut akan menentukan nasib pemain di putaran kedua nanti. Pasalnya, manajemen akan melakukan evaluasi terhadap pemain. “Di putaran kedua, jelas akan ada evaluasi pemain. Jadi kami minta kesungguhan pemain, ini bukan ancaman tapi imbauan agar lebih maksimal,” ungkapnya. Dia mengakui, berada di posisi tujuh klasemen sementara grup I Divisi Utama Liga Indonesia 2010/2011 bukan berarti memupuskan harapan PSMS meringsek ke papan atas. Dua laga terakhir ditargetkan untuk

disapu bersih. Ayam Kinantan akan memainkan laga pamungkas dengan Persipasi pada Senin (31/ 1) dan Persita Tangerang, 4 Februari mendatang. Menghadapi dua tim asal Pulau Jawa itu, PSMS harus bisa bisa meraih enam poin. Saat ini, PSMS mengantongi 14 poin dari 10 laga yang telah digelar, jauh dari pemuncak klasemen sementara Persiraja Banda Aceh yang telah mengantongi 23 poin. Dengan Persipasi, PSMS terpaut empat poin dan tertinggal dari Persita yang menjadi runner up klasemen sementara. “Kenapa kami targetkan enam poin? Karena PSMS bermain di hadapan pendukung sendiri di Teladan. Siapapun lawannya, kemungkinan menang kandang jelas lebih terbuka dibanding laga tandang,” tambah Benny lagi. Dengan raihan hasil 20 poin, upaya PSMS untuk meraih tiket promosi ke Liga Super akan semakin terbuka. Baru di putaran kedua, PSMS akan bisa leluasa melakukan kalkulasi untuk memperbesar peluang meraih target di akhir musim, Liga Super. (m17)

Waspada/Austin Antariksa

M Affan Lubis (tengah) dan kawan-kawan harus fokus penuh dalam dua laga sisa putaran pertama kontra Persipasi Bekasi dan Persita Tangerang.

Mathias Kembali Pimpin Perbasi Sumut MEDAN (Waspada): Mathias Huangdinata SH kembali menduduki jabatan Ketua Umum Pengprov Perbasi Sumut periode 2011-2015 setelah terpilih secara aklamasi pada Musyawarah Provinsi (Musprov) Perbasi Sumut di Hotel Polonia Medan, Jumat (28/1). Usai terpilih, Mathias menyatakan siap mengemban amanah Pengkab/Pengkot Perbasi se-Sumut. “Saya akan meneruskan program-program yang ada, terutama meningkatkan pembinaan dan prestasi basket Sumut. Untuk itu, saya berharap dukungan semua pihak, khususnya rekan-rekan pengurus Perbasi Sumut nantinya,” ucap Mathias. Sebelumnya, Musprov dibuka resmi Ketua Umum PB Perbasi diwakili Ketua Bidang Organisasi Asmin Patros. Pada kesempatan itu, Asmin memberikan apresiasi kepada Perbasi Sumut yang tercatat sebagai salah satu Pengprov terbaik di tanah air. “Di samping sukses menjadi tuan rumah beberapa kejuaraan nasional dan internasional, Sumut juga telah meraih berbagai prestasi mulai dari event pelajar, kelompok umur, mahasiswa maupun Kobatama,” puji Asmin. Ketua Umum KONI Sumut H Gus Irawan Pasaribu mengatakan Perbasi Sumut selama ini cukup aktif menggelar berbagai event dan prestasinya cukup membanggakan. “Cabang basket merupakan salah satu yang berhasil merebut medali emas putra-putri pada Porwil se-Sumatera 2007 lalu dan diharapkan bisa dipertahankan pada Porwil 2011,” ucap Gus. Ketua Panpel Darsen Song mengatakan Musprov dihadiri sembilan dari 11 Pengkab/Pengkot se-Sumut, yakni Medan, Binjai, Langkat, Deli Serdang, Sergai, Pematangsiantar, Tebingtinggi, Padangsidempuan dan Tanjung Balai. Dua Pengkab yang absen adalah Asahan (demisioner) dan Labusel. (m42)

Okto ‘Kabur’ Dari Pelatnas JAKARTA (Waspada): Ketua Bidang Teknis Badan Tim Nasional (BTN), Iman Arief, menegaskan, pihaknya memberi deadline kepada Oktovianus Maniani (foto) untuk segera kembali bergabung dengan timnas U-23 Indonesia yang sedang dipersiapkan tampil di Pra Olimpiade. Jika tidak, mantan pilar PSMS Medan tersebut akan dicoret dari skuad tim besutan pelatih Alfred Riedl. Menurut Iman, Jumat (28/1), jika Okto yang meninggalkan pemusatan latihan (TC) timnas U-23 untuk memperkuat Sriwijaya FC di pentas Liga Super Indonesia (LSI) tidak kembali hingga Minggu (30/1) besok, dipastikan sang pemain tidak akan tampil menghadapi Turkmenistan, 23 Februari mendatang. “Tanggal 30 Januari itu memang merupakan hari terakhir seleksi. Kebetulan, hari itu juga deadline bagi BTN untuk menyerahkan ke-18 nama pemain yang akan menghadapi Turkmenistan. Pemberian deadline ini pun hasil konsultasi dengan pelatih (Alfred Riedl), tapi kami berharap masalah Okto ini tidak dibesar-besarkan,” pinta Iman. Ditambahkan, Okto memutuskan untuk meninggalkan seleksi guna membela klubnya melawan Persipura Jayapura (30/1) dan PersiwaWamena (2/2). Namun, Iman mengaku Okto telah meminta izin kepadanya untuk bermain melawan Persipura. Menanggapi hal ini, Riedl memastikan pemain yang sebelumnya memperkuat tim senior di Piala AFF 2010 itu pasti akan mendapat hukuman darinya. (yuslan)

Sudoku

INFOKOM (MUAT ULANG)

10x10

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. Mendatar

1. Sumber acuan, buku-buku yang dianjurkan untuk dibaca. 8. Ilmu pengetahuan terapan. 10. Buku acuan yang memuat kata dan ungkapan, disusun menurut abjad. 11. Nama Menkominfo bermarga Sembiring. 13. Isi yang paling penting. 15. Siaran bukan siaran langsung. 16. Surat keterangan tercetak sebagai bukti menyelesaikan kursus. 19. Bukti; Cetakan percobaan. 20. Perangkat keras (Inggris). 21. Buat berita suatu peristiwa. 22. Foto, gambar yang dibuat dengan kamera.

Menurun

2. Selaput tipis dari seluloid untuk gambar negatif atau

positif. 3. Singkatan populer Rencana Strategis. 4. Tinta (Inggris). 5. H. Mohammad ______, tokoh pers diabadikan untuk nama jalan dimana kantor Infokom Sumut berlokasi. 6. Penyelidikan pendapat umum. 7. Kepanjangan “Kom” dari Infokom atau Kominfo. 9. Koran elektronik. 10. Tempat bekerja. 12. Penerangan, kabar atau berita. 14. Singkatan populer Interna tional Networking (jaringan internasional). 16. Perangkat lunak (Inggris). 17. Kamera (Belanda). 18. Lembar isian untuk diserahkan pada bagian pendaftaran.

1 3 4 6 5 8 2 3 7 2 8 9 1 0 0 4 1 2 1 8 2 9 0 5 6 5 8 4 1 2 8 9 2 5 0 4 1 8 5 6 3 9 4 5 5 7 6 8 m05

Sport

A12

WASPADA

Sabtu 29 Januari 2011

Ferrari Pamer F150 Di Maranello MARANELLO, Italia (Waspada): Ferrari menjadi tim pertama yang memperkenalkan mobilnya untuk Formula 1 (F1) 2011. “Scuderia” membuka selubung mobil barunya yang diberi nama F150 itu di Maranello, Jumat (28/1). Para desainer Ferrari mendandani “si Kuda Jingkrak” ini supaya lebih agresif. Mereka melakukannya setelah menuai hasil menyedihkan pada seri terakhir musim lalu di Abu Dhabi, di mana Fernando Alonso akhirnya gagal menjadi juara dunia. Ketua Tim Ferrari, Stefano Domenicali, mengakui bahwa tahun lalu mereka kehilangan banyak kesempatan di awal lomba. Karena itu, dia berharap desain F150 akan lebih kompetitif sejak awal musim. Berbicara kepada media pada awal bulan ini, Domenicali mengatakan: “Tujuan utama kami pada 2011 sudah jelas, bahwa kami mengincar dua gelar sekaligus, yaitu konstruktor dan pembalap. Ini harus menjadi tujuan tim kami.

“Begitu juga dengan harapan, kami harus memiliki sebuah mobil yang kompeti-tif sejak awal, mobil yang bisa diandalkan, mobil yang tangguh, dan saya harus mengatakan bahwa kami sudah melihat ini pada tahun lalu. “Jika anda tidak sempurna dalam sebuah lingkungan yang kompetitif, dengan lawan-lawan yang begitu kuat, maka sulit untuk meraih kemenangan,” tambahnya. Menurut rencana, usai peluncuran mobil baru ini, Ferrari akan memberikan kesempatan kepada Alonso untuk melakukan tes di trek Fiorano sekaligus promosi film akhir pekan ini. Setelah itu, esok harinya giliran Felipe Massa yang menguji F150 sebelum menjalani tes resmi perdana pada Selasa (1/2) mendatang di Valencia. (m33/auto)

Fernando Alonso dan Felipe Massa diabadikan bersama mobil Ferrari terbaru, F150, untuk musim kompetisi F1 mendatang. -AP-

Murray Hidupkan Asa Inggris MELBOURNE, Australia (Waspada): Andy Murray (foto) bangkit dari kekalahan di set pertama untuk menyingkirkan petenis Spanyol David Ferrer di semifinal Australia Terbuka 2011, Jumat (28/1). Unggulan kelima dari Inggris Raya ini menang 4-6, 7-6 (2), 6-1, 7-6 (2) atas unggulan ketujuh dari Spanyol tersebut dalam pertarungan melelahkan. Atas hasil ini, Murray melangkah ke final untuk bertemu unggulan ketiga dari Serbia, Novak Djokovic. Sebelumnya, Djokovic secara dramatis menyingkirkan juara bertahan Roger Federer. Murray pun menghidupkan kembali harapan untuk membuka lembaran baru bagi dunia tenis Inggris yang sudah 75 tahun tak pernah melahirkan lagi seorang juara grand slam. Pertandingan final Minggu (30/1) nanti juga menjadi penampilan kedua secara berturutturut bagi Murray di final Australia Terbuka. Tahun lalu, dia juga membukukan prestasi serupa sebelum ditaklukkan peraih 16 gelar grand slam dari Swiss, Roger Federer. Waktu itu pula, Murray menjadi petenis Inggris pertama yang tampil dalam final di Melbourne Park, setelah John Lloyd melakukannya pada 1977. Sejak Fred Perry menjadi juara grand slam pada 1936, Inggris tak pernah lagi memiliki seorang juara. Kini, asa tersebut diletakan pada pundak Murray, apalagi sang pemain memang sedang mengincar gelar pertama turnamen paling bergengsi tersebut. “Dia atlet yang luar biasa dan kompetitor yang hebat. Dia bekerja sangat keras dan memiliki ketajaman,” ujar Murray mengenai Ferrer. “Kondisinya sangat berbeda pada malam hari dibandingkan selama siang. Saya telah bermain dalam kondisi ini (siang) pada dua pertandingan terakhir. Pada awalnya, dia mendikte semua perolehan poin dan di set kedua saya mulai bermain menyerang dan berhasil,” sambung Murray. (m33/ap)

Pasang Iklan Telp.

4528431

HP. 081370328259

Email:

iklan_waspada@yahoo.co.id

AP

Kekalahan Dramatis Heat NEW YORK, AS (Waspada): Unggul di tiga kuarter secara beruntun, Miami Heat secara mengejutkan dipaksa menyerah dari New York Knicks 88-93 dalam lanjutan kompetisi NBA di Madison Square Garden, Jumat (28/1). Tampil sebagai tamu, Heat yang dimotori Dwyane Wade dan LeBron James tampil menyerang sejak awal pertandingan. Sempat tertinggal di angka 5-10, Heat langsung panas dan mengejar perolehan poin hingga akhirnya menutup kuarter pertama 24-23. Memasuki kuarter kedua, Knicks mencoba menekan dengan melakukan tembakan tiga angka. Sayang, beberapa usaha yang dilakukan Shawne Williams dan Bill Walker justru gagal. Sebaliknya, Heat malah mampu memperlebar jarak dan unggul 28-23. Beruntung, Knicks mampu menyamakan kedudukan melalui aksi Williams. Pertarungan kian sengit di pertengahan kuarter ini ketika terjadi kejar-kejaran

angka. Namun, lagi-lagi Heat menutup kuarter kedua dengan kemenangan tipis. Dominasi Heat kian tak terbendung di kuarter tiga. Aksi Wade bahkan tak kuasa dihentikan Knicks hingga akhirnya mampu mendulang 25 poin. Tuan rumah justru hanya mampu menambah 18 poin dan kuarter tiga masih menjadi milik Heat. Dukungan suporter tuan rumah ternyata mampu membakar semangat Knicks yang sudah tertinggal jauh. Hasilnya, Amare Stoudemire cs mampu mengimbangi permainan cepat lawannya hingga menyamakan kedudukan 77-77 saat pertandingan menyisakan lima menit. Suporter pun terus bergemuruh karena Heat mulai kerepotan menghadapi gempuran Knicks. Alhasil, tuan rumah mengunci kemenangan dramatis 93-88. Wade menjadi pencatat angka terbanyak bagi Heat dengan torehan 34 poin 16 rebound dan lima assist. LeBron James menambah 24 angka 11 rebound bagi tim tamu. Di kubu Knicks, Stoudemire mencetak 24 poin, delapan rebound dan empat assist. Di Dallas, tuan rumah Mavericks unggul 111-106 atas Houston Rockets berkat kemasan 21 poin 15 rebound dari Tyson Chandler. Di Portland, Blazers harus menerima kenyataan pahit saat dipermalukan Boston Celtics 88-78. (m33/ap)

AP

Para pemain dan pendukung New York Knicks merayakan kemenangan atas Miami Heat, Jumat (28/1).

Sumatera Utara

WASPADA Sabtu 29 Januari 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:40 12:53 12:40 12:47 12:47 12:44 12:40 12:36 12:43 12:42

‘Ashar 16:02 16:15 16:03 16:10 16:09 16:07 16:03 15:59 16:06 16:05

Magrib 18:39 18:50 18:40 18:45 18:45 18:46 18:40 18:36 18:42 18:40

‘Isya

Imsak

Shubuh Syuruq

Kota

19:51 20:01 19:51 19:56 19:57 19:58 19:52 19:48 19:54 19:52

05:10 05:26 05:11 05:20 05:19 05:11 05:10 05:06 05:13 05:14

05:20 05:36 05:21 05:30 05:29 05:21 05:20 05:16 05:23 05:24

L.Seumawe 12:46 L. Pakam 12:39 Sei Rampah12:38 Meulaboh 12:50 P.Sidimpuan12:37 P. Siantar 12:38 Balige 12:38 R. Prapat 12:35 Sabang 12:53 Pandan 12:39

06:38 06:54 06:39 06:48 06:47 06:39 06:38 06:34 06:41 06:42

Zhuhur ‘Ashar 16:08 16:02 16:01 16:12 16:00 16:01 16:01 15:58 15:15 16:02

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:43 18:38 18:37 18:48 18:40 18:38 18:39 18:36 18:49 18:41

19:55 19:50 19:49 20:00 19:51 19:50 19:51 19:48 20:01 19:53

05:18 05:09 05:09 05:21 05:05 05:08 05:07 05:03 05:26 05:07

05:28 05:19 05:19 05:31 05:15 05:18 05:17 05:13 05:36 05:17

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:39 12:41 12:50 12:43 12:40 12:47 12:35 12:45 12:38 12:38

18:41 18:41 18:47 18:44 18:39 18:45 18:35 18:45 18:40 18:37

19:41 19:53 19:59 19:56 19:51 19:57 19:47 19:57 19:52 19:49

05:07 05:10 05:23 05:12 05:11 05:19 05:05 05:16 05:07 05:08

05:17 05:20 05:33 05:22 05:21 05:29 05:15 05:26 05:17 05:18

Panyabungan 12:36 Teluk Dalam12:43 Salak 12:41 Limapuluh 12:37 Parapat 12:38 GunungTua 12:36 Sibuhuan 12:35 Lhoksukon 12:45 D.Sanggul 12:39 Kotapinang 12:34 AekKanopan 12:36

06:47 06:38 06:37 06:49 06:33 06:36 06:35 06:32 06:55 06:36

16:02 16:03 16:13 16:06 16:03 16:09 15:58 16:08 16:02 16:01

06:35 06:38 06:51 06:40 06:39 06:47 06:33 06:44 06:35 06:36

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Walikota Binjai Lantik Tim Penggerak PKK

T. TINGGI (Waspada): Pembangunan gedung di lokasi eks bioskop RIA di Jalan Jendral Sudirman, Kel. Badak Bejuang, KotaTebingtinggi mendapat protes warga yang bermukim di lokasi sekitar gedung yang akan dibangun. Pasalnyapembangunangedungitumenutup akses jalan dan tempat usaha 10 KK warga di sana yang pada umumnya berprofesi sebagai tukang jahit. Berdasarkan pantuan, kemarin, tidak terlihat plang izin bangunan di sana. Pengerjaan bangunan dalam tahap pengorekan pondasi. Galian lubang pondasi pagar itu persis rapat ke dinding ruko di sebelahnya sehingga tidak ada ruang untuk akses jalan. Eks bangunan RIA itu menurut warga merupakan aset negara milik pemerintah tingkat I Medan. “Kami tidak tahu mau dibangun apa bekas bangunan bioskop RIA itu, kami tidak pernah mengusiknya. Dulu dengar-dengar mau dibangunsemacamminimarketSuzuyasekarang entah apa lagi, “ ucap warga.

Bobol Rumah Di Binjai Ditangkap Waspada/Abdul Khalik

SEROBOT GANG : PD AI dan Jasa Pemprovsu dituding warga hendak menyerobot lahan gang yang telah ada sejak zaman Belanda. Terlihat perumahan warga berderet di pinggir gang sengketa itu. Jika itu diambil, 10 KK tinggal di gang itu akan kehilangan hak hidup mereka. Foto direkam, Jumat (28/1).

Toko Pakaian Dibobol Maling

PD Aneka Industri-Jasa Pemprovsu Dituding Serobot Lahan

T.TINGGI (Waspada) Satu rumah toko (ruko) tempat penjualan pakaian di Jalan Thamrin, Kec. Tebingtinggi Kota, dibobol maling, Kamis (27/1) dini hari. Akibatnya pakaian jualan beserta barang berharga di dalam ruko tersebut raib digondol maling. Peristiwa tersebut baru diketahui pemilik ruko pagi harinya dari laporan pegawainya ketika hendak membuka toko. Pemilik ruko Siti Khadijah, 28, warga Jalan Pulau Belitung, Ling. III, Kel. Persiakan , Kec. Padang Hulu,Tebingtinggi selanjutnya melaporkan kejadian tersebut ke Sentra Kepolisian Masyarakat (SPK) Polres Tebingtinggi. Dalam laporannya, saksi SriWahyuni, 35, warga Perkebunan Sei Bahilang yang sehari-hari bekerja di ruko milik Siti Khadijah mengatakan, saat kejadian hendak membuka ruko pakaian ‘3 R’, ketika itu melihat barang-barang dalam toko sudah berantakan. Atas kejadian itu korban pemilik ruko mengalami kerugian mencapai sekitar Rp 5 juta. Pelaku diperkirakan lebih dari satu orang, kasus tersebut kini dalam pengusutan petugas. (a09)

TEBINGTINGGI (Waspada) : Warga Link.02, Kel. Badak Bejuang, Kec. T.Tinggi Kota, tepatnya bersebelahan dengan eks bioskop Ria di Jalan Sudirman, menuding PD IJ Pemrpovsu mencoba menyerobot lahan yang selama ini dijadikan gang perlintasan. Penyerobotan itu dilakukan pengusaha yang akan membangun super market di lahan itu.

Tiga Pengurus Gapensi Binjai Mundur BINJAI (Waspada) : Tiga pengurus Gapensi Kota Binjai masa bhakti 2010-2015 yang dilantik Senin pekan lalu menyatakan mengundurkan diri. Tiga pengurus yang menyatakan mundur secara tertulis Haris Syahputra Nasution sebagai Bidang Tenaga Kerja, Ketua Kompartemen II Rudi Susanto dan Bidang SDM Hj Mariaty Pohan. KetigapengurusGapensiyangbarudilantiksatuminggumenyebutkan, Rabu (26/1), pengunduran diri dari pengurus Gapensi disebabkan pengurus Gapensi dalam melakukan penyusunan pengurus bertentangan dengan hasil Muscab yang diselanggarakan 12 Februari 2010. Haris Syahputra Nasution menyebutkan, pengurus Gapensi yang dilantik dinilai ilegal, sebab susunan pengurus yang dilantik tak sesuai hasil formatur. Bahkan salah seorang formatur Luthfi Darma mengakui, pengurus hasil formatur tidak sesuai. Jika ada perubahanpengurusuntukdilantik,setelahhampirsetahunMuscab, tim formatur harus kembali bermusyawarah. Apalagi hasil formatur disusunsudahditandatanganiKetuaBPDGapensiSumutHMakmur Aziz. (a03)

PHBI Binjai Bantu Guru Mengaji Tradisional BINJAI (Waspada): Panitia Hari Besar Islam (PHBI) Kota Binjai menyerahkan bantuan kepada guru mengaji tradisonal, Kamis (27/1) di Pendopo Umar Baki. Penyerahan bantuan dilakukanWakilWalikota Binjai Timbas Tarigan yang juga sebagai penceramah dalam pengajian Korpri Kota Binjai. Ketua PHBI Binjai H Lukman, MD. MH menjelaskan, bantuan kepada 522 guru mengaji tradisional dari 37 kelurahan di Kota Binjaisebagaimotivasikepadagurumengajiyangbanyakmembantu generasi muda melek Al Quran. Bantuan PHBI Binjai kepada guru mengaji tradisional yang memberikan pengajaran dari rumah ke rumah, diperoleh dari infaq saat shalat Idul Fitri dan Idul Adha 2010. Setiap guru mengaji dibantu Rp.110.000.(a03)

Kadis Tarukim Binjai Diancam BINJAI (Waspada) : Kepala DinasTarukim Kota Binjai Mahfullah Daulay Jumat (28/1) mengaku mendapat ancaman. Mahfulah ditemui di Balaikota Binjai untuk menghadiri pelantikan TP PKK di aula Pemko tak mau menyebutkan siapa mengancamnya. Mahfullah menyebutkan nada ancaman langsung ke telefon selularnya. Bahkan ada ancaman melalui SMS. “Walau darimana ancaman kepada saya, selama saya menunaikan tugas, tidak akan gentar,” ujarnya. Kadis Tarukim Binjai mengakui, tugas diemban sesuai Perda dan ketentuan yang berlaku dan surat perintah Walikota Binjai. Hanya Mahfullah menyesalkan ada mitra yang masih menghalangi, padahal tujuan penertiban sesuai visi dan misiWalikota Idaham,agar kota Binjai lebih tertata secara baik. Mengenai peruntuhan tembok di Jalan Ahmad Yani yang dieksekusi akibat tak sesuai dengan IMB, hanya dilakukan sekadar saja. Mahfullah membantah hal itu. Kadis Tarukim Binjai menjelaskan, akan memanggil pihak PTPN II dan Perumka Binjai guna mempertanyakan bangunan yang berdiri di tanah mereka. Sebab bangunan ditanah Perumka umumnya permanent,padahal tak sesuai dengan jarak aman rel kereta api. (a03)

Zhuhur ‘Ashar 15:59 16:06 16:04 15:59 16:01 15:59 15:58 16:08 16:02 15:57 15:59

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:39 18:46 18:42 18:36 18:39 18:38 18:38 18:42 18:40 18:35 18:36

19:51 19:58 19:53 19:48 19:51 19:50 19:50 19:54 19:52 19:47 19:48

05:03 05:09 05:10 05:07 05:08 05:03 04:59 05:18 05:08 05:02 05:05

05:13 05:19 05:20 05:17 05:18 05:13 05:09 05:28 05:18 05:12 05:15

06:31 06:38 06:38 06:35 06:36 06:32 06:31 06:46 06:36 06:30 06:33

Menutup Akses Jalan, Warga Protes Pembangunan Gedung Eks Bioskop Ria

BINJAI (Waspada) : Walikota Binjai HM Idaham melantik pengurus tim penggerak PKK Kota Binjai periode 2010-2015, Jumat (28/1) di aula pemko. Pelantikan dihadiri Sekda Iqbal Pulungan dan kepala SKPD se-Kota Binjai. Pengurus yang dilantik terdiri dari Ketua Hj Lisa Andriani M Idaham, Wakil Ketua I Nany Timbas Tarigan, Wakil Ketua II Normalina Iqbal Pulungan, Sekretaris Suryani Agusnadi, Wakil Sekretaris I Maidarningsih Agus Halim, Wakil Sekretaris II Elvi Asriani Khairul,WakilSekretarisIIIDedeAfrizalHasibuan,Bendahara Rosari Rezeki Hutajulu, Ketua Kelompok Kerja (pokja) I Efri Alfi Syahriza, Ketua Pokja II Nurhayati Amir Hamzah, Ketua pokja III Yusni Dwi Anang, Ketua Pokja IV Elly R Susyanto. Walikota Binjai dalam pengarahannya mengingatkan pengurus yangbarudilantikagarbekerjasama menjalankantugasdanfungsinya untuk mewujudkan tujuan gerakan PKK yaitu meningkatkan pemberdayaan dan kualitas kesejahteraan keluarga melalui kegiatan yang menyentuh dan bermanfaat bagi masyarakat. (a03)

BINJAI (Waspada) : Sat Reskrim Polres Binjai, unitVece Control (VC) dipimpin Ipda HL.Tobing meringkus Buyung Jambret, 50, warga Kampung Binjai, Kecamatan Binjai Kota, pelaku pembongkaran rumah milik Iswan Kurniadi, warga jalan Sudirman, Komplek Mega Mas Binjai, Jumat 3 Desember 2010, diringkus petugas di Solok, Sumatera Barat di tempat persembunyiannya, Kamis (27/ 1). Korban menderita kerugian diperkirakan sebesar Rp 385 juta terdiri dari barang perhiasan, uang dan handphone.“Tersangka masih dalam perjalanan bersama petugas yang menangkapnya dengan menggunakan pesawat,” ujar sumber di Polres Binjai. Sebelum diringkusnya tersangka , petugas sebelumnya menangkap istrinya N, 40, Rabu (26/1) dari rumah mereka. Kapolres Binjai AKBP Rina Sari Ginting, melalui Kasat Reskrim AKP Ronni Bonic ketika dikonfirmasi diringkusnya tersangka pelaku pembongkaran rumah milik Iswan Kurniadi membenarkannya. (a04)

B1

Dari berbagai keterangan, Jumat (28/1), pihak pengusaha mengklaim lahan gang lebar 4 meter dengan panjang sekira 50 meter, sebagai lahan mereka, dengancarahendakmembangun tembok pembatas. Akibatnya, jika tembok itu selesai, akses ke luar masuk sekira 10 kepala keluarga terputus. Padahal, gang itutelahadasejakzamanBelanda, sebagai penghubung antara Jln. Sudirman dengan Jalan HAR

Syihab. Dahliana, 55, dan Rosmala, 58, dua keluarga yang mengaku tinggal turun termurun di lahan bersampingan dengan eks bioskopRiaitumengungkapkan,gang itusudahadasejakzamasebelum kemerdekaan. Dahliana mengaku sejak lahir tinggal di kediamannya dan sejak itu pula sudah ada gang di halaman rumahnya. Bahkan, ayah Dahliana bernama Amat Soder (alm) tinggal di lokasi itu sejak sejak zaman Belanda. “Selama itu ada gang di sini, tibatiba pengusaha super market hendak menutupnya,” ujar Dahliana. Rosmala menuturkan, lahan itu semula milik warga bernama Tong Bi. Pemilik kemudian menjual lahan itu secara kaplingan dan sejak dibeli. Lahan milik PD AIJ Provsu itu berdampingan dengan rumah warga dibatasi gang. Semula, tutur Rosmala, lahan itu milik orang Belanda yang dibangunannya berfungsi sebagai bioskop. “Dulunya bernama bioskop Rex,” ungkap Rosmala. Bioskop Rex itu, ketika dibangun telah

mengeluarkan sekira 2 meter lahannya untuk gang. Keduanyajugamenunjukkan sertifikat hak milik lahan yang dibuat BPN Kota Tebingtinggi, masing-masing 1997 dan 2002. Dari peta di sertifikat itu, memang ada lahan gang di dalamnya. Atas dasar itu pula, warga menolak keras jika PD AIJ bersama pengusaha super market hendak menutup gang itu.Warga juga, mempersoalkanlahanpekuburanyang juga dimasukkan sebagai areal untuk super market. Sehari sebelumnya, hampir terjadi bentrok antar warga dan pekerja yang hendak membangun tembok. Bahkan Camat Kec.T.Tinggi Kota Sri imbang Jaya AP, MSP sempat mengalami perlakuan kasar warga karena dinilai menyebelah pengusaha. Syukur salah pengertian itu bisa diatasidengankedatanganSatpol PP.SatpolPPkemudianmemerintahkan pekerja menghentikan pekerjaan mereka membangun tembok, karena pengusaha belum memenuhi ketentuan membangun. (a08/a09)

Larikan Gadis, Ketua OKP Di T. Tinggi Diadukan TEBINGTINGGI (Waspada): Melarikan seorang gadis, seorang ketua organisasi kepemudaan di Kota Tebingtinggi diadukan ke MapolresTebingtinggiolehkedua orang tua gadis itu, Rabu (26/1). Melati(bukannamasebenarnya), 20, pergi meninggalkan rumah orang tuanya bersama LFDT, 38, sejak 5 Januari lalu. Keterangan orang tua korban di Mapolre Tebingtinggi, Melati sejak lama berpacaran dengan LFDT. Namun keluarga Melati

tidak merestui hubungan itu, karena perbedaan mendasar antara keduanya, khususnya perbedaankeyakinan.KetidaksetujuankeluargaatashubunganMelati dengan FLDT itu, nyatanya tak ditanggapi keduanya. Bahkan, keluarga Melati memutuskan untuk mengisolasi Melati di rumah agar tidak lagi menjalin hubungan dengan oknum Ketua OKP itu. Namun, entah bagaimana Melati melarikan diri melalui pintu kamar

rumahnya. Sejak kejadian itu, keluarga terus mencari keberadaan Melati. Belakangan, diketahui keduanya berada di Pematangsiantar Tak terima dengan cara seperti itu, ibu Melati Yuni, 40, ditemani anaknya Dedi Bangun, 25, mengadukan Ketua OKP itu ke MapolresTebingtinggi. Dalam kasus itu, Mapolres Tebingtinggi menetapkan FLDT telah melanggar UU No.23 Tahun 2004 tentangPerlindunganAnak. (a08)

Warga menyatakan tidak pernah menganggu dantidakkeberatanadanyabangunanitu,namun jangan sampai menutup akses jalan,” ucap Aleksander Nainggolan seraya mengatakan, bagaimana bila terjadi kebakaran tidak ada gang atau jalan untuk pemadaman. Didampingi sejumlah warga di sana dia mengatakan, Gang Arsyihab sepanjang sekitar 200 meter selama ini sudah ada semenjak adanya bangunan bioskop RIA. Demikian warga lainnya, Lukman Hakim penjahit pakaian mengatakan, puluhan tahun menempatiusahajahitdisanameneruskanusaha orang tuanya, Gang Harsyihab sudah ada. “Mana mungkin orang tua saya membuka usaha di sini tampa ada jalan,” ucapnya. Karena mendapat protes warga, pengerjaan galian pondasi pagar gedung itu dihentikan dan lubang galian tersebut ditutup kembali. Setelah turun anggota DPRDTebingtinggi bersama aparat pemerintah setempat. Hingga siang tidak lagi terlihat pekerja bangunan di sana. (a09)

Warung Remang-remang Digerebek Di Batubara Puluhan Botol Miras Dan Wanita Diamankan LIMAPULUH (Waspada) : Puluhan botol minuman keras (miras) beserta wanita dan pria berhasil terjaring dalam suatu razia dilakukan aparat gabungan pada 13 titik tempat usaha hiburan (cafe) berkedok warung remang-remang di Desa Sei Muka dan Petatal, Kec Talawi, Kab Batubara, Kamis (27/1) sekira pukul 23.00. Miras berupa jenis Vodca dan Vigour kini diamankan sebagai barang bukti pengusutan di Mapolsek Labuhan Ruku. Sedangkan wanita diduga sebagai pelayan warung beserta lelaki yang terjaring diberikan arahan dari Ketua MUI kecamatan M Ifni Lc MA selanjutnya diperbolehkan kembali pulang setelah sebelumnya mereka membuat surat pernyataan tidak menanggulangi perbuatannya disaksikan para tokoh agama dan masyarakat

di Kantor Camat Talawi di Labuhan Ruku. ‘’Jika nanti mereka kembali kedapatan kami tidak segan-segan melakukan tindakan tegas membawa kepanti rehabilitasi di Berastagi untuk dilakukan pembinaan sekaligus menutup tempat usaha,’’ kata Camat Talawi Luthfi, Jumat (28/ 1). Dirinya membantah jalannya operasi pilih kasih sebab warung yang ber posisi di dekat kawasan perbatasan sudah lebih awal dirazia. Namun tidak beraktivitas maupun menemukan orang yang datang. Tim gabungan terdiri dari Satuan Polisi Polsek Labuhan Ruku, Koramil, Satpol PP, Linmas beserta, Kadis Sosial Zainal Alwi. ‘’Status mereka yang terjaring tidak jelas apakah hanya sebagai pelayan di warung,’’ tambah Kasat Pol PP Batubara Raja Imbalo. (a11)

Oknum Mandor PTPN 3 Gunung Pamela Diduga Terlibat Penipuan SIPISPIS (Waspada): Seorang mandor Afdeling I PN3 Kebun Gunung Pamela, NT,40, warga Pondok Baru Emplasmen PN3 Gunung Pamela di Desa Buluh Duri, Kec. Sipispis, Kab. Serdang Bedagai, diduga terlibat kasus penipuan seratusan juta rupiah dengan korban 14 orang yang dijanjikan sebagai karyawan di perkebunan itu, karena kecewa setelah beberapa akhirnya mengadukan persoalannya ke Polsek Sipispis. Korban penipuan Mustopo, 24, Suarman, 31, didampingi orangtuanya Warsidi,63, dan Tukidi,31, didampingi kakeknya Kartak, 68, semuanya warga Dusun IV, Desa Bahjering, Kec. Dolok Merawan, mengakui awalnya mereka diiming-imingi NT yang memiliki relasi di Kantor Direksi (Kandir) Medan bisa menyisipkan tenaga karyawan yang akan dipekerjakan di perkebunan PN3 Gunung Pamela “Cucu saya Tukidi dijanjikan menjadi karyawan di tempat NT bekerja pada 21 Maret 2010 dengan menyediakan Rp20 juta, caranya bisa dengan sistem cicil dan sempat dibayar Rp10,5 jutadengantigakalipembayaranyangdiserahkan langsung kepada NT di rumahnya,” ucapnya. Cicilan pertama, kata Kartak, Rp4 juta yang diserahkan dirinya ditemani menantunya

Paiman.Cicilan kedua Rp3 juta dan ketiga Rp3,5 juta yang ditemani anaknya Janiyah,29, yang diterima NT di rumanya. Merasa kecewa Tukidi menagih uang yang disetor untuk dikembalikan saja, malah jawabannyaNTtidakadaitikadbaikuntukmenyelesaikannya. Malah terkesan menantang agar melaporkannya ke pihak berwajib. Kepala Desa Buluh Duri, DewiYanthi Purba ketika ditemuiWaspada di kantornya, Kamis (27/ 1) mengakui telah menerima pengaduan para keluarga dan korban yang merasa ditipu NT dengan sejumlah uang rata-rata Rp10 juta Kemudian, Selasa (25/1) NT, salah seorang korban, Ismaliza melaporkannya ke Polsek yang selanjutnya mengamankan NT untuk dimintai keterangan terkait kasus penipuan itu, imbuh sang Kades. Asisten Personalia Kebun (APK) PN3 Gunung Pamela, Sipispis H Abusai Purba mengatakan, NT memang benar merupakan Karyawan perkebunan yang sudah bekerja selama 20 tahun yang bertugas sebagai Mandor deres di Afdeling I. Kapolsek Sipispis AKP R Simanjorang membenarkan telah memeriksa NT terkait kasus penipuan atas laporan resmi Ismaliza. (ces/a09)

Siswa SD Tewas Terlindas Truk TANJUNGBALAI (Waspada) : Seorang siswa SD tewas terlindas truk Fuso sepuluh roda di JalanBesarTeluknibungtepatnyadidepanYayasan MPI saat pulang dari sekolah, Jumat (28/1) sekira pukul 11:00. Informasi dihimpun, korbanYehezkiel Septoria Napitupulu, 6, warga Kel. Betingkuala Kapias, Kec.Teluknibung,KotaTanjungbalai,sebelumnya dijemput orangtuanya Hendri Sugianto Napitupulu bersama adiknya Naptaulina dari yayasan pendidikan swasta mengendarai sepeda motor

jenisYamaha Vega BK dengan No PoL 4323 QW. Setiba di TKP, Hendri hendak mendahului truk yang ada di depannya dengan mengambil lajur kiri. Namun, saat berusaha mendahului, sepeda motor Hendri terjatuh ke sebelah kiri. “Namun malang, akibat pendarahan serius dialami di bagian kepala dan kaki, nyawa korban tidak tertolong,” ujar KapolresTanjungbalai AKBP Puja Laksana melalui Kasubbag Humas AKP Y Sinulingga didampingi Kasatlantas AKPTumpal Sitorus. (crs)

Sabar Dan Ikhlas, Resep Nurbeti Jalani Hidup RUMAH sederhana dengan ukuran sekitar 5 X 8 meter yang bagian depanya terbuat dari batu dan beratapkan seng, sedangkan bagian belakangnya masih berdindingkan tepas dengan atap daun rumbia tampak sedikit ramai, sementara sang tuan rumah yang terdaftar sebagai keluarga miskin (Gakin) tampak hangat terburu-buru menyambut kedatangan Waspada yang ditemani salah seorang perangkat Desa Lidah Tanah. “Kesabaran, keikhlasan, keyakinan serta doa dalam keimanan merupakan resep ampuh dalammenjalanihidupdemilima

orang buah hati saya, segala cara dan upaya tetap saya dilakukan dan Alhamdullilah hingga saat ini kami tetap sehat, karena jika dituruti hidup ini kebutuhan kita pastilah tetap kurang,” ungkap Nurbeti, 40, janda warga Dusun III, Gang Buntu, Desa Lidah Tanah, Kec.Perbaungan, Kab. Serdang Bedagai mengawali perbincangan, Jumat (28/1). Cobaan berat, kisah Nurbeti dihadapi ketika suaminya, Murdianto, 49, meninggal dunia pada Maret 2008, karena menderita radang tenggorokan yang syukur biayanyaditanggungJamkesmas, sehingga memaksanya untuk menafkahi 5 anaknya, Ayu,19, Kandar,15,Tritas,13, Nurmaliyah, 6, dan Nurmala, 3, tanpa meninggalkan bekal karena selama ini hanya sebagai petani penggarap di desa itu hanya rumah sederhana diatas sebidang tanah 200 m2. “Untuk memenuhi kebutuhan sehari-hari saya mengandalkan sawah sewaan seluas dua rante (800 m2) milik adik saya,

selain itu dari beras raskin 6 kilogram setiap bulan, kemudian sebagai PRT di kios dodol Nurhayati Pasar Bengkel,” terang Nurbeti. Sesekali juga dibantu anak sulungnya Ayu yang sudah bekerja di Medan dan juga anak ketiga Kandar yang juga sudah bekerja dengan gaji sekitar Rp20 ribu setiap hari, ditambah hasil ternakbebekyangsekarangtersisi 90 ekor itik dari awalnya dibeli 500 ekor. “Sekarang yang masih sekolah anak ketiga saya Tritas kelas III Tsanawiyah di Desa Suka Beras, dan dua masih kecil-kecil, yang harus disambil bekerja dan jika salah satunya sakit terpaksa libur bekerja,” keluh Nurbeti. “ Namun saya sangat bersyukur dan berterimakasih karena sejaksuamisayameninggal,warga desa sekitar khusunya pihak Desa danPemkabSergai, pedulidengan kami, seperti rumah yang kami tempati bagian depan dan lantainya bahannya bantuan dari pemerintah,” katanya.

Menurutnya, jika dirinya diizinkanuntukmengungkapkan rasa terimakasih yang mendalam karena kepedulian Hj Khairiah sangpemilikkiosdodolNurhayati tempatnya bekerja yang sangat pedulidengankondisikehidupan mereka. “Saya yakin suatu saat, kelak jika anak-anak saya telah besar dan berkat dukungan dari semua pihak, hidup kami akan berubah dan itu merupakan cita-cita hidupsaya,”kenangNurbetidengan linangan air mata. Kepala Desa Lidah Tanah Alifuddin didampingi Kepala DusunIIIRusliNasutiondanKaur Umum, Nurman sempat menuturkan,sejakmeninggalnyasuami Nurbeti tiga tahun yang lalu, pihaknya tetap memprioritaskan keluarga Nurbeti sebagai warga miskin,sepertipenyediaanraskin, pelayanan kesehatan, bantuan bahan bangunan untuk rumah yangsudahterpasang.“Kamijuga sedang mengusulkan bantuan rumahdariDinasSosial,”jelasnya.

Waspada/Edi Saputra

KELUARGA MISKIN: Keluarga kurang mampu (miskin) Nurbeti, 40, bersama keempat anaknya saat berada di rumahnya di Dusun III, Gang Buntu, Desa Lidah Tanah, Kec. Perbaungan, Kab.sergai, Jumat (28/1). “Dan hari ini (Jumat-red) Dinas Sosial Pemkab Sergai dan Ketapang juga baru saja menyerahkan bantuan sembako dan alat-alat rumah tangga berikut tetangganyaUmiKalsum,65,yang

juga tergolong keluarga miskin. Kedepan kami juga akan tetap memperhatikankeluargaNurbeti dan keluarga miskin lainnya “ tambah Kades. Edi Saputra

Sumatera Utara

B2

Diparkir, Sepeda Motor Lewong

WASPADA

P. SIANTAR (Waspada): Saat diparkir di depan Kantor Catatan Sipil Pemkab Simalungun, satu unit sepeda motor Honda Mega Pro BK 6652 TAB milik korban Irpan Humusor Tua Silaban, 27, guru, warga Jalan Kavaleri, Kelurahan Bukit Sofa, Kecamatan Siantar Sitalasri, Kota Pematangsiantar diduga lewong dicuri maling yang belum diketahui identitasnya. Keterangan dihimpun menyebutkan sepeda motor milik korban lewong saat diparkir di depan Kantor Catatan Sipil, komplek kantor bupati lama, Jalan Asahan, Km 3,5, Kec. Siantar pada Jumat (22/ 1) pukul 12:00. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Senin (24/1) menyebutkan pengaduan korban masih dalam penyelidikan dan menyita satu lembar fotokopi STNK sepeda motor itu sebagai bahan penyelidikan.(a14)

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: Hj. Emma Sujianti Tarigan. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapak Tuan: Zamzamy Surya. Blang Pidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Oknum Mahasiswa Miliki Ganja Ditangkap P. SIANTAR (Waspada): Seorang oknum mahasiswa, MN, 17, alias Nurdin, warga Perumnas Manahul, Kelurahan Perdagangan III, Kecamatan Bandar, Kabupaten Simalungun ditangkap karena memiliki narkotika. Saat dilakukan penangkapan di Perumnas Manahul, Kamis (27/1) pukul 09:00, ditemukan barang bukti dua bungkus kecil daun ganja kering dari tangan MN. MN segera dibawa bersama barang bukti ke Mapolsek Perdagangan dan dilakukan pemeriksaan. Kapolres Simalungun AKBP Marzuki, Kamis (27/1) menyebutkan, MN sudah ditetapkan sebagai tersangka dan ditahan, karena diduga tanpa hak dan melawan hukum menyalahgunakan narkotika. (a14)

Hasil Tim Forensik Belum Ke Luar BERASTAGI (Waspada) : Pasca kebakaran yang menghanguskan lima usaha panglong di Kota Berastagi awal bulan lalu, belum menuai hasil tim forensik Poldasu sehingga police line telah dibuka demi menghindari amukan pihak keluarga korban yang ingin mengambil barang sisa puing kebakaran. Kanit Reskrim Berastagi Ipda Zulfikar, Rabu (26/1) mengatakan, meski hasil tim forensik Poldasu belum juga keluar, namun atas izin Kapolres Karo police line telah dicabut. Demi kenyamanan serta menghindari keluarga korban yang hendak mencari harta benda di lokasi kebakaran. (cdb)

WASPADA Sabtu 29 Januari 2011

2 Korban Perbuatan Cabul Mengadu

Waspada/Rahmad F Siregar

GENERASI : Teknologi kian berkembang, dan serbuan informasi media seperti internet tak dapat dihindari termasuk kepada anakanak sekolah di Kota Tanjungbalai. Biasanya mereka mengakses facebook dan game online, malah tak jarang sebagiannya membuka situs-situs dewasa. Sampai kini, pemerintah belum mengantisipasi kenakalan anak, buktinya masih banyak yang main di warnet dengan mengenakan seragam sekolah. Foto direkam, Senin (24/1).

P. SIANTAR (Waspada): Dua perempuan yang masih muda dan diduga korban perbuatan cabul, korban DAH, 18, dan DS, 16, mengadu ke Polres Simalungun didampingi keluarga masing-masing. Keterangan dihimpun dan pengaduan di Polres Simalungun Minggu (23/1) menyebutkan DAH diduga dicabuli Mas, 20, warga Huta II, Kel. Pematang Bandar, Kec. Pematang Bandar, Simalungun didalam rumah Mas di Huta II, Kel. Pematang Bandar , Sabtu 18 Desember 2010 pukul 22:00. Terungkapnya perbuatan cabul itu ketika pengadu Antonius Hutagalung, 45, karyawan BUMN, warga Emplasmen Tobasari, Kec. Pematang Sidamanik, Simalungun mendapat pesan singkat (SMS) dari Mas pada Sabtu 18 Desember 2010 pukul 22:00. Sementara, perbuatan cabul yang menimpa DS diduga dilakukan Heng, 20, sopir angkot GMSS Jaya, warga Jalan H. Ulakma Sinaga, Gang Swaskarsa, Nagori Rambung Merah, Kec. Siantar, Simalungun di Jalan Asahan, gedung lama kantor bupati Simalungun, Kec. Siantar, Simalungun, Selasa (4/1) pukul 20:00. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Senin (24/1) menyebutkan pengaduan kedua korban masih dalam penyelidikan. (a14)

Kejari Kabanjahe Belum Terima Pacar Diadukan Ke Polisi SPDP Perkara 13 Truk Dolomit KABANJAHE (Waspada) : Kasipidum Kejaksaan Negeri (Kejari) Kabanjahe R Aritonang, SH mengatakan, sampai Kamis (27/1) belum menerima Surat Pemberitahuan Dimulainya Penyidikan (SPDP) dari Polres Tanah Karo, terkait 13 truk dolomit yang ditangkap beberapa waktu lalu. “Sampai saat ini Kejaksaan belum menerima Surat Pemberitahuan Dimulainya Penyidikan (SPDP) dari Polres Tanah Karo,’’ ujarnya, Kamis (27/1) seraya mengatakan akan mempertanyakan ke Polres. Sesuai Kitab Undang-Undang Hukum Acara Pidana (KUHAP) Pasal 109 Ayat (1) dalam hal penyidik telah mulai melakukan penyidikan suatu peristiwa yang merupakan tindak pidana, penyidik wajib memberitahukan hal itu kepada penuntut umum.

Namun anehnya, hingga saat ini, Polres Karo belum juga mengirim SPDP ke JPU KapolresTanah Karo melalui Kasat Reskrim Karo AKP Harry Azhar Sik, Kamis (27/1) ketika dikonfirmasikan,mengakubelum mengirim SPDP dan berkas perkaranya. “ Masih ada yang perlu dilengkapi dalam penanganan kasus tersebut. Sebab ada perbedaan perbandingan hukum antara penyidik dengan JPU,” ujarnya tanpa terinci. Beberapa hari lalu aparat Polres Tanah Karo menangkap 13 truk bermuatan dolomit. Menurut polisi ke-13 truk tersebut di amankan karena tidak dapat menunjukan dokumen resmi dari pemerintah. Penangkapan 13 truk tersebut, di jalan Kabanjahe ketika hendak menuju Medan. Dalam hal ini Polres Tanah Karo telah memeriksa dan memintai keterangan para kernet, sopir dan pengusaha termasuk sejumlah pejabat instansi terkait di lingkungan Pemkab Karo. Se-

lanjutnya ke-13 truk yang sempat di tahan sepekan lebih di Mapolres Tanah karo di Kabanjahe, dilepaskanSabtu(22/1)menjelang malam. Dolomit itu diduga dikeruk darisalahsatudesadiKecPayung, kawasan penunjukan Hutan Register sesuai SK Menhut No. 44/2005 dan belum ada izin operasional secara resmi dikeluarkan Pemkab Karo. Dolomit tesebut akan dipasarkan ke Medan. Galian dolomit tersebut sudah di protes warga ke DPRD Karo beberapa waktu lalu. Menurut warga, disamping tidak memiliki izin Pemkab Karo, truktruk pengangkut dolomit juga merusak jalan ke desa mereka. Selain diprotes warga, kalangan anggota DPRD Karo juga mendesak pihak berkompeten segera menutup lokasi pengambilandolomit.Karenahaltersebut menyalahi peraturan. Perlu Ketegasan Maraknya galian golongan C jenis dolomit yang sudah berlangsung lama di Tanah Karo, pemerhati lingkungan hidup

CuacaBangun,SH,M.Simengatakan, hal itu perlu menjadi perhatian khusus stakeholders Pemkab Karo maupun DPRD. Dalam hal ini, kata Cuaca, perlu regulasi, konsistensi dan kebijakan yang jelas dan terukur. “Artinya, kalau memang tidak bisa, harus dihentikan. Apalagi bila dikaitkan dengan UndangUndang RI Nomor 23/2007, Pasal 116, dan Pasal 156 UndangUndang RI No. 4/2009 tentang Pengelolaan Lingkungan Hidup, tidak segampang itu mendirikan tambang atau galian C,’’tegasnya. Menurut dia, kajian hukum secara komprehensif harus dilakukan pihak berkompeten. Demikian juga bila dikaitkan SK Menhut No 44/2005 yang hingga sekarang terus menuai kontroversi. Untuk itu, kata Cuaca, penegakan hukum harus tegas, agar tidak menjadi preseden buruk. “Penindakan terhadap para pelanggar hukum dan peraturan harusmemberiefekjera,sehingga tidak muncul kesan hukum dan peraturan bisa dibeli. (c06)

Renbang Kab. Samosir Kurang Matang, Terjadi Pemborosan Anggaran SAMOSIR (Waspada): Rapat paripurna dengan agenda mendengartanggapanakhirfraksiatas Ranperda Kab Samosir tentang APBD 2011, Kamis (27/1) lancar. Fraksi PNI-Marhaenisme melalui juru bicara Freddy LumbanTungkupberpendapat,sesuai hasil kunjungan kerja komisikomisi DPRD Samosir dalam pengawasan APBD 2010 banyak ditemukan perencanaan tidak matang. Sementara, Fraksi Demokrat Pelopor Republik Indonesia Raya (DPR-IR) berpendapat, sebagai daerah tujuan wisata lingkungan inovatif mempunyai sasaran kedepan Samosir akan berupaya danberkreasiuntukmenggalidan memperkenalkan hal-hal seni,

budaya dan situs sejarah berbasis lingkungan. Fraksi ini juga berpendapat, keterlambatanpenetapanRAPBD 2011 bukan karena pelaksanaan Pemilukada yang berproses sampai September 2010 seperti yang disampaikan bupati. Sebab, katanya, KUA PPAS dan R-APBD disusun oleh Tim Anggaran Pemkab Samosir bersama pimpinan SKPD dan seluruhnya PNS yang dilarang ikut berpolitik praktis. Disamping itu fraksi ini juga memandang PAD belum menunjukkan peningkatan, namun bupati mengatakan peningkatan kepedulian dan kesadaran masyarakat masih membutuhkan proses sehingga fraksi ini ber-

pendapat tim intensifikasi dan ekstensifikasi sumber PAD belum bekerja maksimal. DPR-IR menyatakan, agar bupati berupaya mencari solusi agaralokasibelanjatidaklangsung lebih rendah daripada belanja langsung sementara yang terjadi sebaliknya. Ditambahkanfraksiini,Bupati Samosir akan melaksanakan fit and profer test bagi pejabat struktural secara seksama, terencana danmelibatkanpihakketigayang berkualifikasi. Sementara, Bupati Samosir Mangindar Simbolon mengatakan, APBD Samosir diharapkan dilaksanakan sesuai azas tepat arah dan tepat guna. Sementara, Ketua DPRD

Samosir Tongam Sitinjak,ST mengatakan,setelahdisahkannya APBD agar ditindaklanjuti ke Gubsu untuk dievaluasi sehingga APBD Samosir 2011 dapat dinikmati masyarakat Samosir. Dirincikan, Pendapatan Daerah Rp 394.227.420.033. Belanja Daerah Rp421.585.879. 715 berarti defisit Rp27.358.459. 682, Belanja Daerah tidak langsung Rp222.652.773.753, belanja langsung Rp 198.933.105. 962. PADSamosirRp20miliarlebih, Dana Perimbangan Rp 334 miliar lebih,lain-lainpendapatandaerah yang sah Rp39 miliar lebih. Penerimaan pembiayaan daerah Rp 88 miliar lebih, Pengeluaran Pembiayaan Daerah Rp61 miliar. (c10)

Bupati Langkat: Kesejahteraan Masyarakat Nelayan Perlu Ditingkatkan STABAT (Waspada) : Bupati Langkat H Ngogesa Sitepu mengungkapkan komitmennya untuk membangun pemberdayaan masyarakat pesisir dan nelayan melalui program pembangunanperikanandankelautan yang berbasis pada sumberdaya perikanan dan kelautan secara terpadu, efisien, berdaya saing dan ramah lingkungan. “Kemajuan dan kesejahteraan masyarakat nelayan perlu ditingkatkan denganmenerapkan pendekatan bisnis terpadu mulai dariprosesproduksi,penanganan hasil dan pemasaran hasil-hasil perikanan,”katabupatimengawali sambutannyapadaacarapemberian bantuan sarana produksi perikanan dan kelautan kepada kelompok nelayan bertempat di aula Pegnasos Stabat, Jumat (28/ 1). Bupati meminta kepada seluruh nelayan yang mendapat bantuan sarana produksi perikanan dan kelautan untuk digunakan semaksimal mungkin. Di-

ingatkannya juga bantuan bukan untuk diperjual belikan, karena hal itu mengkhianati komitmen Pemkab dalam memberikan perhatian terhadap nelayan. Ketua DPRD Langkat H Rudi Hartono Bangun menyatakan, dukungannya terhadap program kebijakanPemkab.Langkatuntuk peningkatan pendapatan masyarakat nelayan di daerah ini. Bupati Langkat H Ngogesa Sitepu didampingi Ketua DPRD H Rudi Hartono Bangun menyerahkan berbagai bantuan secara simbolis kepada para nelayan di antaranya : keramba apung dan kerambatancap,benihikanbenur udang dan bibit kepiting soka, sampan dan alat tangkap ikan, peralatan pengolahan terasi dan kerupuk ikan yang tergabung dalam5kategoriyakni:kelompok nelayan, kelompok wanita nelayan, kelompok pembudidayaan ikan, dan kelompok pembudidayaan masyarakat pengawas serta kelompok penerima manfaat.

P. SIANTAR (Waspada): Seorang perempuan yang masih dibawah umur, diduga dicabuli pacarnya dan tidak percaya dengan janji akan dinikahi hingga pacarnya itu diadukan ke Polres Simalungun. Keterangan dihimpun dan pengaduan korban di Polres Simalungun, Senin (24/1) menyebutkan korban diduga dicabuli RL, 17, alias Tagor, pelajar SMK Swasta Perdagangan, warga Nagori Bandar Sawah, Ke. Bandar, Simalungun di depan gudang KUD bandar Sawah, Kec. Bandar, Simalungun, Minggu (21/1) pukul 09:00. “Pengaduan korban VAP dan keluarganya masih dalam penyelidikan dengan meminta keterangan korban dan para saksi,” sebut Kapolres Simalungun AKBP DRs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Selasa (25/ 1).(a14)

Miliki Ganja Ditangkap P. SIANTAR (Waspada) : Seorang pria pengangguran, AK, 26, warga Jalan HR. Shihab, Kelurahan Serbelawan, Kecamatan Dolok Batunanggar, Kabupaten Simalungun diringkus polisi karena memiliki satu bungkus kecil atau seberat 0,01 gram daun ganja kering. Keterangan dihimpun dan informasi dari Polres Simalungun, Selasa (25/1) menyebutkan, pelaku AK ditangkap personil Polsek Serbelawan di samping pekarangan rumah AA di Nagori Bandar Selamat, Kec. Dolok Batunanggar, Simalungun, Minggu (23/1). Penangkapan terhadap AK dilakukan sesudah pihak Polsek Serbelawan mendapat informasi dari masyarakat pada Sabtu (22/ 1) pukul 23:30 yang menyebutkan di rumah AA di Bandar Selamat sering terjadi penyalahgunaan narkotika jenis ganja. “AK sudah dijebloskan ke dalam tahanan sesudah diperiksa dan ditetapkan sebagai tersangka, karena memiliki, menyimpan, memakai dan membawa narkotika jenis ganja serta melanggar Pasal 111 (1) UU RI Nomor 35Tahun 2009 tentang narkotika,” kata Kapolres Simalungun AKBP Marzuki melalui Kasubbag Humas AKP Sulaiman Simanjuntak, Selasa (25/1). (a14)

Bupati Dairi Terima Bantuan Mobil Ambulans PT Askes SIDIKALANG (Waspada): Bupati Dairi, KRA Johnny Sitohang Adinegoro menerima penyerahan satu unit mobil ambulans bantuan PT Askes. Kendaraan itu dipakai guna kelancaran tugas di RSU Sidikalang. Serah terima dilakukan di pelataran kantor bupati di Sidikalang, Selasa (26/1). Muspida,Wakil Bupati Irwansyah Pasi ,SH dan pejabat bersama sejumlah warga menyaksikan agenda dimaksud. Acara digelar serangkaian penandatanganan nota kerja sama Bupati dengan Rasinta Ria Ginting Kepala PT Askes Cabang Karo bertajuk “Jaminan Kesehatan Masyarakat Umum Gerakan Terpadu Nduma”. DR Ikhsan MM AAK Kepala PT Askes Regional I menaungi Sumatera Utara dan Aceh menjelaskan, BUMN ini senantiasa mencari terobosan demi meningkatan pelayanan kesehatan. Di antaranya adalah pembuatan askes center bagi pelayanan standar di berbagai unit termasuk RSU Sidikalang.(a28)

Rakor KNPI Sibolga SIBOLGA (Waspada) : Sebagai pelaksanaan amanat organisasi, DPD KNPI Kota Sibolga menggelar Rapat Koordinasi Pemuda/ KNPI Kota Sibolga yang diikuti pimpinan Organisasi Kemasyarakatan Pemuda (OKP) tingkat Kota Sibolga dan pimpinan kecamatan KNPI se–Kota Sibolga, Sabtu (22/1) di Hotel Poncan Morine Sibolga. Walikota Sibolga HM Syarfi Hutauruk yang diwakili Staf Ahli Pemko Sibolga H Junaidi Tanjung mengharapkan KNPI sebagai wadah berhimpun dapat mengorganisir semua potensi pemuda untuk memberikan kontribusi pemikiran dan kritikan terhadap proses kelangsungan pembangunan di Kota Sibolga. Ketua DPD KNPI Kota Sibolga Hendra Sahputra mengharapkan para peserta memanfaatkan forum Rakorda ini sebagai sarana menyusun program kerja DPD KNPI untuk 2011 serta menyusun berbagai pokok pikiran dan rekomendasi kepada pihak pemerintah dan DPRD Kota Sibolga. Rapat Kordinasi Daerah DPD KNPI dipimpin Ketua Steering Commitee (SC) DjafanawarTanjung dan Sekretaris Abdul Munir.(a34)

Pencuri Genset Di Masjid Raya Ditangkap

Waspada/Ibnu Kasir

Bupati Langkat H Ngogesa Sitepu didampingi Ketua DPRD H Rudi Hartono Bangun menyambut akrab perwakilan nelayan yang mengucapkan terima kasih atas bantuan bupati di aula Pegnasos Stabat, Jumat (28/1). Kepala Dinas Perikanan dan Kelautan Langkat H Nazaruddin melaporkan kegiatan ini bertujuanuntukmeningkatkankualitas dan kesejahteraan SDM nelayan,

meningkatkan produksi dan produktivitas hasil perikanan serta meningkatkan pemanfaatan dan pengendalian sumber daya hayati perairan. (a01)

P. SIANTAR (Waspada): Dua pelaku pencurian mesin genset di Masjid Raya Perdagangan, Kecamatan Bandar, Kabupaten Simalungunditangkap Polsek Perdagangan, Polres Simalungun. Kedua pelaku yakni SHH, 22, warga Jalan Sudirman, Kelurahan Perdagangan, dan JS, 29, warga Simalungun. Penangkapan terhadap SHH dilakukan sesudah pengurus Masjid Raya Perdagangan melaporkan ke Polsek Perdagangan tentang hilangnya satu unit mesin genset dari dalam gudang penyimpanannya pada Selasa (25/1) pukul 16:30. Mendapat laporan itu, Kapolsek Perdagangan AKP P. Panjaitan segera memerintahkan Kanit Reskrim Iptu Jhonson M Sitompul bersama personilnya segera melakukan penyelidikan. “Mendapat informasi itu, personil Polsek Perdagangan segera melakukan pencarian dan akhirnya menemukan JS di tempat persembunyiannya pada Rabu (26/1) pukul 18:00,” kata Kapolres Simalungun AKBP Marzuki, Kamis (27/1). (a14)

WASPADA Sabtu 29 Januari 2011

Setubuhi ABG, Divonis 9,5 Tahun Penjara RANTAUPRAPAT (Waspada) : Menyetubuhi anak di bawah umur, Syukur Laoli alias Syukur, 22, divonis pidana penjara selama 9 tahun 6 bulan, Rabu (26/1) di Pengadilan Negeri (PN) Rantauprapat.Warga JalanBalai Desa Gang Zaman, Kecamatan Rantau Utara, juga dihukum membayar denda Rp100 juta subsider 6 bulan kurungan. Majelis hakim yang memeiksa dan mengadili perkara terdakwa Syukur, Nelson Angkat menyebutkan, terdakwa terbukti bersalah melakukan tindak pidana, dengan sengaja membuat tipu muslihat, serangkaian kebohongan atau membujuk anak atau memaksa anak melakukan persetubuhan dengannya, sebagaimana didakwakan dalampasal81ayat(2)UUNomor23Tahun2002tentangPerlindungan Anak, pada dakwaan primer oleh Jaksa Penuntut Umum. Disebutkan, menurut para saksi termasuk saksi korban (sebut saja Mawar, 17, persetubuhan dilakukan terdakwa terhadap korban pada pertengahan tahun 2010. Korban dan terdakwa mengakui menjalin hubungan percintaan sejak Januari 2010 dan tidak diketahui orangtua korban karena terdakwa tidak pernah mau datang ke rumah. Pada pertengahan 2010, terdakwa melakukan hubungan suami istri dengan korban di sebuah pondok sunyi di Talaksimin, Kel. Ujungbandar, Kec. Rantau Selatan. Perbuatan yang sama mereka ulangi di tempat yang sama. Setelah terdakwa menyetubuhi korban 2 kali, korban meminta pertanggungjawaban terdakwa. Namun terdakwa mengelak. Korban akhirnya memberitahu perbuatan terdakwa kepada ibunya, MZ, serta keluarga Yuniman Zebua SE. Keluarga merasa keberatan atas perbuatan terdakwa dan melaporkan ke Polres L.Batu. (a27)

Pemalsu Pupuk Dituntut 3 Tahun, Denda Rp 1 Miliar RANTAUPRAPAT (Waspada): Terbukti memalsukan pupuk, terdakwa Suwarno, 51, warga Jalan Padang Bulan, Gang PGRI Rantauprapat, Kel. Padang Bulan, Kec. Rantau Utara, Kab. Labuhanbatu, dituntut Jaksa Penuntut umum (JPU) dengan pidana penjara 3 tahun dan denda Rp1 miliar subsider 6 bulan kurungan di Pengadilan Negeri (PN) Rantauprapat, Rabu (26/1). JPU Denny Trisnasari, SH dalam tuntutannya menyebutkan, terdakwa bersalah melakukan tindak pidana tanpa sengaja menggunakan merek yang sama pada pokoknya dengan merek terdaftar milik orang lain dan mengedarkan pupuk yang tidak sesuai dengan labelnya sebagaimana dalam dakwaan kesatu subsidair Pasal 91 UU RI tahun 2001 tentang Merek jo pasal 55 ayat (1) ke1 KUHP dan kedua Pasal 60 ayat (1) huruf f UU RI No.12 tahun 1992 tentang sistem budidaya tanaman jo Pasal 55 ayat (1) ke-1 KUH Pidana. Perbuatan terdakwa dikuatkan adanya keterangan saksi yakni, Turman Panggabean, SH. MH, Ir Rooy Bayer Nababan, Ir Catur Dian Mirzada, Susiono, Karman, Zulkarnain Surbakti, Insani, Yuli Erdi STP (keterangan saksi ahli) dan Novi Susanti, SH yang pada intinya menerangkan, terdakwa benar melakukan pemalsuan pupuk dan merek. (a27)

Mau Kenduri Uang Dijambret LIMAPULUH(Waspada): Sarinem,40,warga Desa Air Hitam, Kec. Limapuluh, Kab. Batu bara, Kamis (27/1) sekira pukul 13:40 menangis histeris di persimpangan eks Panti Nirmala Limapuluh setelah tas yang disandangnya dijambret pemuda bersepedamotor. Di sela isak - tangisnya Sarinem menuturkan ia baru turun dari bus asal Medan bermaksud balik ke kampungnya di Desa Air Hitam. Karena anaknya yang seharusnya menjemput di simpang tidak kunjung datang ia mondar-mandir disimpang itu. Korban yang terlihat kebingungan itu menjadi perhatian dua pemudayanggerak-geriknyamenurutwargamemangmencurigakan. Tiba-tiba mereka menghidupkan sepeda motor Suzuki Satria FU berwarna kuning langsung mengarah ke Sarinem dan menarik tas yang disandangnya. Korban yang terkejut dengan situasi itu sempat tertegun dan terjadi tarik menarik dengan pelaku namun tali tasnya putus dan tasnya berhasil dilarikan pelaku. Setelah menyebrang jalan barulah Sarinem berteriak “ rampok-rampok “ warga pun mengerumuni korban sementara seorang petugas yang berada di tempat itu mencoba melakukan pengejaran. Menurut keterangannya ia akan melaporkan peristiwa yang dialaminya ke Mapolsek Limapuluh. (a31)

L. Batu Siapkan Perangkat Penawaran Tender Proyek Lewat Internet RANTAUPRAPAT (Waspada) : Pemkab Labuhanbatu sedang mempelajari penyediaan penawaran tender proyek melalui layanan internet, sesuai Peraturan Presiden (Perpres) Nomor 54/2010 tentang Pengadaan Barang dan Jasa. Bupati Labuhanbatu dr Tigor Panusunan Siregar mengatakan, kini pihaknya sedang mempelajari secara menyeluruh tentang penggunaan penawaran tender proyek melalui internet yang dimulai tahun 2011 mendatang. Ditambahkan, salah satu yang menjadi kendala dalam realisasi penggunaan penawaran tender proyek bagi rekanan tahun 2011 termasuk masalah sumber daya manusia seperti operator dan jaringan internet sebagai akses layanan bagi masarakat, “Itulah salah satu kendalanya,” kata Tigor kepada wartawan. Wakil Bupati Labuhanbatu Suhari Pane mengatakan, Pemkab Labuhanbatu kini sudah mulai mempersiapkan melaksanakan (Perpres) Nomor 54/2010 tentang Pengadaan Barang dan Jasa dengan membentuk unit pengadaan pelayanan pengandaan dengan system Unit Layanan Pengadaan (ULP).(c01)

Anak Harus Disentuh Dengan Pendidikan AEKKANOPAN (Waspada) : Anak merupakan penerus keluarga, masyarakat dan negara, selaku orang tua dan pendidik harus mengoptimalkan seluruh potensi yang dimiliki anak dengan memberikan sentuhan pendidikan yang baik dan benar sehingga anak di masa mendatang menjadi anak yang sesuai sengan apa yang kita harapkan. Demikian Ketua TP PKK Labura Ny Hj Ely Zarwati Kharuddinsyah saat membuka workshop tutor dan penyelenggara pendidikan anak usia dini (PAUD) se Kabupaten Labuhanbatu Utara di aula Kantor Camat Kualuh Selatan, Kamis (27/1). Tampak hadir, Kadis Pendidikan Labura H Ridwan Rambe, SPd. MPd, Camat Kualuh Selatan Marwansyah, SH, Wakil Ketua TP PKK Labura Hj Elly Riana Minan Pasaribu serta para SKPD. Dikatakan Ely, demi suksesnya program Paud di Labura maka diperlukan pembinaan dan pelatihan bagi para pendidik dan tenaga pendidik anak usia dini sehingga mampu mengembangkan seluruh potensi yang dimiliki anak.(csi)

DPRD Labuhanbatu Akan Panggil Pemilik SPBU RANTAUPRAPAT(Waspada): Usai melakukan rapat dengar pendapat dengan pengusaha SPBU PT Bangko Bakti Persada terkait penyedotan kembali BBM dari tangki penyimpanan SPBU Simpang Mangga yang dimasukkan kembali ke truk tangki, Selasa (25/1), DPRD akan kembali memanggil pemilik SPBU, Kusbuana, untuk dimintai penjelasan. Pemanggilan itu dilakukan karena belum ditemukan titik temu penjelasan mengapa BBM yang sudah masuk kedalam tangki SPBU disedot kembali untuk dimasukkan kembali kedalam truk tangki. Demikian dikatakan Ketua Komisi B DPRD Labuhanbatu Akhyar Simbolon usai melaksanakan rapat dengar pendapat. Menurut Akhyar, berdasarkan keterangan yang disampaikan Manajer SPBU, Elvi Susanti penyedotan yang dilakukan adalah untuk memenuhi kapasitas yang harus dipenuhi sesuai dengan permintaan. Ronald Matio Siahaan anggota DPRD Labuhanbatu menyatakan keterangan yang disampaikan pihak SPBU dalam rapat dengar pendapat belum akurat dan simpang siur. (c01)

Sumatera Utara

B3

Solidaritas Kaum Tani Indonesia Demo P. SUSU (Waspada): 1.500 warga tergabung dalam Aliansi Solidaritas Kaum Tani Indonesia yang melakukan aksi demo sempat bertahan di areal perkebunan kelapa sawit PT JBP, Jumat (28/1), sementara untuk mengantisipasi hal tak diinginkan aparat kemananan tetap disiagakan. Sebagian besar pendemo memilih tetap bertahan dengan menginapdibawahratusantenda darurat yang mereka dirikan di sela-sela pohon kelapa sawit. Sekira pukul 16:00, para pendemo membubarkan diri dan meninggalkan areal perkebunan

sembari mengultimatum akan melakukan aksi 2 Februari 2011 di Kantor Bupati Langkat dengan membawa massa lebih banyak. Sementara, kalangan aparat penegak hukum menilai, dasar hukum tuntutan Aliansi Kaum Tanilemah.Jikapunpermohonan HGU PT JBP tidak diterbitkan pemerintahbukanberartimasyarakatdapatmengambilalihlahan. Akibat aksi demo ini, aktivitas buruh kebun, distribusi TBS dan pabrik kelapa sawit terganggu sehingga menimbulkan kerugian besar. Sebelumnya, pengurus Aliansi Solidaritas Kaum Tani Indonesia wilayah Telukaru menyurati Polres Langkat dengan tembusan Polda Sumut memohon perlindungan dan pengamanan dalam pengambilalihan lahan.

Surat warga yang mengugat dianggap perusahaan tidak ada dasar hukumnya, sebab lahan seluas 1.420 ha yang dikuasai perusahaan diperoleh melalui proses ganti rugi dengan masyarakat pemilik lahan yang sah. Menurut Humas PT JBP, Sugito Subandi, perusahaan memiliki izin sesuai ketentuan UU, seperti Izin Usaha Perdagangan, Izin Usaha Perkebunan Budidaya Komoditas Kelapa Sawit, TDP, Izin Gangguna (HO), Izin Lokasi dan perusahaan membayar PBB. Dikatakan,penasehathukum perusahaan telah melayangkan suratsebagaijawabansuratAliansi Solidaritas Kaum Tani. Apabila niat pengembil alihan lahan tetap dilaksanakan, maka warga dapat tejerat tindak pidana.(a02)

Kantor Lurah TB Kota IV Dilempar OTK TANJUNGBALAI (Waspada): Aksi-aksi orang tidak dikenal alias OTK terus terjadi di KotaTanjungbalai dan salah satu menjadi sasaran mereka Kantor Lurah Tanjungbalai Kota IV, Lingk. I, Kec. Tanjungbalai Utara, Jumat (28/ 1) pagi. Seorang saksi mata yang enggan disebutkan namanya kepada Waspada mengatakan, dia mendengar kaca pecah sekira pukul 06:00, dan ketika membuka pintu jendela untuk mencari asal suara, seorang lelaki tampak berlari ke belakang kantor, namun saksi tidak begitu jelas melihat ciri-ciri OTK tersebut karena gelap. Menurutnyalagi,diamengira yang menjadi sasaran pelemparan adalah rumah tetangganya, namun setelah dicek, ternyata

tidak ada kaca yang pecah. “ Saya pikirkacajendelarumahtetangga, namun ternyata bukan, ya saya kembali lagi ke rumah,” ucapnya Namun, sekira pukul 07:00, saat seorang pegawai kantor kelurahan Ade Hartono yang hendak membuka pintu kantor, terkejutmelihatkacatelahhancur berserakan dan di antara pecahan kaca ditemukan sebongkah batudankertasbertuliskanpesan. Dikatakan Ade, setelah dibuka ternyata kertas tersebut berisi pesan yang menyinggung Lurah dan Pejabat. Tapi diakhir tulisan, disebutkan kertas itu berasal dari teroris. “Kurang bisa dimengerti maksudnya,tapiyangjelasdiakhir pesan tertulis ‘from teroris’,” pungkas Ade yang juga Kepala

Lingkungan I. Kapolres Tanjungbalai AKBP Puja Laksana melalui Kasubbag Humas AKPY Sinulingga didampingi Kapolsek TBU AKP S Nainggolan dan Kanit Reskrim Aiptu M Silaban membenarkan dan telah menerima laporan. Menurut Silaban, belum diketahui motif pelemparan karena karena masih dilakukan penyelidikan. Selama dua bulan terakhir telah terjadi empat kali pelemparan dilakukan OTK, pertama rumah dinas KajariTanjungbalai, Jumat(17/12)dinihari,kemudian KantorDispora,Kamis(13/1)pagi, selanjutnya mobil dinas anggota DPRD Fraksi PDI Perjuangan, Jumat (14/1) sore, dan yang keempat Mess Pemprovsu, Minggu (16/1) siang. (crs)

Dugaan Korupsi ADD Pematang Panjang, Kades Diadukan Ke Polres Asahan LIMAPULUH (Waspada) : Badan Permusyawaratan Desa (BPD) Pematang Panjang, Kecamatan Limapuluh, Kabupaten Batubara, Rabu (26/1) telah mengadukan kasus dugaan korupsi dana Alokasi Dana Desa (ADD) Tahun Anggaran 2009-2010 yang melibatkanKadesPematangPanjang MS ke Polres Asahan. “Kita telah mengadukannya ke Polres Asahan. kita berharap pihak kepolisian secepatnya memeriksaKadesMS,”kataKetua BPD Pematang Panjang Taufik Helmi didampingi anggota Hamdandansejumlahtokohmasyarakat dan pemuda, Jumat (28/1)

di Desa Pematang Panjang. Dijelaskannya, surat pengaduan bernomor 04/BPD-PP/I/ 2011 itu diterima Kasi Umum Polres Asahan S Mariati Hutahaean. Dalam surat itu disebutkan,dugaantindakpidanakorupsi itu dilakukan dengan cara memark-up dana perehaban bangunan Balai Desa Pematang Panjang. “Dugaan korupsi itu juga telah menjadi temuan Komisi A DPRD Batubara saat melakukan peninjauan beberapa waktu lalu. Untuk tahun anggaran 2009 sebesar Rp98.223.394. Dugaan korupsi juga terjadi terhadap

ADD 2010,” ujarnya. Sementara itu anggota BPD Pematang Panjang Hamdan mengakusebelumnyapihaknyatelah mengadukan masalah itu kepada Bupati Batubara, Badan PemberdayaanMasyarakatdanPemerintahan Desa (BPMPD) Batubara, DPRD Batubara, Camat Limapuluh, dan Inspektorat Batubara. “Namun sampai saat ini pengaduan itu belum ditindaklanjuti. Malah rekomendasi yang belum lama ini diterbitkan DPRD Batubara agar oknum Kades MS segera dicopot juga belum direspon Bupati. (a31)

Marpoken Ala Rekanan Menunggu Proyek Di L. Batu KOTAPINANG (Waspada) : Marpoken salah satu istilah bila sedang musim proyek di Labuhanbatu. Para rekanan biasanya hilir-mudik di instansi perkantoran yang menyelenggarakan pelelangan proyek. Mulai dari mengajukan pendaftaranhinggaprosespengumuman lelang tak henti rekanan datang dan pergi. Proses waktu pelelangan dan pekerjaan yang cukup lama tentu terjalin hubungan antara rekanan dengan pengawas/PPK (Pejabat Pembuat Komitmen) sehingga menghasilkan hubungan kekeraban yang cukup kental dan kuat. Namun sayang. Hubungan yangbaikitukebanyakanrekanan menafsirkan salah. Terutama dalam menjaga kualitas pekerjaan. Rekanan, baik di daerah kabupaten pemekaran maupun rekanan yang berada di kabupaten induk masih menafsirkan bahwa dalam pekerjaan fisik diutamakan keuntungan sebesarbesarnyabukanmenjagakwalitas pekerjaan. Apakah pekerjaan fisik yangdipercayakaninstansiterkait kepada rekanan layak untuk dinikmati rakyat atau tidak. Hasilnya sangat mencengangkan. Pekerjaan fisik hasil tender di 2010 khususnya proyek di PU Pertambangan, Energi Kab. Labusel sangat amburadul dan rusak walau baru dikerjakan. Mulai dari proses pelelangan atau tender sudah menunjukkan tanda-tandabakalpekerjaanyang dilaksanakanrekananpemenang jauh dari kwalitas. Pertanda itu dimulai ada kecurangan yang diduga dilakukan panitia demi memuluskan ‘jagoannya’. Wajar saja pada masa pelelangan terjadi kericuhan antara rekanan dan panitia. Saat tiba pengerjaanpun, banyak rekanan kalang kabut dibuat PPK PU Labusel. Pasalnya,

Anak Lembu Berkepala Dua Ditemukan Di Asahan PULAUBANDRING (Waspada) : Seekor anak lembu yang lahir dengan kepala dua dan bertumbuh satu ditemukan di Kabupaten Asahan, namun setelah beberapa detik lembu itu lahir akhirnya mati, Kamis (27/1) sekitar pukul 20:00. Lembu jantan itu binatang ternak piaraan Supian, 45, warga Dusun IV, Desa Tanah Rakyat, Kecamatan Pulaubandring, Kabupaten Asahan. Pada awalnya tidak ditemukan kelainan pada ibunya, layaknya seperti lembu yang mengandung sedikit bergerak, namun banyak makan rumput. Namun tiba-tiba sewaktu menjelang malam (habis Maghrib) lembunya bersuara keraspertandaakanmelahirkan,sehinggaSupian bersama istrinya Sugianti, 40, mendatangi kandang yang berada di belakang rumah. Mereka melihat lembu betina sedang proses melahirkan dengan mengeluarkan kaki dari rahimnya.Tapi kaki itu tidak keluar keseluruhan, sehingga Supian meminta bantuan Mantri Desa untukmembatupersalinanlembunya, akibatnya kaki itu ditarik dengan berlahan.

Namun di luar dugaan, Supian beserta istri dan warga yang ikut menyaksikan proses melahirkan itu terkejut, ketika melihat anak lembu itu mempunyai kepala dua, tapi berbadan dan berekor satu serta kakinya hanya empat, berselang beberapa detik lembu itu tewas. Wargasekitaryangmendengarhalitumenjadi heboh dan berduyun-duyun datang ke kandang lembumilikSupian,untukmenyaksikanlangsung anak lembu itu, hingga Jumat siang, lembu itu baru dikuburkan. “Saya tidak menyangka, lembu saya melahirkan anak berkepala dua, namun mungkin Allah tidak mengizinkan, sehingga anak lembu itu berumur pendek. Dan saya berharap ini bertanda bagus,” ungkap Supian, Kamis (28/1) di kediamannya. DokterHewanKabupatenAsahandrYusnani mengatakan, anak lembu berkepala dua itu, sama halnya dengan manusia yang lahir kembar siam. Hal itu terjadi karena gagalnya sel telur saat proses pembentukan, disebabkan kurangnya asupan gizi di saat binatang itu mengandung. (csap)

Mendagri Didesak Segera Keluarkan SK Bupati Labusel KOTAPINANG (Waspada): Belum dilantiknya pasangan Bupati danWakil Bupati terpilih Kabupaten Labuhanbatu Selatan Wildan AswanTanjung-Maslin Pulungan (Wilmas) sampai saat ini, menyusul belum turunnya surat keputusan (SK) pengangkatan dari Menteri Dalam Negeri(Mndagri)mengusikketenangansejumlah elemen masyarakat Labusel. Mendagri dinilai telah menghambat jalannya proses pembangunan. Hal itu diungkapkan Sekretaris Komite Nasional Pemuda Indonesia (KNPI) Labusel Abdullah Situmorang kepada Waspada, Kamis (27/1). Menurutnya, terhambatnya proses pelantikan bupati terpilih yang disebabkan lambannya Kemendagri mengeluarkan SK telah membuat semua program dan visi-misiWilmas saat kampanye pada Pemilukada lalu belum dapat dilaksanakan. Padahal kata Abdullah, saat ini masyarakat sudah berharap agar visi-misi tersebut dapat dilaksanakan.ApalagisaatiniLabuselperlusegera dibenahi sehingga tidak tertinggal dari kabupaten lainnya di Sumatera Utara.Terlebih setelah disahkannya APBD 2011 Labusel pada 31 Desember lalu. Akibat belum dilaksanakannya visi-misi lanjut dia, sistem pengawasan masya-

rakat juga belum dapat dilaksanakan. “Inikan jadi persoalan. Harusnya kalau sudah dilantik mereka dapat menjalankan visi-misinya, dankamisebagaimasyarakatkhususnyapemuda dapat mulai memonotoring kinerja mereka,” kata pria yang juga menjabat sebagai Ketua Ikatan Cendekiawan Muslim Indonesia Labusel itu. Menurut Abdullah, proses administrasi untuk pengeluaran SK tersebut oleh Mendagri telah berjalan terlalu lama. Sebab, surat tersebut sudah sampai di Kemendagri sejak hampir sebulan lalu. Karenanya dia berharap Mendagri segeramenerbitkanSKitu,sehinggaDPRDLabusel dapat segera membentuk Badan Musyawarah (Banmus) untuk merumuskan jadwal pelantikan. Sementara secara terpisah Kabag Pengembangan Daerah, Biro Otonomi Daerah Provsu Syaiful M Hutasuhut yang dikonfirmasi Waspada via selular, memastikan sampai saat ini SK pengangkatan Bupati Labusel belum turun dari Kemendagri.Menurutnya,jikaSKitutelahdikeluarkan maka akan sampaikan pada pihaknya. “Kita belum tahu kapan SK-nya turun.Yang jelas sampai hari ini SK itu belum ada. Mungkin dalam waktu dekat ini. Setelah SK-nya turun baru mereka dapat dilantik sebagai kepala daerah defenitif,” kata Hutasuhut. (cden)

Bupati Labura Rujuk Wahyudi Ke RS Pirngadi

Waspada/Neiru Nizam

PECAH-PECAH: Jalan hotmix menuju Dusun Tugu Sari Desa Sisumut Kec. Kota Pinang walau baru dikerjakan kondisi badan jalan sudah banyak pecah-pecah dan rusak. saat anwijing disepakati jaminan uang muka 30 persen diharapkan rekanan dari asuransi dan saat itu disetujui oleh salah seorang panitia yang dipercaya tampil sebagai pembicara. Tapi, saat pelaksanaan pekerjaanPPKPULabusel‘mangkir’. Nyaris pekerjaan infrastruktur yang dibidani PU Labusel tidak selesai. Kalaupun rekanan mengerjakan ‘tenaga terseok-seok’ sebab wajib meminjam uang kepada siapa yang mau memberi utang. Namun tidak ketahui pasti, apakah rekanan yang mengerjakan proyek pengaspalan hotmix di Blok Songo menuju Dusun Tugu Sari Desa Sisumut, Kec. Kota Pinang dengan pagu anggaran sebesar Rp 1.063.371. 000, yang dikerjakan rekanan PT PB, direktur perusahaan MRZ. Apakah bermasalah dengan keuangan.

Waspada/Sapriadi

LEMBU BERKEPALA DUA : Anak lembu jantan berkepala dua milik Supian, 45, warga Dusun IV, Desa Tanah Rakyat, Kecamatan Pulaubandring, Kabupaten Asahan, mati saat setelah beberapa detik dilahirkan, Kamis (27/1). Karena peristiwa itu tergolong jarang terjadi, sehingga warga sekitar berduyun-duyun datang untuk melihat langsung anak lembu itu. Foto direkam, Jumat (28/1).

Namun melihat hasil pekerjaannya sangat mengecewakan. Baru saja dikerjakan, aspal hotmixnya sudah pecah-pecah dan banyak yang rusak. Melihat kondisi badan jalan sebelum dihotmix, jalan menuju Dusun Tugu Sari itu pondasi badan jalan cukup keras. Inilah yang menimbulkan kecurigaan, apa betul ketebalan LPA dan LPBnya serta aspal hotmixnya sudah sesuai dengan bestek ? Allahua’ lam. Sementara itu Kadis PU Pertambangan dan Energi Kab. Labusel melalui PPK Ir. Aunillah asal Kab. Sergai itu ketika dikonfirmasi Waspada, Selasa (25/1) melalui telefon tidak diangkat di sms tidak dijawab. Sangat disayangkan PPK yang merupakan ujung tombak dalam penentuan pekerjaan layak atau tidak untuk di BA kan ternyata sangat sulit untuk berkomunikasi dengan publik. (a26)

AEKKANOPAN (Waspada) : Bupati Labuhanbatu Utara H Kharuddinsyah, SE merujuk Wahyudi Syahputra, 21, warga Aekkanopan Timur, Kec. Kualuh Hulu ke rumah sakit umum Pirngadi Medan Selasa pekan lalu. Wahyudi Syahputra terdiagnosa penyakit luka bakar sekujur badan, akibat terkena tegangan listrik di Jl Jenderal Sudirman Aekkanopan, 13 Juli 2010 silam, namun belum dapat sembuh karena kekurangan biaya. Spontanitas Bupati Labura H Kharuddinsyah, SE yang dikenal berjiwa sosial tinggi ketika mengetahuiWahyudi masih merasakan kesakitan akibat luka bakar langsung tanggap dan merujukWahyudi ke Rumah Sakit Pringadi Medan untuk mendapatkan perawatan intensif. Bupati Labura H Kharuddinsyah, SE menjelaskan, dirinya merasa bertanggung jawab apa yang telah dirasakan keluarga korban, untuk

itu Pemkab Labura akan membiayai Wahyudi sampai sembuh. Sementara di RS Pringadi Medan nampak sejumlah fungsionaris DPP Formap Labura dan anggota DPRDSU Sumut menjenguk Wahydi Syahputera di antaranya Ketua Umum Haris Muda Siregar, Sekretaris Rudi Syahputra, Bendahara M Indra dan Ketua Departemen Kesehatan Annisa Racmi dan Dewan Pembina Formap Labura H Isma Padli Ardhya Pulungan (Sekretaris Komisi A DPRDSU). Haris Muda Siregar kepada Waspada Rabu (26/1) usai menjenguk Wahyudi Syahputra mengatakan, langkah yang dilakukan Bupati LaburaHKharuddinsyah,SEmerupakanlangkah yang kontruksional yang tanggap dari seorang bupati dalam merujuk ke RS Pringadi Medan, sehingga diharapkan Wahyudi akan segera sembuh, karena korban tulang punggung dalam keluarga.(csi)

50 Persen Lahan Tambak Batubara Berubah Fungsi LIMAPULUH (Waspada) : Kadis Perikanan dan Kelautan Batubara Azuar Hamid mengharapkanmasyarakatuntukmengoptimalkanlahan pertambakanmengingatbanyaknyasudahterjadi konversi alihfungsi lahan menjadi perkebunan kelapa sawit. ‘’Ini sangat kita sayangkan karena hampir 50 persen lahan pertambakan sekarang sudah berubah fungsi menjadi perkebunan.Padahal nilai ekonomis hasil perikanan cukup tinggi,’’ kata dia dalam acara penaburan benih perdana program wirausaha pemula polikultur air payau di Jalan Bandeng, Desa Masjid Lama, Kec.Talawi, Kamis (27/1). Mewujudkan Indonesia produk kelautan terbesar di dunia, Pemkab Batubara galakan budidaya perikanan sekaligus melakukan penaburan benih perdana. ‘’Melalui program ini diharapkan Batubara bisa menjadi pasokan terbesar pertama untuk sektor perikanan di Indonesia,’’ kata Bupati BatubaraHOKAryaZulkarnaindiwakiliInspektur

Inspektorat H Sakti Alam Siregar Selain itu diberikan juga bantuan benur udang windu dan ikan bandeng bersumber dari APBN kepada enam kelompok masyarakat (Pokmas) Kec. Tanjungtiram dan Talawi untuk dibudidayakan. Dirinyamengakupotensiperikananmengandungnilaiekonomisyangtinggidiharapkandapat dimanfaatkan sebagai menambah pendapatan masyarakat. Apalagi Batubara mulai dari Kec. Medang Deras sampaiTanjungtiram merupakan wilayah pantai yang berhadapan langsung dengan laut Selat Malaka cukup mendukung dalam budidaya perikanan. ‘’Jika pendapatan meningkat secara otomatis sejahtera yang merupakan bagian dari harapan bersama,’’ ujarnya sembari mengatakan dengan gebrakan dilakukan diharapkan dapat mengangkat wilayah pesisir dari imej selama ini. Sedangkan Dirjend Budidaya Kementerian Kelautan menargetkan Batubara diharapkan produkperikanan/budidayasetiaptahunsebesar 30 persen. (a11)

B4

Sumatera Utara

Hamili Kekasih Diadukan

Yayasan dr’s ‘Koffie’ Medan Bantu Pengobatan Gratis Warga Sergai

P. SIANTAR (Waspada): Kandungan seorang perempuan muda diduga sudah digugurkan sesuai permintaan kekasihnya, tapi PGS, 24, warga Jalan Sipisopiso, Kecamatan Silimakuta, Simalungun tetap tidak mau bertanggungjawab hingga akhirnya menjadi urusan pihak Polres Simalungun. Keterangan dihimpun di Polres Simalungun, Selasa (25/1), korban MMT, 20, warga Nagori Panribuan, menyebutkan, PGS mencabuli dirinya di dalam rumah PGS hingga hamil pada Juli 2010. Perbuatan cabul itu dilakukan PGS terhadap korban ketika PGS menghubungi korban melalui SMS. PGS meminta korban datang ke rumahnya dengan alasan dia sedang sakit. “Pengaduan korban masih dalam penyelidikan dan PGS diduga melakukan tindak pidana perbuatan cabul dan melanggar Pasal 293 KUH Pidana,” kata Kapolres Simalungun AKBP Marzuki saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu di Mapolres, Rabu (26/ 1). (a14)

Pensiunan PNS Serobot Tanah P. SIANTAR (Waspada) : Seorang perempuan penisunan PNS, Ha, 77, warga Nagori Kerasaan I,Pematang Bandar, diduga menyerobot tanah orang lain hingga diadukan ke Polres Simalungun. Keterangan dihimpun menyebutkan, Ha diduga menyerobot tanah milik korban Isnawati Saragih, 49, warga Jalan Kasad Belakang, Pematangsiantar di Nagori Kerasaan I, Pematang Bandar, Selasa (25/1). Menurut korban, Ha menyerobot tanahnya dengan mensertifikatkan tanahnya itu menjadi atas namanya. Padahal, tanah itu merupakan tanah hibah dari orangtua korban dan kakak serta abang kandung korban. Kapolres Simalungun AKBP Marzuki melalui Kasubbag Humas AKP Sulaiman Simanjuntak, Rabu (26/1) menyebutkan, pengaduan korban masih dalam penyelidikan dan sudah menyita satu fotokopi surat hibah atas nama korban, sedang Ha diduga melakukan tindak pidana penyerobotan tanah dan melanggar Pasal 385 KUH Pidana. (a14)

Pengawasan Penyaluran Dana PUAP Kepada Gapoktan Dinilai Lemah KABANJAHE (Waspada) : Pengawasan penyaluran dan pengelolaandanapengembanganusahaagribisnispedesan(PUAP)dariKementerian Pertanian ke gabungan kelompok tani (Gapoktan) sejak 2008 hingga 2010 penyalurannya khusus di Kabupaten Karo sebanyak 110 Gapoktan dinilai lemah. Penilaian lemah diakui Kepala Badan Penyuluhan Pertanian, Perikanan, Peternakan dan Kehutanan Karo Martin Sitepu, Rabu (26/1). Karena pengelolaan dan kewenangan penuh diberikan kepada masyarakat kelompok tani yang tergabung dalam Gapoktan agar masyarakat lebih dewasa dalam mengelola usaha keuangan.Tim teknisdalamhaliniadalahpenyuluhanyanghanyasebagaipengawasan di luar dari Gapoktan. Lebih lanjut dikatakannya, petunjuk teknis (juknis) pengelolaan keuangan yang diimplementasikan ke bentuk permodalan seperti usaha pertanian, saprodi dan jual beli gabah juga diizinkan. Namun tidak dipaksakan bagaimana harus pengelolaannya, sebab sewaktu waktu rembuk kelompok dengan beragam masukan pengelolaan keuangan bisa berubah-ubah dan tidak ada intervensi dari pihak manapun. (cdb/a17)

SHU Primkopad Korem 022/PT P. SIANTAR (Waspada): Sisa Hasil Usaha (SHU) Primkopad Korem 022/PT untukTahun Buku 2010 mencapai Rp104.159.417, atau lebih rendahdibandingkanSHUTahunBuku2009mencapaiRp131.336.412. SHUTahun Buku 2010 diungkapkan saat Rapat AnggotaTahunan (RAT) Primkopad Korem 022/PT dan dibuka Danrem 022/PT Kolonel Inf Karsiyanto di aula Makorem 022/PT, Kamis (27/1). RAT dihadiri Ketua Dekopinda dan Kadis Koperasi dan UMKM Kota Pematangsiantar serta anggota Primkopad Korem 022/PT. Danrem menyebutkan, RAT merupakan pemegang kekuasaan tertinggi dalam koperasi. Melalui RAT dapat ditetapkan kebijakan di bidang manajemen dan usaha koperasi, pemilihan, pengangkatan, pemberhentian pengurus dan pengawas, rencana kerja, rencana anggaran pendapatan dan belanja koperasi serta pengesahan laporan dan pertanggungjawaban keuangan pengurus dalam pelaksanaan tugas yang tertuang dalam RAPB tahun 2010. (a14)

Paket DAK Tahun 2010 Selesai Dikerjakan KABANJAHE (Waspada) : 39 Paket dana alokasi khusus (DAK) senilai Rp4.694.119.870 yang dikelola Dinas Pendidikan Kabupaten Karo tahun 2010, telah selesai dikerjakan sesuai peruntukannya. Masing-masing kegiatan berupa rehabilitasi berat sekolah SMP sebanyak sembilan unit berada di kecamatan Kabanajahe dua unit, Berastagi dua unit, Munte satu unit, Tiga Binanga satu unit, Kuta Buluh satu unit, Mardinding satu unit dan Barusjahe satu unit. Untuk rehabilitasi sebanyak lima unit, masing - masing di kecamatan Tiga Panah satu unit, Munte satu unit, Juhar satu unit dan Kabanjahe dua unit. Sedangkan pembangunan ruang kegiatan belajar (RKB) dan meublair SMP terdapat delapan unit, yang berada di Kecamatan Tiga Panah satu unit, Dolat Rayat satu unit, Barusjahe dua unit, Simpang Empat satu unit, Merek dua unit dan Kabanjahe satu unit. Kadis Pendidikan Seruan Sembiring di dampingi PPK Kegiatan, Kasta Berahmana, Rabu (26/1) mengatakan, kegiatan bersumber DAK pada tahun 2010 telah selesai dikerjakan dengan baik, sedangkan pemeliharaan berlangsung selama enam bualan dan dana lima persen dari tiap paket, masih ditahan sebagai jaminan pemeliharaan. (cdb)

Penganiaya Divonis 4 Tahun KABANJAHE (Waspada) : Penyerang rumah makan dengan menggunakan senjata tajam divonis empat tahun tahun penjara. Dengan melangar pasal 354 KUHPidana dengan menggunakan senjata tajam hingga tiga orang luka – luka. Sidang yang digelar di Pengadilan Negeri Kabanjahe di Jalan Jamin Ginting Rabu (26/1) sore, dipimpin ketua majelis Hakim Dwina Kusumastanti SH beserta dua anggotanya Jasael dan Khatarina M Siagian memvonis empat tahun penjara kepadaTerangkap Ginting, 35, warga Desa Tiga Panah, Kec. Tiga Panah. Hukuman tersebut, lebih ringan dari tuntutan JPU Sumangger Siagian SH MH yang sebelumnya menuntut terdakwa dengan ancaman lima tahun kurungan penjara. Di depan majelis Hakim, terdakwa mengakui perbuatanya dan berjanji tidak akan mengulangi. (cdb)

Warga Menanti Bupati Karo KABANJAHE (Waspada) : Hingga saat ini, penantian panjang atas kepemimpinan orang nomor satu di Kabupaten Karo belum juga dapat dirasakan masyarakat Karo. Sehingga membuat keterlambatan pembangunan daerah serta kemajuan terlambat atas belum dilantiknya Bupati Karo terpilih DR (HC) Kena Ukur Karo Jambi Surbakti dan Wakil Bupati Terkelin Berahmana. Menagapi hal tersebut Ketua KPU Karo, Benyamin Pinem, Kamis (27/1) mengatakan, hingga saat ini kasus keterlambatan pemimpin di Karo sudah ditangani pihak DPRD Karo dan pihaknya sudah menyurati DPRD agar dalam waktu tiga hari, DPRD memberikan hasil keputusan Menteri Dalam Negri. “Tiga hari kita beri waktu, untuk DPRD Karo dalam menjawab surat yang kita layangkan dan diteruskan oleh mereka ke Mendagri. Dan secepatnya juga mereka memberi jawaban kepada masyarakat, kapan di lantiknya orang nomor satu di Karo,” jelasnya. Menanggapi hal itu, aktivis Dari DPP PHP (Perjuangan Hukum Politik) Indonesia Bakterah Ginting mengatakan, agar realisasi tahapan pelantikan bupati terpilih, baik sinkronisasi antara pihak KPU dan DPRD Karo bisa melanjutkan tahapan ke Gubsu dan Mendagri. (cdb)

WASPADA Sabtu 29 Januari 2011

Waspada/Eddi Gultom

BAKSOS GRATIS : Bupati Sergai Ir HT Erry Nuradi, MSi di Sei Rampah, Rabu (26/1) menerima kunjungan pengurusYayasan dr’s “Koffie” Medan melaporkan rencana kegiatan bakti sosial kesehatan gratis bagi 1.000-an warga kurang mampu di Kabupaten Sergai.

DPD PAN Belum Serahkan Nama Kandidat Ketua Ke DPW Musda PAN P. Siantar Ditunda P. SIANTAR (Waspada): Musda IV PAN Kota Pematangsiantar yang seyogianya dilaksanakan di Siantar Hotel, Pematangsiantar, Sabtu (29/ 1) ditunda menjadi Jumat (12/2) karena DPD PAN Pematangsiantar belum menyerahkan nama-nama kandidat Ketua DPD PAN periode 2010-2015 ke DPW PAN Sumut. “Panitiabelumbisamempersiapkan seluruh perangkat termasuk administrasi dan berkasberkas kandidat ketua,” sebut KetuaPanitiaPelaksanaSamsudin Harahap didampingi Sekretarisnya M. Turmuzi dan Bendahara Romy Koto, Ketua Panitia PengarahM.AliHarahapdanSekretarisnya Osner Sitio serta Humas Panitia Fadri Sikumbang di sekretariatpanitiaMusdaIVPAN,Jumat (28/1). Menjawab pertanyaan, Samsudin mengungkapkan tahapan pelaksanaanMusdatidakberlangsung lancar terutama rekomendasi tentang peserta Musda dan berkas-berkas kandidat ketua DPD PAN belum diserahkan kembali kepada panitia.

“Banyak mengaku-ngaku sebagai peserta dengan menunjukkan fotokopi SK. Sesuai ketentuan hanya 76 peserta Musda yang mempunyai hak suara terdiri tiga DPD, 16 DPC, 53 DPRt, satu MPP, satu DPW dan masingmasing satu dari BM PAN dan PUAN. Namun, yang mendaftar 90 peserta,”katanya. Menurut Samsudin, sesuai ketentuan, DPD PAN Pematangsiantar merupakan penanggungjawab Musda dan bila panitia menghadapikendalaakanmengkonsultasikannya kepada DPD. “Kami sudah mengkonsultasikan ke DPD siapa yang berhaksebagaipesertaMusdaseperti pengurus DPC dan DPRt yang sudah pindah ke partai lain termasuk berkas kandidat ketua, namun sampai saat ini tidak ada jawaban atau rekomendasi dari DPD,”ujarnya. Selain itu, ungkap Samsudin, panitia sudah dua kali rapat, pertama 7 Januari 2011 dan terakhir Jumat (28/1), namun undangan rapat yang disampaikan panitia tidak pernah dihadiri DPD. Ali menambahkan, pihaknya sudah menemui langsung Ketua DPD PAN Drs. H. Imal Raya Harahap, Kamis (27/1) dan jawaban yang mereka terima yakni namanama kandidat ketua DPD PAN akandisampaikanDPDPANlangsung kepada DPW PAN Sumut,

Jumat (28/1). Mernjawab pertanyaan, Ali menyebutkan DPD PAN tidak berhak merekomendasikan nama-nama kandidat ketua seperti mencoret nama kandidat ketua sebelum menyerahkan kepadaDPWPANSumut,namun DPD PAN hanya berhak membuat catatan-catatan tentang kandidat ketua itu. “Yang berhak merekomendasikan nama-nama kandidat ketua hanya DPW dan DPP,’’ ucapnya Samsudin tidak menampik kemungkinan terjadi ketidakharmonisan antara Ketua DPD PAN dengan Sekretarisnya Ir. Wandy M Koto, karena keduanya turut mendaftarkan diri sebagai kandidat Ketua DPD PAN Pematangsiantar periode 2010-2015 bersama anggota DPRD H. Aulul Imran, SPdI dan Wakil Ketua DPRD Zainal Purba, keduanya asal PAN hingga nama-nama kandidat ketua itu sudah satu bulan diserahkan kepada DPD PAN, namun belum diserahkan kepada DPW PAN. Kami akan berangkat ke Medan menemui DPW PAN Sumut untukmengkonsultasikanpenundaan Musda itu sekaligus melaporkan berbagai tahapan yang sudah dilakukan panitia serta kendala yang dihadapi hingga Musda terpaksa ditunda, sebut Samsuddin.(a14)

Koramil 05 Razia Togel, Jurtul Dibiarkan KABANJAHE (Waspada) : Komandan Rayon Militer (Danramil)Tiga Nderket Kapten Inf.D.Pandia mengambil alih mengelar razia nomor tebakan berhadiah kelipatan uang, Kamis (27/1) di beberapa titik pedesaan Tiga Nderket tanpa dididampingi polisi. Razia tersebut terkesan menakut- nakuti masyarakat setempat,terlihatdarihasilrazia,mereka hanya mengamankan rekap berisikan tulisan angka - angka, namun para jurtul tidak diangkut ke Koramil dan dibiarkan saja. Menangapi permasalahan tersebutDandim0205TanahKaro Letkol Inf. Meyer Putong saat di hubungi wartawan mengatakan sedang rapat di Sibolga. Lalu dia menganjurkan menghubungi Pasi Intel Kodim. Pasi Intel Kodim 0205/Tanah Karo Kapten, Inf. JunaidiTarigan membenarkan, ada razia yang digelar oleh Koramil 05 Tiga Nderket. Sebelum digelar razia, katanya, Danramil 05 terlebih dulu nmenerima laporan atau informasi, dari warga Tiga Nderket terutama kaum perempuan yang merasa resah atas perjudian toto gelap.

Menindaklanjutiraziaini,kata Pasi Intel, akan berkordinasi dengan Kepolisioan Sektor Tiga Nderket dan sebelumnya telah memberitahukan kepada Dandim. Sementara, Kapolsek Tiga Nderket AKP. E. Situmorang ketika dikonfirmasi menyebutkan, telah mendapat laporan dari anggota polisi mengenai adanya gelar razia Togel oleh Koramil 05, namun belum ada kordinasi. “Sampai sore ini, Koramil belum memberikan barang bukti apapun kepada Kepolisian atas

digelarnyaraziatogelitu,’’jelasnya. Sedangkan Kapolres Tanah Karo AKBP. Ig. Agung Prasetyoko ketika di hubungi wartawan mengatakan, belum mendapat laporan Koramil 05 melakukan razia Togel di wilayahnya. Lebih lanjut dukatakannya, Koramil 05 bisa – bisa saja melakukan razia, jika akan menyerahkan barang bukti dan tersangka kepada Kepolisian.Tetapi menurut perundang-undangan sebenarnya Koramil tidak bisa razia seperti itu. (cdb/cmm)

Wabup Dairi Lantik 186 Pejabat Struktural Dan Fungsional SIDIKALANG (Waspada):Wakil Bupati (Wabup) Dairi Irwansyah Pasi, SH melantik 186 pejabat struktural dan jabatan fungsional di lingkungan Sekretariat Pemkab, Jumat (28/1) di Balai Budaya Sidikalang, dengan disaksikan unsur Muspida dan tokoh agama. 128 Jabatan struktural terdiri dari eselon IV, III dan eselon II. Sedangkan jabatan fungsional 58, terdiri dari guru, kepala sekolah dan pengawas sekolah. Irwansyah, seusai pelantikan mengatakan, dalam pelantikan itupastiadayangsenangdanadayangtidaksenang.Namun,pelantikan itu tetap mengacu pada kinerja dan prestasi seseorang, setelah melalui proses Baperjakat. Bukan karena teman atau famili.(a28)

Pengurus Lira Kota Sibolga Dilantik SIBOLGA (Waspada) :Wakil Presiden(Wapres)DPPLumbung Informasi Rakyat (LIRA) Imam BogieYudiswara melantik Pengurus DPD Lira Kota Sibolga periode 2011 – 2014 di Gedung Nasional, Jalan FL Tobing, Kamis (27/ 1). Pengurus yang dilantikWalikota Lira Kota Sibolga Hotma Nainggolan,WakilWalikotaKusnan Efendy Situmorang, Sekretatis Daerah Hendra Sahputra,Wakil Sekretaris Daerah Bachtiar Sinaga,BendaharaMidianSiregardan Wakil Bendahara Goppis Simarmata serta dilengkapi dengan Asisten, Kabag, Kadis, Suku Dinas serta Asisten Manager Eksekutif. Walikota Sibolga HM Syarfi Hutauruk dalam sambutan tertulisnya yang dibacakanWakilWalikota Marudut Situmorang berharap kehadiran Lira di Kota Sibolga dapat mengambil peran strategis untuk mendorong keadilan, kete-

gasan, kepastian hukum demi kemajuan Kota Sibolga. “Jika dalam situasi kemasyarakatanterjadiguncangan,perbedaan pendapat, disharmoni antara elemen masyarakat, maka Lira harus mampu menjadi moderator untuk memberi solusi dan sekaligus merangkul semua element masyarakat, sehingga tujuan–tujuanbesardalammembangun daerah dapat tercapai,” katanya. Saat ini, lanjutnya, demokrasi dan system pollitik membutuhkan organisasi kemasyarakatan serta individu – individu di berbagai komunitas yang mampu bertindak dan melakukan berbagai aktivitas secara mandiri, otonom, keratif serta bertanggungjawab. “Saya sangat yakin, kepengurusan DPD Lira kota Sibolga akan terus mengingatkan dan menjadi pengawal terdepan dalam pem-

bangunan Sibolga,” tandasnya. SedangkanWalikotaLiraKota Sibolga Hotma Nainggolan mengatakan, Lira Kota Sibolga adalah sebuah lembaga bagi masyarakat sipil yang mampu melakukanpengawalanterhadapperjalanan Pemerintahan dalam muara pembangunan kesejahateraan rakyat. Sebagailembagaindependen yang mandiri, akan menggiring proses perbaikan masyarakat untuk mendorong terciptanya embrio aktualisasi nilai transparansi demi pertanggungjawaban moral yang akuntabilitas“Lira ada dan berkarya sebagai lembaga progress rill control social yang dilandasi niat dan tekad untuk rakyat berdaulat,” katanya. Sementara, Gubernur LIRA Sumatera Utara (Sumut) Rizladi Mavimengatakan,kehadiranLira di Kota Sibolga bukan sebagai alat menakut – nakuti.(a18)

SEI RAMPAH (Waspada): Yayasan dokter spesialis (dr’s) ‘Koffie’ Medan yang dipimpin dr Irwanto Than pada tanggal 13 Februari 2011 akan menggelar bakti sosial kesehatan berupa pelayanan pengobatan gratis bagi 1.000-an warga kurang mampu di Kab. Serdang Bedagai. Program itu disampaikan dr Irwanto Than didampingi pengurusYayasan dr’s‘Koffie’ dr Surya Wijaya, AliceWijaya dan Sofyan saat melakukan pertemuandenganBupatiSergaiIrHTErryNuradi, MSi di ruang audiensi Bupati di Sei Rampah, Rabu (26/1). Dikemukakan dr Irwanto, bakti sosial yang dilaksanakan Yayasan dr’s ‘Koffie’ itu diberikan kepadawargakurangmampudiKabupatenSergai meliputi pelayanan kesehatanTHT, penyakit kulit, mata (operasi katarak) dan pemeriksaan/ pengobatan gigi. Menurutnya, bakti sosial kesehatan itu akan mengerahkan puluhan dokter maupun peralatan lengkap dari Kota Medan serta kepada semua pasien yang akan mendapatkan pelayanan tidak dipungut bayaran, karena kegiatan ini murni bersifat kemanusiaan. Bahkan khusus untuk pengobatan mata setelah selesai operasi katarak akan dilakukan pengobatan lanjutan olehYayasan dr’s ‘Koffie’, ujar dr Irwanto. Untuk menentukan pasien/warga kurang mampu yang perlu mendapatkan bantuan pelayanan sebelumnya akan dilakukan penjaringan langsung ke desa-desa di daerah ini oleh puluhan relawan dariYayasan dr’s“Koffie” bekerjasama dengan relawan dari perkumpulan INTI Sergai. Penjaringan langsung bagi warga desa kurang mampu yang layak mendapatkan pelayanan ke-

manusiaan itu dilakukan agar kegiatan bakti sosial benar-benar tepat sasaran, ujar Ketua INTI Sergai Budi, SE yang ikut men-dampingi Yayasan dr’s ‘Koffie’. Bagi warga yang terjaring untuk mendapatkan bantuan pelayanan kesehatan akan diberikan kartu khusus dan bahkan pada saat pelaksanaan bakti sosial yang dipusatkan di Vihara Hut Cou dan Rumah Sakit Sultan Sulaiman Sei Rampah, para pasien akan dijemput langsung dan diantar kembali ke rumah masing-masing, kata Budi, SE yang juga anggota DPRD Sergai. Sementara itu, Bupati Sergai Ir HT Erry Nuradi, MSididampingiKadisKesehatanSergaidrgZaniyar, Staf Ahli Bupati Drs Rachmad Karo-Karo dan Direktur RSU Sultan Sulaiman Sei Rampah dr Amri pada kesempatan itu menyampaikan apresiasi kepadaYayasan dr’s“Koffie” Medan yang telah menjadikan Kab. Sergai sebagai salah satu daerah tempat kegiatan bakti sosial kesehatan. Program yang akan dilaksanakan yayasan kemanusiaan dari dr’s‘Koffie’ Medan itu menurut bupatimerupakanresponatastemayangdiangkat pada peringatan Hari Jadi ke-7 Kabupaten Sergai tahun 2011 yaitu meningkatkan rasa kebersamaan antara masyarakat dengan unsur pemerintah dalam memberikan pelayanan kepada publik di daerah ini. Diharapkannya wujud kebersamaan itu munculjugadariberbagaikalanganlainnya,karena melalui kegiatan kemasyatan seperti yang dilaksanakan Yayasan dr’s “Koffie” maka kebutuhan masyarakat untuk mendapatkan pelayanan mendasar yang selama ini belum terpenuhi tentu secara bertahap akan dapat terpenuhi, ujar bupati.(a07)

Dek Irigasi Kotanopan Akan Diperbaiki PANYABUNGAN (Waspada): Dinas PU Pengairan Kab, Mandailing Natal akan memperbaiki dek Irigasi yang jebol akibat dilanda banjir di hulu Irigasi Bondar Bariba Tamiang, Kec Kotanopan. Hal itu di katakan Kabid Pengairan Dinas PU Madina Ahmad Subuki melalui PPTK Syahruddin Lubis, ST kepada Waspada, Jum’at (28/01) di kantornya. “Mengenaiwaktunya masihmenunggukoordinasi, mudah-mudahan secepatnya. Jebolnya irigasi karena banjir Sungai Batang Gadis 30 Desember 2010,’’paparnya. Kita pun memahami, lanjutnya, masa turun ke sawah sudah datang, namun apa boleh buat, semua pekerjaan harus sesuai dengan aturan

jadwal. Syahruddin menambahkan, jebolnya dek irigasi tersebut di luar dugaan apalagi curah hujan sangat tinggi di Madina. Masyarakat kita harap maklum. “Agar warga tetap bisa menggarap lahan, telah dilakukan penanganan sementara. Sambil menunggu diperbaiki, melalui pemborong sudah kita sampaikan agar masyarakat membuat bronjongtradisionalsementara. Mudah-mudahan usaha ini nanti bisa memasukkan air ke lahan warga,” jelasnya. Sebelumnya, Lurah Tamiang dan Camat Kotanopan telah melaporkan kondisi ini ke Dinas PU.(cpin)

Korban Asusila Oknum Camat Kabur Dari Rumah GUNUNGTUA (Waspada) :Wanita di bawah umur pegawai Tenaga Kerja Sukarela (TKS), RD yang menjadi korban asusila diduga dilakukan oknum Camat Hulu Sihapas, kabur dari rumah. Keterangan dihimpun, Rabu (26/1) dari abang korban Jungjung Daulay di Simpang Portibi Gunungtua, siang itu korban masih berada di rumahnya di Desa Aek Nauli. Mungkin, karena adapesansingkatdiHPkorbandaripelaku,korban kemudian keluar dengan alasan berbelanja ke warung. Namun, rupanya kabur untuk menemui keluarga dekat camat itu di Gunungtua. “Kita mengetahui korban kabur karena ada

yang melihatnya di Gunungtua bersama keluarga dekat sang camat, lalu kita langsung mengejarnya ke Gunungtua, rupanya mereka sudah lebih dulu pergi dengan mengendarai sepeda motor,” kata Jungjung. Jungjung sempat meminta pertolongan ke Polsek Padang Bolak, karena kejadiannya sudah berlangsung 3 jam, pihak Polsek hanya bisa membantu menghubungi HP korban. Hingga, Kamis (27/1) korban masih belum kembali ke rumahnya. Sementara, Jungjung Daulay mengatakan, pihak keluarga masih melakukan rapat keluarga. (csp)

Pemakai Sekaligus Bandar Ganja Diamankan Polisi KABANJAHE (Waspada):Satuan Narkoba Polres Tanah Karo mengamankan pemakai dan sekaligus penjual narkoba jenis ganja dari lokasi berbeda, Jumat(28/1). Tersangka itu, SW, 31, warga Jalan Jamin Ginting, Gg Sempurna, DusunVI, Desa Mufakat, Kec Kabanjahe, dan BLD, 24, warga Jalan Setia Budi, Tanjungsari, Psr 1, Gg Bahagia, Kota Medan. Penangkapan kedua tersangka bermula dari tertangkapnya SW sekira pukul 19:00 dengan barang bukti 1amplop ganja dan 4 lembar kertas yang di gunakan untuk mengkonsumsi daun haram tersebut. Polisi melakukan pengembangan dari mana di peroleh ganja yang di miliki SW, lalu tersangka SW mengatakan ganja dibeli dari temannya

bernama BLD. Petugas menyuruh SW memesan kembali kepada BLD melalui telpon. SW segera menghubungi dan meminta untuk diantarkan ke Jalan Veteran,Kabanjahe setelahsepakatdenganperjanjian sang bandar dalam waktu 1 jam. Sekira pukul 20:00 BLD tiba membawa pesanan. Petugas langsung meringkus BLD beserta barangbukti9amplopganjasiapedardan8lembar kertas putih serta langsung di gelandang ke Mapolres Tanah Karo. Kapolres Tanah Karo AKBP Ig Agung Prastyoko SH, melalui Kasat Narkoba AKP Azhar di dampingi Kaorbin Ops Narkoba Aptu Agus Karyono Harahap kepada Waspada membenarkan. (cmm)

Pemekaran Desa Percepat Pembangunan DOLOKSANGGUL (Waspada): Bupati Humbang Hasundutan (Humbahas) Drs Maddin Sihombing MSi, menyebut, pemekaran desa untuk mempercepat laju pembangunan di berbagai sektor, khususnya pelayanan pada masyarakat. “Sejumlah desa di Humbahas dibentuk dan diresmikan sesuai Perda No 4/2010. Pemekaran desa disetujui sebagai wujud aspirasi masyarakat yang disampaikan kepada pemerintah daerah dan DPRD.Tetapi yang utama aspirasi pemekaran desa disahuti agar masyarakat desa semakin sejahtera dan dapat merasakan pembangunan,” katanya. Bupati menyampaikan itu pada peresmian di Desa Sibongkare, Kec Tarabintang, Kamis (27/ 1). Acara tersebut dirangkai dengan pelantikan penjabat Kepala Desa yang disaksikanWakil Ketua DPRD Pantas Purba,Wakil Bupati Drs Marganti Manullang, Sekdakab Martuaman S Silalahi, SH serta sejumlah pimpinan SKPD dan warga. Desa itu, Mungkur Kec Tarabintang dengan Penjabat Kepala Desa Suban Mungkur, Desa Sibongkare Sianju dengan Penjabat Kepala Desa Marisi Situmorang dan Desa Marpadan dengan Penjabat Kepala Desa Wansitor Sihotang.

Bupati mengharapkan agar Penjabat Kepala Desa yang baru dilantik melaksanakan tugastugas pemerintahan dan pelayanan kepada masyarakat serta Penjabat Kepala Desa harus memfasilitasi pembentukan Badan Perwakilan Desa (BPD), membentuk perangkat desa, dan mempersiapkan pemilihan kepala desa yang defenitif. “Sayaberterimakasihkepadamasyarakatyang mendukung pemekaran desa dan yang bersedia menyerahkan tanahnya untuk lokasi perkantoran desa,” ujar Bupati. Sebelumnya,Selasa(25/10,BupatiDrsMaddin Sihombing MSi juga meresmikan Desa Sosortolong Sihite III, Kec Doloksanggul sekaligus melantik Penjabat Kepala Desa Maruba Sihite. Bupati juga meletakkan batu pertama pembangunan Kantor Desa Sosortolong Sihite III. Direncanakan juga Bupati akan meresmikan desa baru hasil pemekaran dan sekaligus melantik Penjabat Kepala Desa di Kec Parlilitan yaitu Desa Sionom Hudon Runggu, Desa Baringin Natam, Desa janji Hutanapa. Kemudian di Kec Pakkat yaitu Desa Hauagong, Desa Panggugunan, dan Desa Siambaton Pahae. (a13)

Ninja Sawit Resahkan Petani INDRAPURA (Waspada) : Aksi pencurian sawit akhir – akhir ini semakin meningkat di Desa Sei Simujur, Kec. Sei Suka, Kab. Batu Bara. Akibatnya petani dirugikan jutaan rupiah tiap panennya. Menurut keterangan sejumlah petani, Jumat (28/1), pencuri sawit yang biasa disebut ninja sawit ini sepertinya tidak mengenal rasa takut. Sudah berbagai upaya dilakukan petani untuk mencegah pencurian ini, namun sepertinya tidak ada hasilnya. Salah satunya dengan membuat surat perjanjian antara petani dengan agen sawit yang

biasa membeli Tandan Buah Segar (TBS) petani untuk tidak membeli TBS hasil curian. Tiga puluh enam petani yang menandatangani perjanjian dengan agen sawit yang diketahui oleh Kepala Desa Simujur Muhammad Chalif dan Ketua LPM Kasmoinijugaternyatamasihkalahtehnikdengan pencuri sawit, pencurian masih terus berlanjut. Petanimengharapkanpetugaskepolisianmau turun tangan mengatasi tindak kejahatan yang menimbulkankeresahanmeluasdikalanganpetani sawit di Desa Sei Simujur khususnya Dusun Enam, Tujuh dan Delapan. (a31)

Aceh

WASPADA Sabtu 29 Januari 2011

B5

Data Kelulusan CPNS Formasi Honor Agara Bakal Menuai Masalah KUTACANE (Waspada): Informasi tentang kelulusan tenaga honorer angkatan 2005 yang telah didata di Aceh Tenggara (Agara) lebih dari 1.000 orang, telah mengundang reaksi, meski belum di umumkan oleh pihak Badan Kepegawaian Daerah (BKD) Agara. Direktur Pakat Mejile Center (PMC) Agara, Ramisin,SE, Jumat (28/1), mengatakan, banyak informasi yang masuk, data kelulusan CPNS justru kelulusan didominasi oleh orang yang tidak pernah menjadi honorer. Perkembangan isu CPNS formasi 2005 yang bakal diumumkan hasilnya pada Januari 2011, ada indikasi permainan. Ada yang tau mereka telah lulus dan yang tidak lulus meski pihak BKD Agara belum resmi mengumumkan hasil honerer yang lulus CPNS. Ramisin, menyebutkan, dia telah konfirmasi kepihak BKD, namun pihak BKD mengaku belum menerima data nama-nama yang lulus pendataan CPNS jalur honorer tersebut. Disisi lain, ada pihak lain warga Agara, menye-

butkan mereka telah mendapat informasi langsung dari orang BKD, dari 1000 lebih yang didata oleh pihak BKN, sekitar 450 telah positif lulus termasuk ada nama keluarga pejabat teras Agara disebut lulus. Bila Informasi indikasi permaian kelulusan ini sesuai dengan data yang dalam waktu dekat ini diumumkan sinkron, kata Ramisin, pihaknya telah menyiapkan tim kerja yang bakal membawa persoalan ini nantinya ke jalur hukum. “Melaporkan kepada Kapolda, Kajati serta ke KPK,” tegas Ramisin. Ketua LSM Generasi anti korupsi alas generasi (GAKAG), Arafik Beruh, senada dengan PMC, mengatakan, indikasi permainan dan korupsi mungkin sekali bisa dibongkar, bila melihat gelagat keresahan warga soal adanya permainan dalam penetapan nama-nama honorer yang lulus. “Informasi adanya indikasi main uang, isunya sudah masuk ke kami,” ujar Arafik. (b28)

Warga Korban Perampasan Tanah Mengadu Ke Wagub LANGSA (Waspada): Puluhan masyarakat mewakili 5 kecamatan di Aceh Timur yang merupakan korban perampasan tanah oleh PT Bumi Flora, Rabu (26/1) melakukan pertemuan dengan Wakil Gubernur Aceh H Muhammad Nazar, SAg di aula Bappeda Aceh Timur di Kota Langsa.Warga mengadu keWakil Gubernur soal sengketa tanah dengan PT Bumi Flora yang kasusnya sudah terkatung-katung selama 4 tahun. Salah seorang masyarakat korban perampasan tanah di hadapanWagub mengungkapkan konflik sengketa tanah antara masyarakat di lima5 kecamatan dalam wilayah Aceh Timur dengan PT Bumi Flora hingga kini belum ada penyelesaian yang jelas. Warga berharap agar pemerintah bisa menyelesaikan kasus itu sesegera mungkin, sehingga warga bisa dengan leluasa menggarap lahan masing-masing. “Kami ingin kejelasan, kalau tanah ini milik kami maka kembalikan kepada kami untuk menggarapnya. Dan kalau tanah ini dianggap milik PT Bumi Flora, maka pemerintah harus tegas untuk memutuskannya. Karena sudah 4 tahun lebih kasus ini belum ada penyelesaiannya,” kata warga. Wakil Gubernur Aceh Muhammad Nazar didampingi Wakil Bupati Aceh Timur Nasruddin Abubakar, pada kesempatan itu, berjanji akan berupaya semaksimal mungkin untuk membantu penyelesaian sengketa tanah warga dengan PT Bumi Flora. DikatakanWagub, sebelumnya pihak BPN telah diarahkan untuk melakukan penguku-

ran sesuai aturan terhadap tanah yang menjadi sengketa. Dalam upaya pengukuran tersebut ditekankan agar tidak ada intervensi dari pihak manapun. “Lahan di luar HGU jangan di klaim lagi sebagai milik PT Bumi Flora tetapi harus jadi milik masyarakat. Bahkan lahan yang di dalam HGU pun, PT Bumi Flora secara aturan dapat melibatkan masyarakat dalam pengelolaannya,” kata Muhammad Nazar. Dalam proses pengukuran lahan ini, Wagub meminta warga dan wartawan juga ikut melakukan pengawasan yang konstruktif tanpa adanya provokasi dan tendensi tertentu. Formula yang disampaikan Wagub itu, disetujui masyarakat korban perampasan tanah dan unsur Pemerintah Aceh Timur yang hadir dalam pertemuan tersebut. Apalagi, sebenarnya sudah sejak dua tahun lalu usulan itu telah disampaikan Wakil Gubernur Muhammad Nazar ketika masyarakat korban perampasan tanah mendatangi kantorWagub untuk mengadukan nasib mereka. Namun dalam proses pelaksanaannya berjalan secara stagnan. Karenanya, Wagub Muhammad Nazar meminta kali ini proses penyelesaian sengketa lahan tersebut jangan sampai macet lagi. Sementara pihak BPN Aceh Timur dalam pertemuan tersebut mengaku telah menurunkan tim ke lapangan guna melakukan pengukuran dan pemancangan tapal batas, karena masih ada beberapa titik lagi yang belum diukur.(ts)

Gubernur Kembali Didesak Teken Pergantian Ketua DPRK Langsa LANGSA (Waspada) : Gubernur Aceh IrwandiYusuf kembali mendapat desakan dari sejumlah elemen sipil menyangkut kejelasan pergantian Ketua DPRK Langsa, Muhammad Zulfri, ST yang kini mendekam di Lembaga Pemasyarakatan (LP) Langsa. Desakan Itu kembali dilontarkan elemen sipil Langsa setelah beberapa kali sebelumnya dilakukan ikhwal serupa yang menginginkan kejelasan tentang pergantian Ketua DPRK Langsa yang selama ini terjadi kekosongan karena Ketua DPRK Langsa tersandung kasus hukum memberikan keterangan palsu pada saat persidangan kasus uji baca Al Quran saat yang bersangkutan menjadi anggota KPU Kota Langsa. “Kekosongan Ketua DPRK Langsa merupakan preseden buruk bagi DPRK Langsa secara kelembagaan dan masyarakat Kota Langsa secara menyeluruh. untuk itu kita mendesak Gubernur Aceh untuk segera memperjelas tentang pergantian Ketua DPRK Langsa dimaksud,” sebut Direktur Eksekutif Komunitas Rumoh Aceh Putra Zulfirman kepada wartawan di Langsa. Putra mengatakan, menurut pantauannya pihak DPRK Langsa telah menyurati Gubernur Aceh sesuai hasil Rapat Paripurna DPRK Langsa beberapa waktu lalu. namun, sejauh ini Gubernur Aceh belum juga memberikan kejelasan mengenai permasalahan ini. “Gubernur harus segera menyikapi hal ini agar tidak terjadi polimik dan konflik di daerah, apa bila Gubernur tidak merespon secara cepat dikhawatirkan akan timbul gejolak dari masyarakat, apalagi tenggang waktu dari pengiriman surat DPRK dimaksud telah berakhir pada 20 Januari lalu.” Untuk itu LSM Komunitas Rumoh Aceh mendesak, Gubernur Aceh segera menjawab dan menjelaskan status hukum M. Zulfri, ST

dan pergantian Ketua DPRK Langsa. Mendesak pimpinan Partai Aceh untuk segera memroses permasalahan pergantian Ketua DPRK Langsa agar citra Partai Aceh tidak tercoreng hanya karena mempertahankan kader partai yang terjerat kasus hukum. Mendesak Walikota Langsa dan anggota DPRK Langsa untuk dapat menelusuri dan mengawal kejelasan pergantian Ketua DPRK Langsa dimaksud. Mengimbau kepada semua komponen masyarakat Langsa untuk bersama menyikapi permasalahan ini sehingga masyarakat tidak dirugikan. Apabila desakan ini tidak mendapat respon dari Gubernur Aceh maka kami akan melakukan aksi unjuk aspirasi dan menduduki kantor Gubernur Aceh. Desakan itu juga disuarakan kader Partai Aceh dari DPG PA Gampong Blang Paseh, Khairizal S. Menurutnya, DPW PA Kota Langsa untuk dapat melakukan langkah persuasif dalam menyelesaikan polimek pergantian M. Zulfri, ST dari tampuk kepemimpinan DPRK Langsa agar citra Partai semakin bersinar dihati masyarakat terlebih dalam menghadapi pemilukada kedepan. Ia juga menjelaskan dalam waktu dekat ini seluruh kader PA se Kota Langsa akan memberkan rekomendasi mengenai kejelasan pergantian M. Zulfri yang kini menjadi Ketua DPRK Langsa terpidana. Selain itu, perlu adanya pemilahan kasus Zulfri bukan kasus partai sehingga partai harus memilah ini. Hal senada juga disampaikan Ketua DPG PA Gampong Teungoh, Mustafa, SPd. “Pengurus dan petinggi PA pusat dan DPW PA Kota Langsa untuk lebih arif dan bijak dalam menyelesaikan polemik Zulfri ini agar pencitraan PA yang telah terbangun ditenggah masyarakat tidak menjadi bias dan tercoreng terlebih pemilukada sudah diambang mata,” pungkasnya. (b23)

Waspada/Muhammad Riza

JEMBATAN RUSAK: Akibat buruknya kondisi jembatan Peukan Sot, yang menghubungkan Kecamatan Simpang Tiga dengan Kota Sigli, Kabupaten Pidie menyebabkan warga sulit melintasi jembatan ini, foto dia badikan, Jumat (28/01).

Penyimpangan Keuangan Di Aceh Timur Ditindaklanjuti LANGSA (Waspada): Wakil Gubernur Aceh H Muhammad Nazar SAg mengatakan akan menindaklanjuti setiap laporan penyimpangan keuangan negara di Aceh Timur, jika laporan tersebut masuk ke meja nya. Hal ini dikatakan Wagub usai melakukan rapat pengawasan pembangunan dengan beberapa pimpinan Satuan Perangkat Kerja Daerah (SKPD) Pemkab Aceh Timur, Rabu (26/1).

Dikatakan Muhammad Nazar, rapat pengawasan pembangunan yang dilakukannya dengan beberapa SKPD Pemkab Aceh Timur tersebut merupakan bagian dari tugas pokoknya sebagai seorang Wakil Gubernur Aceh. “ Kita hanya melakukan fungsi pengawasan terhadap setiap program pembangunan yang menggunakan uang negara,” katanya. Menyangkut banyaknya du-

gaan penyimpangan keuangan dalam pembangunan di Aceh Timur sebagaimana muncul di media dalam beberapa pekan terakhir, Muhammad Nazar mengatakan pihaknya akan menindaklanjuti setiap dugaan penyimpangan tersebut jika laporannya masuk ke meja kerja Wakil Gubernur. “Kita tau ada dugaan penyimpangan sebagaimana diberitakan media seperti dugaan

Diduga Kerap Selundupkan Barang Pemilik KM Sultan Aceh Diburu IDI, Aceh Timur (Waspada): Setelah ratusan ban mobil dan masin mobil eks Malaysia yang gagal diselundupkan ke Aceh Timur, melalui perairan Selat Malaka, diserahkan ke Polres AcehTimur,Kamis(27/1),Sa-tuan Reskrim Polres setempat kini sedang memburu pemilik KM Sultan Aceh GT 28 No. PPF, itu. Hasil lidikan sementara, kepolisian memperkirakan KM Sultan Aceh, kerap melakukan penyelundupan barang-barang bekas asal Luar Negeri (LN) ke Aceh, baik melalui jalur perairan pantai Timur maupun pantai utara Aceh. “Kita sedang memburu pemilik kapal,” ujar Kapolres Aceh Timur, AKBP Drs Ridwan Usman. Melalui Kasat Reskrim, AKP Priyo Utomo, S.Ik, menjawab Waspada, Jumat (28/1) di Peudawa, dia mengatakan kasus ditemukannya satu unit kapal yang menyelundupkan barang eks LN oleh personel Pos Pol Air Polda Aceh di Kuala Idi, kini dise-

rahkan ke Satreskrim Mapolres setempat, guna proses selanjutnya. AKP Priyo Utomo menegaskan, pihaknya akan terus menyelidiki status kepemilikan KM Sultan Aceh, yang hingga kini masih terkesan ‘gelap’. “Kita tidak akan hentikan kasus penyelidikan ini. Apalagi menurut informasi awal, KM Sultan Aceh, kerap keluar masuk ke Aceh, me nyelundupkan barang eks LN,” ujarnya. Ketika disinggung apakah polisi menemukan dokumen kapal? Priyo menjawab sama sekali tidak ada dokumen di kapal, sehingga polisi bekerja ekstra, guna mengungkap kasus dibalik aksi penyelundupan tersebut. “Kita duga pemilik kapal membawa lari seluruh dokumen saat diketahui kapalnya kandas berat,” sebutnya. Sementara itu, Kasat Pol Air Polres Aceh Timur, Aiptu Zainir secara terpisah mengungkap-

kan, KM Sultan Aceh diduga gagal menyelundupkan barang bekas asal LN akibat baling-baling dibawah labung kapal rusak dililit tali. Pasalnya, kepolisian melihat alat tersebut rusak saat air surut. “Baling-baling kapal rusak akibat tebalnya lilitan tali dibagian lambung kapal. Kita menduga, saat itu ABK kapal gagal memutuskan lilitan tersebut, sehingga langsung kabur meninggalkan kapal dengan muatan ratusan ban eks LN itu,” jelas Aiptu Zainir. Sebagaimana diwartaka sebelumnya, KM Sultan Aceh GT 28 dtemukan personel kepolisian dari Pos Pol Air Polda Aceh yang bermarkas di Kuala Idi, Senin (24/1) sekira pukul 04:00. Meski ratusan ban bekas itu telah dibongkar dan diamankan ke Polres setempat, namun kapal masih kandas berat di titik penemuan awal di Kuala Peudawa Puntong, Kecamatan Idi Rayeuk. (cmad)

PTPN I Dukung Penegerian Unsam Setelah Dapat Imbalan Rp5 M Lebih

Waspada/Bustanuddin

JEMBATAN PUTUS: Jembatan Gantung Desa Kuning Kec. Rikit Gaib putus walau pun tidak memakan korban. Jembatan ini salah satu jalan alternatif masyarakat menuju persawahan. Masyarakat meminta dinas PU Kab. Gayo Lues untuk segera memperbaiki jalan tersebut, karena hingga kini belum ada tanda-tanda perbaikan. Foto direkam Selasa (25/1).

LANGSA (Waspada): PTP Nusantara I resmi memberi dukungan untuk penegerian Universitas Samudra Langsa setelah memperoleh imbalan senilai Rp5.832.959.629. Pernyataan dukungan dari perusahaan perkebunan itu baru disampaikan secara terbuka, Rabu (26/1), melalui siaran pers yang dibagibagikan kepada wartawan. Dalam press release yang ditandatangani H Hasan Basri, SH, MH selaku Humas dan Protokoler PTPN-I itu juga disebutkan, sebenarnya proses penegerian Unsam Langsa sudah lama dirintis Yayasan Unsam bersama Pemko Langsa tetapi selalu terbentur pada salah satu syarat mutlak yang tak dapat dipenuhi, yakni kekurangan lahan untuk perluasan kampus. Menurut catatan Waspada yang pernah ikut dalam tim penegerian Unsam Langsa sampai ke Kementerian Pendidikan di Jakarta tahun lalu, berlarutlarutnya proses penegerian universitas swasta yang didukung tiga daerah, Kabupaten Aceh Timur, Kota Langsa dan Kabu-

paten Aceh Tamiang karena PTPN I sebelumnya tidak mau melepaskan HGU-nya untuk perluasan kampus. Padahal waktu itu, pihakYayasan Unsam bersama Pemko Langsa, Aceh Timur dan Kabupaten Aceh Tamiang serta didukung sejumlah tokoh masyarakat telah berupaya dengan berbagai cara agar pihak PTPNI Langsa mau melepaskan sebagian lahannya yang bersisian dengan kampus Unsam. Soal keberatan PTPN I Langsa melepaskan lahannya pada masa lalu itu, tidak disebutkan dalam siaran pers itu kecuali yang dinyatakan, atas dukungan semua pihak proses pelepasan HGU PTPN-I seluas 50 HA, Alhamudulillah akhirnya tuntas. Hal ini terbukti, demikian ditulis dalam siaran pers, karena PTPN I sudah menerima dana sesuai nilai harga tanaman dan tanah senilai Rp5.832.959.629 – inclusive PPh 5 persen. Harga yang disebutkan itu senilai Rp5.717.757.990 telah diterima di rekening PTPN-I setelah

dipotong PPn, sementara dana senilai Rp. 115.201.639 inclusive PPn akan diselesaikan Pemko Langsa tahun 2011. Selesainya pembayaran kepada PTPN-I, dijelaskan lagi, pihak PTPN I pun telah menyerahkan sertifikat asli HGU No.124 Tahun 1999 Pondok Pabrik kebun Lama untuk dipinjampakaikan guna mempercepat proses kegiatan pembebasan tanah untuk lokasi pembangunan Unsam dan STAIN Cot Kala sesuai permintaan Walikota Langsa. Sedangkan proses selanjutnya, pihak Pemko Langsa akan melakukan pemecahan sertifikat lama ke sertifikat baru seluas 50 HA dari HGU No.124 seluas 2847 HA. Setelah itu Pemko Langsa akan mengurus lagi ke Pemprov Aceh untuk menghibahkan ke Pemko Langsa, baru selanjutnya Pemko Langsa menyerahkan kepada Yayasan Unsam agar bisa diteruskan ke Menteri Pendidikan RI sebagai syarat penegerian Unsam Langsa, demikian bunyi siaran pers dari PTPN I.(b22)

penyalahgunaan bantuan Menkokesra Rp 16 milyar, dana stimulus, maupun persoalan yang menyangkut pembangunan pusat pemerintahan Aceh Timur. Ini semua akan kita tindak-

lanjuti jika laporannya masuk. Nanti kita akan lihat, kasus mana yang layak dilanjutkan ke proses hukum,dankasusmanayanghanya perlu penertiban administrasinya saja,” katanya. (ts)

Ka-Kwarna Tutup Perkemahan Kemsi-G LANGSA (Waspada): Ketua Kwartir Nasional (Ka-Kwarna) Azrul Azwar hari ini akan menutup perkemahan prestasi tingkat Penggalang (kemsi-G) yang akan berlangsung di Swimbath Scout Camp, keumuning, Kota Langsa, Jumat (28/1). Ketua Panitia Kemsi-G, Zainal Arifin yang dihubungi kemarin mengatakan Ka-Kwarnas yang datang atas undagang khusus Kwartir cabang Langsa tersebut datang dengan membawa hadiah khusus kepada pemenang Kemsi-G, berupa seperangkat alatalat perkemahan. “Beliau antusias datang di tengah agenda kegiatan yang padat, dengan membawa langsung hadiah utama bagi para juara KemsiG berupa seperangkat alat perkemahan,” ujarnnya. Menurutnya, semua persiapan untuk acara penutupan perkemahan yang diikuti ratusan pramuka tingkat penggalang dari Kwartir Cabang Aceh Timur, Aceh Tamiang dan Kota Langsa telah rampung dilaksanakan. “Insya Allah persiapan acara penutupan perkemahan telah matang, semua panitia telah bekerja optimal, terutama persiapan lapangan upacara telah selesai, mudah-mudahan semuanya berjalan lancar,” harap Zainal. Dia menambahkan selama tiga hari penyelenggaran perkemahan Kemsi-G yang dimulai sejak 26 Januari lalu mempertandingkan aneka keterampilan keperamukaan seperti baris-berbaris dan kecakapan lainnya. “Dari penyelenggaran perkemahan tersebut kita telah mendapatkan para anggota pramuka khususnya dari Kwarcab Kota langsa yang akan kita terjunkan pada Jambore daerah mendatang,” paparnya. (b25)

Warga Kluet Diminta Tingkatkan Mutu Pendidikan TAPAKTUAN (Waspada): Bupati Aceh Selatan Husin Yusuf mengajak segenap alemen masyarakat, khususnya warga Kluet, agar terus berupaya dan berperan aktif dalam rangka meningkatkan mutu pendidikan, guna menciptakan manusia berkualitas. Hal ini penting, mengingat semua sarana dan prasarana pendidikan dibangun pemerintah di daerahnya dinilai telah memadai. Tetapi apa artinya memiliki gedung mewah dan bertingkat, tanpa dibarengi hasil yang memuaskan berupa kualitas atau mutu pendidikan. Demikian Bupati Husin Yusuf, ketika meresmikan pemakaian gedung SMA 3 Kluet Utara, di Gampong Tinggi, Kamis (27/1). Peresmian gedung bertingkat itu ditandai pembukaaan selubung papan nama, penandatangan prasasti serta pengguntingan pita oleh bupati, disaksikan unsur Muspida dan tokoh-tokoh masyarakat setempat. Sebelumnya tokoh masyarakat setempat Adiman mengungkapkan keberadaan gedung sekolah SMA 3 ini telah memenuhi harapan masyarakat, khususnya siswa-siswa di daerah pedalaman, seperti Menggamat Kecamatan Kluet Tengah. Sebelumnya mereka harus bersekolah ke Kotafajar yang berjarak belasan kilometer. “Karena itulah, peresmian gedung sekolah ini, perwujudan rasa syukur kami kepada Ilahi Rabbi,” sebutnya.(b19)

Waspada/Zamzamy Surya

BUKA SELUBUNG: Bupati HusinYusuf, membuka selubung papan nama, menadai peresmian gedung SMA 3 Kluet Utara, di Gampong Tinggi, Kamis (27/1).

Aceh

B6

WASPADA Sabtu 29 Januari 2011

Wagub Aceh:

Plat Luar Aceh Rugikan Jutaan Rupiah

Daerah Pailit Karena Pemimpin Tidak Cakap

LANGSA (Waspada): Kebijakan manajemen Koperasi Mon Madu PT Perkebunan Nusantara (PTPN-I) Aceh yang engan menggunakan plat kendaraan Aceh untuk kendaraan operasional para direksi dan manager diperkirakan berpotensi merugikan pemerintah Aceh jutaan rupiah setiap tahun dari penerimaan pajak kendaraan bermotor. “Ya.. sekitar jutaan rupiah lah setiap tahunnya dari pajak kendaraan, karena banyak kendaraan di PTPN-I yang mewahmewah,” ujar Husnaidy, Kepala UPTD Samsat Wilayah VI Aceh, Kamis (27/1), soal potensi pendapatan yang hilang akibat penggunaan plat kendaraan luar daerah yang dilakukan Koperasi PTPN-I. Padahal seperti dikatakan Husnaidy, bila pihak koperasi PTPN-I mau, pihak penyedia kendaraan (leasing) bisa menggunakan plat kendaraan Aceh, tidak harus menggunakan plat kendaraan luar daerah. “Sebenarnya kalau mereka mau tinggal bilang, pasti pihak ke tiga yang memegang kotrak penyediaan kendaraan akan menggunakan plat Aceh untuk semua kendaraan operasional di perusahaan tersebut,” katanya. Sejumlah kalangan mendesak pemerintah Aceh untuk memanggil pihak manajemen PTPN-I Aceh terkait kebijakan penggunaan plat kendaraan luar daerah. “Sudah saatnya Gubernur Aceh mengambil sikap, bila perusahaan BUMN saja tidak punya niat membantu daerah apalagi yang mau diharapkan dari perusahaan swasta yang lain,” ujar Husaini, tokoh pemuda Kota Langsa. (b25)

Bendaharawan Kantor Camat Dilaporkan Ke Polisi KUALASIMPANG ( Waspada): Diduga menilep honorarium perangkat Desa (Baca: Kampung) se Kec. Bandar Pusaka, Kab. Aceh Tamiang yang berjumlah puluhan juta rupiah , oknum Bendaharawan Kantor Camat Bandar Pusaka berinitial Mhd alias Buyung dilaporkan ke Polsek Tamiang Hulu. “Saya sudah melapor ke Polsek karena honorium perangkat desa atau kampung tahun 2010 tidak dibayar dan uang honorarium kami Rp98 juta telah dimakannya,” ungkap Datuk Penghulu Kampung (Desa) Pengidam,Kec. Bandar Pusaka, Idris bin Ismail sambil menunjukkan Surat Tanda Penerimaan Laporan/Pengaduan No: STPL/2/I/2011/Plsk.Tamiang Hulu. Idris mengungkapkan, honorarium yang ditilep Bendaharawan sebesar Rp98 juta itu merupakan honor 15 Datok Penghulu , Khatib Mesjid, Tenaga Pembersih Mesjid, Bilal Mayat dan perangkat desa lainnya. “Uang tersebut memang sudah ditarik oleh Bendaharawan di tingkat kabupaten, tetapi uang yang ditariknya tidak diserahkan untuk kami,” kata Idris . Idris menegaskan agar kasus penilepan uang honorarium perangkat desa ini dapat diusut tuntas oleh aparat hukum dan pelakuknya segera ditangkap serta dijebloskan dalam penjara untuk mempertanggung jawabkan perbuatannya. Bendaharawan Kantor Camat Bandar Pusaka, Muhammad alias Buyung ketika dikonfirmasi selularnya tidak aktif. Namun Camat Bandar Pusaka, A.Yuhardha membenarkan, Bendaharawan Muhammad telah dilaporkan ke Polisi oleh Idris, Datok Penghulu Kampung Pengidam.(b24)

Kembangkan Ayam Petelur REDELONG (Waspada): M. Yusuf Gayo, SH. SAg anggota DPRK Bener Meriah mengembangkan ayam petelur. Meski hasil produksi belum mampu untuk memenuhi kebutuhan telur di daerah penghasil kopi itu, namun per hari ternaknya menghasilkan sekitar 3.134 butir telur. Selama ini, kepada Waspada, Jumat (28/1) dikatakannya, untuk kebutuhan telur di Kab. Bener Meriah dan Aceh Tengah, sebagian besar dipasok dari Medan, Sumatera Utara (Sumut). Ditambahkan, ia tertarik mengembangkan ayam petelur di Bener Meriah lantaran melihat dari sisi bisnis dan peluang ke depan yang cukup menjanjikan. Apalagi untuk saat ini, katanya, pengembangan ayam petelur di daerah itu masih kurang diminati sementara kebutuhan telur masih dipasok dari luar daerah. “Modal awalnya memang cukup besar tetapi kalau melihat peluangnya cukup menjajikan,” katanya.(cb04)

Cuaca Buruk, Kapal Cepat Expres Bahari Berlayar Satu Trip SABANG (Waspada): Tiga hari terakhir cuaca buruk di perairan selat Benggala yang biasa dilalui kapal penyeberangan KMP BRR dan kapal cepat Expres Bahari dari dan ke Balohan Sabang – Ulee Lhee Banda Aceh. Pada Kamis dan Jumat (27-28/1), kapal cepat expres Bahari yang biasa berlayar dua trip (PP) terpaksa hanya satu trip (PP) karena gelombang laut tinggi 4 meter. Angin kencang dan hujan lebat di Sabang mengakibatkan banyak pohon kayu yang tumbang dan dilaporkan tidak ada korban jiwa dan kerugian harta benda warga masyarakat. Kepala Kantor Meterologi dan Geofisika Sabang, Syamsul Bahri ketika dihubungi via ponselnya sedang tidak aktif. Kepala UPTD Balohan, Irawadi mengatakan kapal cepat expres Bahari dan kapal ferry KMP BRR dalam cuaca buruk seperti sekarang tetap menempuh pelayaran satu trip. Jika hari Sabtu dan seterusnya cuaca sudah normal akan berlayar seperti biasa.(b29)

Rangkap Jabatan Ketua MPU Dipertanyakan SINGKIL (Waspada) : Anggota DPR Kab. Aceh Singkil Frida Siska Sihombing, S.TP mempertanyakan rangkap jabatan Ketua Majelis Permusyaratan Ulama (MPU) Kab. Aceh Singkil yang dijabat H. Ust. Rasyidudin, SH. Pertanyaan itu dilontarkan pada sidang paripurna DPRK tentang pengesahan APBK Tahun 2011 dan penetapan rancangan Qanun menjadi qanun Aceh Singkil, Kamis ( 27/ 1) di gedung DPRK Singkil Utara. Sesuai Qanun No. 6 Tahun 2010 pasal 21huruf j, disebutkan Anggota Majelis Permusyawaratan Ulama (MPU) yang berstatus PNS tidak boleh rangkap jabatan dan tidak dibenarkan menerima tunjangan ganda. Hal itu juga dipertegas pada penjelasan pasal 21 bab VIII tentang persyaratan, bahwa PNS yang menduduki jabatan struktural tidak dapat menduduki jabatan rangkap , baik dengan jabatan struktural maupun dengan jabatan fungsional. Untuk optimalisasi kinerja disiplin dan akuntabilitas pejabat struktural serta menyadari akan keterbatasan kemampuan manusia, sudah selayaknya dilarang adanya rangkap jabatan, begitu juga dengan penerimaan tunjangan tidak boleh ganda.(cb02)

PA Belum Siap Umumkan Nama Balon Walikota Banda Aceh BANDA ACEH (Waspada): Ketua Dewan Pimpinan Wilayah (DPW) Partai Aceh kota Banda Aceh, Hidayatullah Jumat (28/1) saat coffee morning dengan wartawan mengatakan, Partai Aceh belum menentukan siapa yang menjadi bakal calon Walikota dan Wakil Walikota Banda Aceh yang akan berkompetisi dalam Pilkada 2011. “Kami belum bisa mengumumkan nama calon yang bakal naik menjadi walikota dan wakil walikota karena bakal calon tersebut masih kita seleksi,” kata Hidayatullah. Ketua DPW PA tersebut menambahkan, saat ini DPW partai Aceh masih dalam tahap penyeleksian internal partai, walaupun belum menetapkan nama pasangan, namun DPW partai Aceh mengakui telah menerima beberapa nama sebagai masukan untuk menjadi calon. (gto)

Waspada/Muhammad Riza

KORBAN ABRASI: Wakil Gubernur Aceh Muhammad Nazar, Jumat (28/1) berkesempatan melihat langsung sejumlah rumah warga Geunteng, Kec. Bate, Kab. Pidie yang ambruk akibat abrasi pantai beberapa waktu lalu.

Abrasi Pantai Kian Parah SIGLI (Waspada): Abrasi pantai sepanjang pesisir Kab. Pidie dan Pidie Jaya kian parah. Warga diharapkan siap direlokasi, apabila laut terus mengikis tepian hingga merusak perumahan dan lahan perkebunan penduduk.

“Masyarakat harus mendukung aturan pemerintah dan siap direlokasi ke tempat lain apabila abrasi pantai terus mengancam warga,” kataWakil Gubernur Aceh Muhammad Nazar saat kunjungan kerja di Desa Geunteng Barat dan Timur, Kec. Bate, Kab. Pidie, Jumat (28/1). Wagub Aceh datang ke dua desa tersebut untuk melihat secara langsung abrasi pantai yang

telah menghancurkan puluhan rumah penduduk di Desa Geunteng Barat dan Geunteng Timur, beberapa waktu lalu. Dalam kesempatan temu ramah dengan masyarakat Geunteng Barat dan Geunteng Timur tersebut, Muhammad Nazar berjanji akan segera melakukan pembangunan infratruktur di desa tersebut, dalam upaya mengantisipasi terjadinya ab-

rasi pantai di dua desa itu. Pemrov Aceh katanya telah mengajukan dana pada tahun anggaran 2011 kepadaDewanPerwakilanRakyat Aceh (DPRA) untuk dibahas. ” Mudah-mudahan kita semua sama persepsi dan memprioritaskan pembangunan insfratuktur di sepanjang pesisir pantai di Kabupaten Pidie dan Pidie Jaya. Agar peristiwa abrasi dapat diminalisir,” katanya.(b20)

Ganti Rugi PLTA Peusangan TAKENGEN (Waspada): Drs. Khairul Asmara, MM menerapkan aturan main yang jelas dalam proses ganti rugi dan ganti peunayah, seputar harta masyarakat yang terkena proyek PLTA Peusangan. “Ganti rugi aturannya sudah jelas, namun persoalan ganti peunayah seperti keramba yang didirikan masyarakat di tanah negara, ini yang harus ada komitmen. Jangan karena ganti rugi ini ada yang masuk penjara,” sebut Sekda Aceh Tengah, Jumat (28/1) pagi di Takengen. Keramba di seputar DAS Peusangan jumlahnya membengkak, sebelumnya ketika didata hanya 303 unit, naik menjadi 360. Angka ini juga akan mengalami peningkatan bila didata ulang. Pemilik keramba rata-rata mengharapkan ganti rugi terkena proyek PLTA Peusangan.

“Kalau tanah milik masyarakat yang terkena ganti rugi aturannya sudah jelas. Bagaimana dengan keramba yang didirikan masyarakat di atas tanah negara? Tidak mungkin gantirugidilakukandilahantanah milik negara,” sebut Erol panggilan akrab Sekda Aceh Tengah. “Benar jumlah keramba bertambah. Nilai yang diusulkan untuk ganti rugi keramba ini juga cukup besar mencapai Rp7 miliar lebih. Ini sudah tidak logis, dan bukan lagi peunayah,” sebut Erol. Untuk mengantisifasi agar dalam proses pembebasan keramba ini tidak “terinjak” ranjau hingga ke penjara, Sekda sudah memberikan pengertian kepada pemilik keramba. Peunayah itu dihitung permeter dengan harga yang logis. Untuk keramba yang bagus, nilainya mencapai Rp225 ribu

per meter, kelas 2 Rp175 ribu dan yang di bawahnya Rp125 ribu per meter. Ukuran ganti rugi juga bukan dihitung luasnya dengan menerapkan pola panjang kali lebar. “Untuk keramba perhitungan peunayahnya, panjang tambah luas keramba. Misalnya panjang 10 meter, luasnya 5 meter. Yang akan diberikan peunayah 15 meter dikalikan klasifikasi keramba,” sebut Erol. “Harga bangunan di atas keramba akan diputuskan dengan musyawarah. Kan tidak logis bila rumah di atas keramba ada yang mengusulkan harga mencapai Rp47 juta. Sementara rumahnya terbuat dari papan,” kata Sekda. Ganti rugi rumah memiliki standar. Untuk ukuran luks, Rp3,5 juta per meter. Kalau papan hanya Rp1,5 juta per meter. “Rumah bantuan yang diba-

ngun pemerintah saja, nilainya hanya Rp 35 juta, itu juga sudah permanen. Kan tidak logis rumah papan, harganya peunayahnya lebih mahal,” sebut Erol. “Untuk itu mohon pengertian pemilik keramba. Kepada tim pembebasan juga bekerja serius, jangan melihat celah untuk bermain,” pinta Sekda. Menurut Erol, selain persoalan keramba di atas tanah negara, di kawasan Asir-Asir, seputar DAS Peusangan, juga akan dibebaskan tanah milik masyarakat mencapai 1.600 meter. Kalau tanah ini nilai ganti ruginya jelas, ada aturannya. Sebelumnya persawahan/ kebun masyarakat seluas 2 hektar di Calo Sadong yang akan dijadikan gardu induk sudah dibebaskan. “ Kita menunggu kepastian dari pihak PLTA, kapan keramba dan bangunan di atasnya akandibebaskan,”sebutnya.(b18)

Bandar Plus 1,5 Kg Ganja Gol PEUREULAK, Aceh Timur (Waspada): Setelah dilidik dan diincar, petugas keamanan berhasil meringkus seorang pemuda yang diduga bandar ganja antar provinsi di Desa Mata Ie, Kecamatan Ranto Peureulak, Jumat (28/1) sekira pukul 13:00. Dari tangan tersangka, polisi berhasil menemukan 1,5 kilogram barang bukti (BB) berupa ganja kering siap edar.Tersangka berinisial, EYI, 23, warga asal Desa Seumanah Jaya, Kecamatan Ranto Peureulak. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kapolsek Ranto Peureulak, Ipda Ildani kepada Waspada, Jumat

(28/1) mengungkapkan, penangkapan tersangka berawal dari informasi masyarakat, bahwa di lokasi yang terpaut beberapa kilometer dari Markas Kepolisian Sektor Ranto Peureulak. Di sana, diketahui ada seorang pemuda asing masuk dengan gerakan yang mencurigakan. Mendapat laporan masyarakat, lanjut Ildani, sejumlah personel keamanan bergerak melakukan pengintaian ke lokasi dengan mengguna sepedamotor menelusuri jalan tikus. “Dalam kondisi hujan gerimis anggota menelusuri jejak tersangka,” kata Ildani.

Dia menyebutkan, setelah dua jam mengendap disemaksemak kiri dan kanan badan jalan, akhirnya tersangka serentak dihadang sejumlah aparat kepolisian. Saat digeledah, polisi berhasil menemukan sebuah karung berukuran sedang berisi daun ganja kering yang diduga akan diedar ke agen-agen di kawasan Peureulak dan sekitarnya. Ildani menambahkan, awalnya tersangka mencoba melawan, namun niat tersangka EYI untuk meloloskan diri dari perangkap polisi gagal. “Awalnya ingin mengelabui polisi, tapi berkat kesiagaan kita akhirnya

tersangka yang sudah lama kita incar berhasil ditangkap dan kini sudah diamankan untuk proses hukum selanjutnya di Polsek Ranto Peureulak,” kata Kapolsek Ildani. Dia juga mengatakan, tersangka EYI adalah sudah lama menjadi Target Operasi (TO) Polsek Ranto Peureulak. Bahkan, diduga keras tersangka memilik jaringan hingga ke luar Aceh. “Keterangan sebelumnya tersangka sudah lama bermain, bahkan dia adalah agen tunggal yang kegiatannya mengantar ganja dalam skala besar,” tandas Kapolsek Ildani. (cmad)

Walikota, DPRK Tandatangani APBK Subulussalam 2011 SUBULUSSALAM (Waspada): Setelah melalui tahapan sidang pembahasan RKA SKPK, Selasa (25/1) hingga, Kamis (27/ 1), Walikota Subulussalam Merah Sakti, Ketua DPRK Pianti Mala dan wakilnya Karlinus disaksikan langsung Sekda Damhuri dan Setwan Sulisman tandatangani berita acara Persetujuan Bersama Kepala Daerah dan DPRK tentang RAPBK Subulussalam 2011 menjadi APBK. Penandatanganan berlangsung, Jumat (28/1) di Gedung DPRK Subulussalam pada agenda Penutupan Sidang Paripurna Pembahasan RAPBK Subulussalam 2011. Menyusul penandatangaan itu, TAPK diminta meneruskan hasilnya kepada Gubernur Aceh untuk dievaluasi sehingga APBK dapat segera dimanfaatkan untuk pembangunan daerah. “TAPK sudah dapat meneruskan kegiatan penyampaian hasil persidangan ini untuk dievaluasi oleh Gubernur Aceh agar APBK yang telah disahkan ini dapat segera dimanfaatkan

untuk pembangunan daerah,” tegas Pianti Mala saat menutup sidang yang diakhiri doa oleh Naufal, unsur MPU Subulussalam. Saat membuka sidang, Pianti menilai kalau penyusunan RAPBK di sana mengalami perubahan ke arah penyempurnaan. Namun pelaksanaan kolaborasi antara eksekutif dengan legeslatif sering dihadapkan pada hal-hal yang menimbulkan miskomunikasi oleh sebahagian SKPK sehingga menghambat tujuan bersama. Karenanya, Pianti mengingatkan agar jika terjadi perubahan tidak dilakukan sepihak, tetapi harus dikomunikasikan dengan DPRK. “Kami bukan menghambat program yang telah direncanakan di luar dari kesepakatan yang telah diambil, namun tolong dikomunikasikan terlebih dahulu agar tidak terjadi kesalahfahaman antara eksekutif dan legislatif,” pungkas Pianti. Sementara Walikota Sakti dalam pidato penutupan sidang paripurna itu minta segenap

Kepala Dinas/Kantor/Badan untuk tidak berdiam diri, apalagi hanya berpijak kepada mata anggaran yang ada. Mereka juga diminta menindaklanjuti peluang-peluang anggaran, baik dari provinsi maupun pusat karena APBK Subulussalam tidak sepenuhnya mampu mengakomodir semua kebutuhan daerah ini. Ditegaskan, para Kepala Dinas/Kantor/Badan harus proaktif dalam menjalankan tugas pokok dan fungsinya masing-masing karena tekad memberikan yang terbaik untuk masyarakat dan Kota Subulussalam tidak bisa ditawartawar. Sakti pun mengatakan kalau keberadaan Rumah Sakit Ibu dan Anak (RSIA) Kota Subulussalam diupayakan menjadi Unit Pelaksana Teknis Pusat (UPTP), bukan UPTD sehingga operasional dan semua kebutuhan rumah sakit itu disubsidi langsung pusat. Demikian pula Balai Latihan Kerja (BLK) yang untuk pengadaan peralatan dibutuhkan biaya sebesar Rp20

milyar harus dapat ditingkatkan statusnya menjadi UPTP. Pertanyakan Menyusul pendandatangan itu, dua aset vital Pemko Subulussalam, yakni Pabrik Tapioka dan Perusahaan Daerah Air Minum (PDAM) Tirta Subulussalam yang tidak menjadi agenda pembahasan pada Rapat Paripurna ke-1 masa sidang I 2011 DPRK dengan agenda Pembahasan RAPBK Subulussalam 2011, Senin (24/1) di Gedung DPRK setempat, LSM Berkah Subulussalam mempertanyakan peran kedua lembaga itu. Pasalnya, Syahril Tinambunan, Ketua LSM itu kepada Waspada, Jumat (28/1) mengatakan kalau berdasarkan pantauan pihaknya ke lokasi pabrik Tapioka, Senin silam sangat menyedihkan. Dikatakan, pabrik tidak dapat beroperasi bahkan tidak dirawat, dan bukan tidak mungkin akan menjadi besi tua. “Dimana peran eksekutif dan legislatif dalam hal ini,” tanya Syahril, menambahkan kalau aset itu mestinya digunakan, bukan justru ditelantarkan. (b33)

LANGSA (Waspada): Banyaknya kecenderungan sejumlah daerah tingkat dua di Aceh yang mengalami defisit anggaran serta buruknya menajemen pemerintahan mendapat perhatian serius Wakil Gubernur Aceh Muhammad Nazar. Dalam kunjungan silaturahminya ke Sekolah Tinggi Agama Islam negeri (STAIN) Cot Kala Langsa, Rabu lalu, Nazar menekankan petingnya peran masyarakat untuk memantau kinerja para bupati/ walikota. “Saat ini sejumlah daerah mengalami mis manajemen pengelolaan pemerintahan dan defisit anggaran, ini akan berpengaruh pada percepatan pembangunan di daerah tersebut,” ujarnya. Nazar mengharapkan nantinya tidak terjadi pengabungan kembali sejumlah daerah tingkat II di Aceh akibat tidak mampu mengelola daerah, beberapa daerah telah menunjukkan tandatanda ke arah tersebut, namun Nazar mengharapkan upaya semua pihak agar kondisi tersebut tidak terjadi. “Sudah terlihat di beberapa daerah yang tidak perlu saya sebutkan, pengelolaannya sangat buruk sehingga dana yang ada hanya cukup untuk membayar kebutuhan rutin saja,” katanya Nazar menepis anggapan keterpurukan sejumlah daerah tersebut akibat anggaran dana terbatas, sementara anggaran dana yang berlimpah dari dana Otonomi Khusus (Otsus) hanya dikelola Pemerintah Tingkat I. “Soal dana Otsus hanya pengelolaannya saja ada di Tingkat I, sementara penggunaannya dan perencanaan sepenuhnya berada pada tingkat II,” katanya. Dia mengatakan bagi pemerintah provinsi dana Otsus merupakan dana suci yang tidak bisa dipergunakan selain untuk pembangunan dan kesejahteraan masyarakat. Soal adanya tudingan pegawai PNS yang bertugas di provinsi mendapat tambahan pendapatan yang diambil dari dana Otsus dibantah Nazar. Menurutnya dana tersebut bersumber dari Anggaran APBA Provinsi. “Di sinilah dituntut kecakapan dari pemimpin daerah untuk mampu mengelola daerahnya sehingga tidak hanya pembangunan yang dapat berjalan namun juga mampu mensejahterakan para pegawainya,” ujar Nazar.(b25)

ATCW Sudah Pecat Kamal Ruzamal KUALASIMPANG ( Waspada): Dewan Pendiri Aceh Tamiang Corruption Watch ( ATCW), Eddy Arnaldi Harahap menyatakan sudah memberhentikan atau memecat Plt Ketua ATCW, Kamal Ruzamal, SE dari jabatannya terhitung 26 Januari 2011 sampai batas waktu yang tidak ditentukan. “Kamal Ruzamal sudah diberhentikan sebagai Plt Ketua ATCW,” ungkap Eddy Arnaldi Harahap, Kamis (27/1). Menurut Eddy yang juga Ketua ATCW, ATCW telah menerbitkan Surat Keputusan Nomor :018/ATCW/VI/2011 tanggal 26 Januari 2011. Dalam surat keputusannya itu ATCW menerangkan pemecatan terhadap Kamal Ruzamal adalah berdasarkan pertimbangan untuk memperlancar roda organisasi Lembaga Swadaya Masyarakat ( LSM) agar solid dan sesuai bentuknya untuk melakukan pengawasan dan control dalam bentuk pencegahan dini tindak pidana korupsi di Kabupaten Aceh Tamiang. “Kamal Ruzamal melanggar kode etik, tidak transparan dan tidak sesuai dengan garis-garis perjuangan ATCW serta tidak sesuai dengan misi dan visi ATCW,” ungkap Eddy. Eddy menerangkan, ATCW menunjuk Aliyandi, SH menjadi Plt Ketua dan membentuk pimpinan ATCW yang lowong, juga dalam dua bulan ke depan segera mengadakan Musdalub untuk memilih pimpinan ATCW defenitif. Aliyandi, SH ketika dikonfirmasi, Kamis ( 27/1) menyatakan siap melaksanakan tugas yang dipercayakan ATCW kepadanya. “Saya akan laksanakan tugas ini sebaik-baiknya demi kemajuan organisasi, ATCW,” ujar Aliyandi. Sedangkan Kamal Ruzamal yang dikonfirmasi melalui telepon selular, meski ada nada masuk namun tidak diangkat.(b24)

Nelayan Tewas Tersengat Listrik Di Tengah Laut BIREUEN (Waspada): Irfan bin Sofyan, 18, nelayan asal Desa Pulo Kec. Peudada, Bireuen, Rabu (26/1) subuh tewas di tengah laut saat menjalankan aktivitas bersama temannya yang diduga kuat akibat tersengat arus listrik dari genset di dalam boat. Informasi yang diperoleh, Kamis (27/11), Irfan pergi ke laut bersama rekan-rekannya Selasa (25/1) sekira pukul 21:00, beberapa jam menempuh perjalanan atau sekitar 7 mil dari lepas pantai. Mesin genset mereka hidupkan. Namun saat korban hendak mengambil minyak tanah, tangannya diduga menyentuh seng atap boat sehingga tubuhnya tersengat arus listrik. Temannya berusaha menolong dengan memindahkan korban ke boat kecil untuk dibawa ke darat, namun dalam perjalanan korban menghembuskan nafas terakhir. Kapolres Bireuen AKBP H.R Dadik Junaedi S.H melalui Kasat Pol Air PPI Peudada, Aiptu Suryadi dikonfirmasi membenarkan ada nelayan meninggal dunia karena kesetrum aliran listrik saat melaut.(amh)

Dua Maling Boat Nelayan PPI Peudada Ditangkap BIREUEN (Waspada): Para nelayan kawasan Kec. Trieng Gadeng, Pidie Jaya, Rabu (25/1) malam menangkap dua pemuda, Muk, 22, asal Kec. Samalanga, Bireuen dan Jam, 13, asal Kec. Peudada, karena diduga membawa lari boat Faisal, 24, nelayan asal Desa Calok, Peudada, Bireuen yang ditambat di PPI Peudada. Setelah ditangkap keduanya diamankan ke Mapolsek Peudada. Informasi yang diperoleh, Kamis (27/1), nelayan di kawasan Trienggadeng berani menangkap kedua pelaku yang membawa lari boat orang itu karena sebelumnya mereka telah mendapat kabar dari sejumlah nelayan di kawasan PPI Peudada, Rabu dinihari (26/1) sekitar pukul 03:00 WIB terjadi pencurian boat becak milik Faisal, dan diketahui pemiliknya sekira pukul 7:00. Sementara Faisal, pemilik boat kepada wartawan di Mapolsek Peudada menjelaskan, pelaku ditangkap nelayan di Trienggadeng setelah kepergok di tengah laut saat mesin boat itu rusak. Namun saat itu nelayan di Trienggadeng belum tahu boat yang mogok itu hasil curian, apalagi yang tidak mencurigakan mereka karena saat ditanya kedua pelaku mengaku hendak melaut. Sementara Kapolres Bireuen AKBP HR Dadik Junaedi, SH melalui Kasat Pol Air PPI Peudada Aiptu Suryadi mengatakan, k eberhasilan penangkapan kedua pelaku hasil koordinasi Satpol Air Peudada dengan Polsek Trienggadeng serta masyarakat dan nelayan PPI Peudada dan nelayan Trieng Gadeng, sehingga boat yang hilang serta pelakunya berhasil ditangkap.(amh)

Waspada/Abdul Mukthi Hasan

Dua anggota Polsek Peudada, Bireuen menggiring dua pelaku pencurian boat di PPI Peudada setelah dijemput dari Polsek Trienggadeng, Pidie Jaya, Jumat (28/01).

Aceh

WASPADA Sabtu 29 Januari 2011

B7 Puluhan Mobil Bireuen Ekspres Mogok

Rumah Janda Terbakar BIREUEN (Waspada): Puluhan pedagang di Desa Uteun Gathom, Kec. Peusangan, Bireuen, Kamis (27/1) menjelang siang kucar-kacir begitu melihat rumah Nurma, 50, yang berada di belakang deretan 15 unit ruko terbakar. Bahkan mereka sempat mengeluarkan serluruh barang dari ruko masing-masing. Namun beberapa saat kemudian sejumlah armada pemadam kebakan tiba di lokasi dan api tidak sempat menjalar ke ruko mereka. Menurut keterangan, terbakarnya rumah dapur milik janda itu belum diketahui sumber apinya, namun sebagian warga menduga dari kayu bakar bekas dia memasak. Saat itu sekitar 15 pemilik ruko yang berada di samping panik khawatir ruko mereka juga ikut terbakar. Pantauan Waspada sejumlah barang milik pedagang lainnya yang menempati ruko-ruko di kawasan itu masih menumpuk di pinggir jalan. Sedangkan Nurma terlihat masih shok berat dan belum bisa diajak bicara.(amh)

Maling Helm Meresahkan REDELONG (Waspada): Jangan coba-coba tinggalkan helm, tanpa pengaman di parkiran Setdakab Bener Meriah. Bisa-bisa pelindung kepala itu lenyap digondol maling. Pasalnya, sejak sepekan terakhir pencuri helm kembali bergentayangan di area parkir setdakab Bener Meriah, dan membawa kabur helm milik para pegawai yang bekerja di kantor itu. Menurut salah seorang pegawai staf Humas Setdakab Bener Meriah, Julianto, kepada Waspada Jumat (28/1) mengatakan, pencurian helm di parkiran Kantor Bupati Bener Meriah, akhir-akhir ini kembali marak dengan incaran helm milik para pegawai yang diletakkan tanpa pengaman di atas sepeda motor. “Aksi pencurian helm bukan hanya kali ini saja terjadi di area parkir kantor bupati, tetapi beberapa pegawai lainnya juga sudah pernah kehilangan helm,” kata Julianto. Akibat kehilangan helm itu, papar Julianto, untuk berangkat maupun pulang dari kantor ia terpaksa melintas melalui jalan potong untuk menghindari bertemu dengan polisi lalu lintas lantaran tidak menggunakan helm karena helm miliknya telah digondol maling “Padahal belakangan ini, saya tidak pernah lewat jalan potong saat berangkat maupun pulang dari kantor. Tapi lantaran helm hilang dicuri maling terpaksa jalan itu yang saya lalui, sebelum ada pengganti helm yang baru,” keluhnya. Julianto meminta para pengguna kendaraan roda dua bila memarkirkan kendaraannya, sebaiknya helm dibawa serta atau dititip di tempat yang aman agar kejadian seperti yang dia alami tidak terjadi.(cih)

Masyarakat Dukung Upaya Tim Polresta Medan BIREUEN (Waspada): Masyarakat Aceh khusunya Bireuen mendukung upaya Polresta Medan untuk menelusuri tentang pengiriman berbagai jenis buku dan Compact Disc (CD) yang isinya tentang penistaan Islam sebagaimana diharapkan para tokoh dan ulama Islam di wilayah provinsi tetangga Aceh itu. “Umat Islam seperti kata Nabi Muhammad, semua bersaudara, bila satu sakit yang lain juga merasakan sakit. Apa yang dialami masyarakat Medan ssaat ini sama dengan yang dirasakan masyarakat muslim di Aceh,” kata Kadis Syariat Islam Bireuen, Drs Tgk H. Umar Budiman, Jumat (28/1). “Makanya, selaku muslim di Aceh kebetulan juga tetangga dekat provinsi Sumatera Utara, sangat mendukung upaya tim Polresta Medan untuk menelusuri pengiriman paket,” tegasnya.(amh)

Siswa SMK Pedalaman Aceh Utara Kembangkan Pupuk Kompos NISAM, Aceh Utara (Waspada): Siswa SMK Negeri1 Nisam, Aceh Utara mengembangkan pupuk kompos dari jerami. Selama ini jerami padi tidak dimanfaatkan sehingga tidak memiliki nilai ekonomis. Sekolah Menengah Kejuruan (SMK) jurusan Teknik Pengolahan Hasil Pertanian (TPHP) di pedalaman Nisam, konsen dengan pengembangan pertanian. Salah satunya, jerami padi yang sebelumnya tidak dimanfaatkan diolah agar memiliki nilai ekonomis. “Siswa sudah bisa mengolah jerami dari petani menjadi kompos,” jelas Ketua SMK Negeri-1 Nisam Drs. Ibrahim kepada Waspada beberapa waktu lalu. Untuk menguji kualitas kompos, telah digunakan untuk menyuburkan berbagai jenis tanaman peghijauan di lingkungan sekolah. Biasanya setelah panen padi, petani membakar jerami yang menumpuk di sawah. Namun dengan dilakukan pengembangan produksi kompos, jerami tersebut sudah bisa bermanfaat. Sebelumnya para siswa juga mengem bangkan pengolahan susu kedelai dan minuman keseha tan dari jahe.(b17)

Partisipasi Warga Menunjang Menuju Gampong Mandiri BIREUN (Waspada): Partisipasi masyarakat desa sangat penting untuk menunjang suksesnya pembangunan menuju Gampong mandiri. Tanpa partisipasi masyarakat pembangunan Gampong untuk kepentingan masyarakat menjadi pincang tidak mencapai sasaran secara maksimal. Camat Kota Juang Dahlan, SE menyampaikan hal itu dalam pegarahannya pada Musyawarah Atar Desa (MAD) Kecamatan Kota Juang diselenggarakan Fasilitator PNPM Kecamatan di Aula SMKN-1 Bireuen, Kamis (27/1). Dikatakan, musyawarah antar desa yang membahas perencanaan pembangunan Desa merupakan usulan perencanaan dari bawah sangat penting untuk menunjang pembangunan desa. Konon lagi dengan adanya program PNPM Mandiri yang mengalokasikan dana untuk pembangunan desa, diharapkan dapat dimanfaatkan secara benar dan terlaksana secara maksimal dalam upaya menuju Gampong Mandiri. Musyawarah Antar Desa diikuti 142 peserta terdiri dari lima anggota DPRK DP-1 Kota Juang, Imum Mukim, Geuchiek, Tuha Puet, SKPD terkait, BPM, Disdikbudpora Dinas PU, Bappeda, Dinkes, dan unsur perempuan.(b16)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:20

11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta

13:25

12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

Waspada/Maimun Asnawi

MOGOK: Puluhan BE mogok dan parkir di depan Kantor Bupati Aceh Utara, Jumat (28/1) karena mobil mereka tidak dicarter para santri dan ulama berangkat ke Aceh Barat hari ini, Sabtu (29/1)

Kenaikan Harga GabahBeras Tak Dinikmati Petani MEUREUDU (Waspada): Kalangan petani di Provinsi Aceh menyatakan, pihaknya nyaris tidak pernah menikmati kenaikan harga gabahberas di saat musim paceklik. Bahkan, sebaliknya menjadi pembeli beras di saat harga-nya melambung tinggi seperti sekarang ini. Kalangan petani di Kabupaten Pidie Jaya dan Pidie kepada Waspada, Jumat (28/1) mengakui, kenaikan harga gabah disertai harga beras tidak dinikmati petani. Pasalnya, kenaikan justru selalu terjadi pada saat stok gabah habis dan petani mulai kembali turun ke sawah. Bahkan, kenaikan harga gabah dan beras ini membuat petani mulai kehilangan gairah sebagai petani sawah, karena mereka beranggapan dengan naiknya harga beras akan disusul naiknya harga pupuk dan obat-obatan (racun hama). Pengakuan M. Amin, petani Bandar Baru, kehidupan petani sawah semakin sulit akibat mahalnya biaya produksi. Seperti, naiknya harga pupuk dan obatobatan (racun hama). Sedangkan musim

panen, harga beras atau gabah selalu stabil, bahkan cenderung turun. “Kenaikan harga beras sama sekali tidak dinikmati petani, karena saat panen kamisudahmenjualhabishasilpanengabah dan menjadi pembeli beras,“ tukas Amin. Dia juga menyatakan, hidup sebagai petani tidak ada enaknya, karena saat musim panen harga gabah cenderung turun dan musim tanam (paceklik) harga beras bergerak naik disusul naiknya harga pupuk dan obat-obatan. Keluhan sama juga dikemukakan, M. Piah, petani di Glumpang Minyeuk, Kec. Glumpang Tiga, Pidie. Dikatakannya, setiap musim tanam tiba, dia terpaksa meminjam modal tetangga. Dengan harapan pada musim panen nanti dapat membayar pinjamannya. Menurut petani yang mengaku hanya sebagai penyewa sawah ini, dari hasil panennya seluas dua naleh bijeh (setengah hektar-red), tak mampu menutupi kebutuhan berasnya selama empat bulan atau sampai kembali turun tanam sawah. Praktis, dia terpaksa mencari utangan untuk dapat kembali turun sawah. Ironi Diakui, kenaikan harga gabah dan beras itu sesuatu yang ironi dialami para

petani di Aceh. Hal itu seperti diungkapkan Kepala Badan Ketahanan Pangan dan Penyuluhan (BKPP) Provinsi Aceh, Drs. H. Salman Ishak, M. Si, harga gabah yang signifikan saat ini senilai Rp5.000/kg, yang seharusnya menguntungkan petani. “Justru sebaliknya, ketika harga naik petani menjadi kelabakan, karena tidak memiliki stok beras untuk kebutuhan sehari-hari dan bahkan menjadi pembeli dengan harga mahal,“ kata mantan Bupati Pidie Jaya itu. Padahal, kata Salman, jika petani Aceh memiliki saving (stok) yang cukup selama menunggu masa panen berikutnya, kenaikan harga beras itu tidak menjadi masalah. Menurut Salman, di masa lalu petani di Aceh tidak pernah krisis stok gabah, kecuali jika gagal panen. Ini disebabkan, para petani Aceh dulu, tidak pernah menjual habis gabah mereka di saat panen. Oleh karenanya ke depan, kata Salman, pihaknya siap mengkampanyekan masalah disiplin pangan keluarga bagi petani Aceh, yakni dengan menghimbau petani tidak keburu menjual gabahnya pada saat panen, tapi harus memperhitungkan simpanan stok gabah selama masa menunggu panen berikutnya.(b21)

Irwandi Yusuf: Aceh Tidak Akan Kekurangan Pangan BAKTYA, Aceh Utara (Waspada): Drh. Irwandi Yusuf, Gubernur Provinsi Aceh, Kamis (27/1) di Kec. Baktya, Aceh Utara menyebutkan, Provinsi Aceh tidak akan kekurangan pangan, meski ada beberapa daerah yang gagal panen, namun di beberapa daerah lain mengalami surplus beras. “Saya pikir, tidak ada yang perlu dikhawatirkan. Aceh saat ini tidak akan mengalami kekurangan pangan, kita memiliki stok yang cukup,” kata orang

nomor satu di Bumi Iskandar Muda itu, usai mewisuda mahasantri di Ma’had Aly Lil Ulum Islamiyyah Samudera Pase (INSIS) di Gampong Alue Reudang, Baktya. Begitu pun, Pemerintah Aceh perlu melakukan memantau distribusi beras ke daerah-daerah, yang selama ini dianggap masih terdapat kelemahan. Agar stok beras Aceh tetap pada posisi aman, Irwandi Yusuf minta masyarakat terutama para pengusaha jual beli gabah tidak menjual gabah dalam jumlah berlebihan ke luar

ikutsekitar30sanggaryangadadiKotaBanda Aceh. Mereka sudah memastikan menyambut Kutaraja Art Carnival ini,” ujar dia. Reza menyebutkan, Kutaraja Art Carnival akan menampilkan berbagai atraksi, seperti tarian, musik khas Aceh hingga penampilan kesenian debus. Kutaraja Art Carnival akan mengambil rute dari lapangan Blang Padang, menuju ruas jalan depan pendapa Gubernur Aceh hingga sisi selatan Masjid Raya Baiturrahman. Selanjutnya peserta pawai melintas di ruas jalan depan Balai Kota Banda Aceh dan berakhir di Taman Sari. Di depan kantor wali kota ini mereka diwajibkan beratraksi. Peserta pawai budaya ini akan dinilai oleh tim juri yang khusus didatangkan dari Jakarta. Penilaian ini dila-

daerah, contohnya ke Provinsi Sumatera Utara. Jika jual beli gabah antar provinsi masih tetap dilakukan pengusaha, maka Pemerintah Aceh akan melakukan pantauan melalui tiga daerah yakni Aceh Tamiang, Subulussalam dan melalui Aceh Tenggara. “Pantauan sangat mudah kita lakukan, karena ke luar masuk barang antar provinsi hanya dapat dilakukan lewat tiga daerah tadi,” katanya.(cmun)

kukan untuk menentukan juara pawai budaya. “Total hadiah yang diberikan kepada peserta terbaik mencapai Rp 38 juta dengan rincian juara pertama mendapat Rp 5 juta, kedua Rp 3 juta dan ketiga Rp 2 juta,” sebutnya. Katanya, hadiah juga diberikan kepada peserta terbaik keempat hingga 10 dengan hadiah Rp 1,5 juta dan lima juara favorit masing-masing Rp 1 juta. “Kutaraja Art Carvinal ini merupakan kegiatan pembukaVisit Banda Aceh Year 2011. Pawai budaya ini menandakan kesiapan masyarakat menyambut wisatawan dalam dan luar negeri,” ungkap mantan kabag umum Pemko Banda Aceh ini. (b05)

DPRK Sabang Minta Program Sentuh Kepentingan Masyarakat SABANG ( Waspada): Pimpinan DPRK Sabang mengundang Kepala BPKS dalam dengar pendapat anggota terhadap berbagai program BPKS tahun 2011. Acara di gedung dewan, Kamis (27/ 1) pagi, banyak hal yang dipertanyakan dewan kepada BPKS. Namun stresingnya mengharapkan program kerja tahun 2011 yang dapat menyentuh kepentingan masyarakat seperti masalah air minum yang selama ini belum ada solusinya. Rapat dengar pendapat dipimpin Ketua DPRK Sabang Abdul Manan, S.Ag dan dihadiri sebagian besar anggota dewan berjalan lancar. Sementara dari BPKS dihadiriWakil Kepala BPKS, Ir. Nasruddin Daud, M.Sc dan Pj. Deputi Bidang Program Perencanaan BPKS Puddu Razak serta sejumlah staf. Pj. Deputi Bidang Program Perencanaan BPKS Puddu Razak dalam paparannya menjelaskan, program prioritas BPKS 2011 akan lebih fokus pada beberapa sektor pengembangan ekonomi masyarakat termasuk pengelolaan aset pemerintah yang sudah diserahkan kepada BPKS. “Ada beberapa aset yang harus kita

kelola seperti Sabang Hill, Sabang Plaza dan sebagian besar lainnya yang bila dikelola dengan baik juga akan meningkatkan ekonomi masyarakat,” ujar Puddu. Ia berharap dukungan dewan agar program kerja BPKS berjalan baik termasuk harus adanya masukan-masukan yang akan mendongkrak kepentingan mas-

Puluhan Bus Jalani Pemeriksaan BIREUEN (Waspada): Puluhan bus dan truk yang melintasi kawasan depan Mapolres Bireuen, Kamis (27/1) diperiksa tim gabungan yang terdiri Badan Narkotika Provinsi Aceh (BNPA), Badan Narkotika Kabupaten Bireuen (BNKB), anggota Polres anggota POM /TNI. Rrazia yang langsung dikoordinir Ketua BNK Bireuen, Busmadar Ismail yang juga Wabup setempat dan Waka Polres Bireuen Kompol Armaini berlangsung pada malam hari mulai pukul 21.00-24.00 WIB. Namun, tidak didapat bus ataupun truk yang mengangkut narkoba atau benda lain yang mencurigakan, selain beberapa unit sepmor yang tidak membawa yang diamankan malam itu oleh tim Polres setempat. Pantauan Waspada Kamis (27/1) malam, tim gabungan yang jumlahnya sekitar 100 orang melaksanakan razia dan estiap bus atau mobil penumpang lainnya dan juga truk. Begitu tiba di depan Mapolres Bireuen lalu memeriksa luar dan dalamnya, bila tidak ditemukan bus atau mobil itu dipersilahkan melanjutkan perjalanannya. Ketua BNK Bireuen, Busmadar Ismail kepada wartawan diselasela menggelar razia mengatakan, razia tim gabungan yang dilaksanakan itu tujuannya untuk memutuskan jaringan peredaran narkoba yang masuk atau yang ada di Aceh sekaligus untuk mencari pelaku pengedar narkoba. “Razia ini sudah dilaksanakan beberapa hari lalu dan kalau tidak ada halangan apa-apa akan berakhir akhir bulan ini (Januari-red),” katanya. Sementara itu, Wakapolres Bireuen Kompol Armaini menambahkan, razia tim gabungan untuk menjaring pengedar atau barang jenis narkoba bukan saja diperiksa seperti biasa saja seperti selama ini, namun diperiksa dengan alat pendeteksian narkoba yang telah dimiliki Polres Bireuen.(amh)

Masyarakat Sipil Tolak Pengadaan Mobil Dinas Pimpinan DPRK

Banda Aceh Gelar Kutaraja Art Carnival BANDA ACEH (Waspada): Menyambut tahun kunjungan wisata 2011, Banda Aceh terus menggeber banyak acara untuk memikat tamu. Salah satunya adalah pawai budaya yang bertajuk Kutaraja Art Carnival. Kepala Dinas Kebudayaan dan Pariwisata Kota Banda Aceh, Reza Fahlevi kepada wartawan, Jumat (28/1) mengatakan, pagelaran pawai budaya itu masih rangkaian awal dalam rangka menyambut Visit Banda Aceh Year 2011, dan akan dilangsungkan pada hari ini, Sabtu (29/1). Kata dia, Kutaraja Art Carnival itu akan dimeriahkan ratusan pelaku seni yang tergabung dalam sejumlah sanggar, para ‘geuchik’ (kepala desa), pejabat dan masyarakat umum.“Jumlah sanggar yang

ACEH UTARA (Waspada): Karena tidak dicarter berangkat ke Meulaboh untuk memperingati hari ulang tahun (haul) ke-4 Rabithah Silahturrahmi Santri se-Aceh (RASSA) di Dayah Darul Hikmah Gampong Peunaga Rayeuk, Kecamatan Meurbo, Aceh Barat, Sabtu (29/1), puluhan mobil Bireuen Ekspres (BE) dari Aceh Utara dan Kota Lhokseumawe mogok dan parkir di depan Kantor Bupati Aceh Utara. Pasalnya, seseorang yang mencarter mobil telah pernah bernegosiasi dengan para sopir BE di Aceh Utara dan Lhokseumawe. Namun para sopir keberatan, satu unit mobil ditawar senilai Rp2.8 juta per unit. Sementara para sopir meminta per unit mobil Rp3 juta. “Kalau Rp2.8 juta kita nggak sanggup ke Meulaboh, karena itu kita tawarkan Rp3 juta,” kata Hanafiah, 45, perwakilan BE Aceh Utara dan Lhokseumawe. Karena tawaran itu ditolak yang mencari mobil, maka dianggap tidak ada persoalan, namun Kamis (27/1) malam diterima informasi panitia telah mencarter mobil BE dari Bireuen senilai Rp3 juta per unit. “Ini yang membuat kami marah. Kalau harganya Rp3 juta, kami di Aceh Utara dan Lhokseumawe sanggup ke Meulaboh. Banyaknya mobil yang diperlukan 20 unit. Kami mogok hari ini untuk menuntut keadilan, ya paling tidak kami diberi jatah 10 mobil saja,” katanya. Hal itu juga disampaikan Irwandi, 27, sopir BE lainnya. Kata dia, jika kenyataannya seperti itu, maka para sopir telah mengibaratkan dirinya seperti buya krueng teudong-dong, buya tamong meuraseuki (buaya sungai tidak dapat apa-apa, buaya masuk dapat rezeki). “Kami tidak terima diperlakukan seperti ini. Makanya kami mogok hari ini, Jumat (28/1),” katanya. Menanggapi persoalan itu, Isa Ansari ND Sekda Aceh Utara didampingi F. Badli, Kadis Perhubungan kepada wartawan mengatakan, aksi mogok dan aksi protes yang dilancarkan para sopir BE tak cukup alasan dan dinilai salah alamat. Pasalnya, para santri dan ulama yang akan berangkat ke Aceh Barat mencarter mobil secara pribadi menggunakan uang pribadi mereka masing-masing. “Jadi aksi protes ini salah alamat. Mobil-mobil itu tidak dicarter dengan dana APBD, tapi dengan uang santri dan ulama sendiri. Kebetulan yang mencarter mobil penagwai Kantor Bupati Aceh Utara, tapi bukan atas nama Pemkab Aceh Utara. Begitu…,” kata Isa Ansari. (cmun)

yarakat. Sementara Ketua DPRK Sabang, Ridwan Manan, S.Ag menilai selama ini program BPKS belum menyentuk kepentingan masyarakat Sabang seperti halnya program pembebasan lahan yang dilakukan BPKS, belum menyentuh kepentingan masyarakat.(b29)

Waspada/T.Zakaria Al bahri

DENGAR PENDAPAT: Anggota DPRK Sabang dengar pendapat dengan BPKS.

BANDA ACEH (Waspada): Rencana Pemkab Aceh Barat untuk melakukan pengadaan tiga unit mobil dinas bagi pimpinan DPRK setempat mendapat penolakan dari kalangan masyarakat sipil di kabupaten tersebut. Menurut mereka, hal tersebut merupakan tindakan yang kurang tepat jika dilakukan pada tahun ini. Apalagi diketahui beberapa tahun terakhir keuangan Aceh Barat mengalami defisit, selain masih adanya piutang pada Bank Aceh. Koordinator GeRAK Aceh Barat, Mulyadi, selaku jurubicara kelompok Masyarakat Sipil Aceh Barat, mengatakan, pengadaan tiga unit mobil untuk pimpinan DPRK bukanlah suatu hal yang mendesak. “Masih banyak kegiatan lain yang lebih bermanfaat yang harus dilakukan oleh Pemkab Aceh Barat, seperti alokasi dana untuk meningkatkan mutu pendidikan dan kesehatan bagi masyarakat Aceh Barat, misalnya,” katanya kepada Waspada, Jumat (28/1). Sebagaimana diberitakan, Pemkab Aceh Barat akan mengalokasikan dana sebesar Rp1 milyar untuk pengadaan 3 unit mobil dinas bagi pimpinan DPRK. Berarti, Pemkab Aceh Barat akan mengalokasikan anggaran untuk pengadaan mobil tersebut pada KUA-PPAS Tahun Anggaran 2011. “Tindakan ini jelas-jelas sangat melukai hati rakyat dan terkesan Pemkab Aceh Barat belum cermat dalam menyusun perencanaan, sehingga tidak dapat mengklasifikasikan program prioritas yang harus dilaksanakan pada tahun 2011 ini. Selain terkesan belum dapat menganut asas efektif dan efisien dalam mengelola keuangan daerah,” papar Mulyadi. Terkait itu, kelompok masyarakat sipil Aceh Barat secara tegas meminta agar Pemkab Aceh Barat tidak mengajukan alokasi anggaran untuk pengadaan 3 unit mobil bagi pimpinan DPRK pada KUA-PPAS tahun ini. “Kami juga mendesak DPRK Aceh Barat agar tidak menyetujui alokasi dana untuk pengadaan 3 unit mobil bagi pimpinan DPRK pada saat pembahasan KUA-PPAS,” demikian Mulyadi atas nama Kelompok Masyarakat Aceh Barat yang terdiri dari GeRAK Aceh Barat, LBH Banda Aceh Pos Meulaboh, FK-GEMAB, DPC GRANAT Aceh Barat, KiPAS, LIBPAS. (b07)

Aceh Kehilangan Potensi Pajak Rp 1 M Pertahun Dari PKB LANGSA (Waspada): Diperkirakan dalam satu tahun pemerintah Aceh mengalami kehilangan potensi sumber Pajak Kendaraan Bermotor (PKB) hampir Rp 1 milyar. Perkiraan tersebut hanya untuk tiga kabupaten kota yakni, Kota Langsa, Aceh Tamiang dan Kota Subusalam, Jumat(28/1). Itu baru hitungan kasar saja, karena berdasarkan penuturan Husnaidy, Kepala UPTD Samsat wilayah VI, yang meliputi Aceh Tamiang, Kota Langsa dan Aceh Tamiang, hampir 67 persen kendaraan bermotor terutama jenis roda empat yang beroperasi di wilayah tersebut mengunakan plat kendaraan luar Aceh. “Kita perkirakan hampir 67 persen kendaraan di daerah ini masih mengunakan plat kendaraan luar daerah,” ujar Husnaidy. Dia mengatakan sampai sejauh ini pengunaan plat kendaraan luar daerah tersebut tidak bisa dibatasi karena belum ada peraturan yang mengaturnya. “Kita tidak bisa melarang pemilik kendaraan mengunakan plat luar daerah, hanya saja kita mengharapkan kesadaran para pemilik kendaraan untuk mengunakan plat kendaraan Aceh,” tambahnya. Namun ironisnya pemilik kendaraan bermotor yang mengunakan plat luar daerah bukan hanya didominasi kendaraan milik pribadi, sejumlah kendaraan milik Badan Usaha Milik Negara (BUMN) yang beroperasi Di Langsa ternyata juga lebih memilih mengunakan plat luar Aceh Husnaidy menambahkan pendapatan pajak kendaraan bermotor di Samsat wilayah Vi sampai desember 2010 mencapai Rp 4 milyar, nantinya semua dana tersebut akan disetorkan kepada pemerintah tingkat I untuk nantinya akan didistribusikan kembali kepada daerah tingkat II dalam bentuk dana perimbangan tingkat I sebesar 30 persen. (b25)

Opini

B8 TAJUK RENCANA

VCD Pemecah Belat Umat Dan Pendangkalan Akidah

B

erbagai kalangan mengecam persebaran VCD (vidoe compact disk) dan buku yang isinya memojokkan umat Islam. Dalam VCD dan buku tersebut disebutkan berbagai hal yang bertentangan dengan ajaran agama Islam. Sampai sosok Nabi Muhammad pun menjadi sesuatu yang dibelokkan ajarannya dalam VCD dan buku tersebut. Sampai Jumat (28/1), khatib shalat Jumat di berbagai masjid mengecam persebaran yang ingin memecah belat umat Islam tersebut. Memang hingga kini organisasi keagamaan telah meminta aparat keamanan untuk bertindak terutama mengejar pelaku yang mengedarkan. Jangan sampai kemudian VCD yang tersebar memecah belah kesatuan umat. Dalam khatib Jumat, kemarin, permintaan kepada aparat keamanan sangat serius. Sebab paling tidak kalau ada persebaran seperti itu yang menjadi tertuduh adalah mereka yang di luar agama Islam. Dengan begitu gampang sekali tersulut isu SARA (suku agama ras dan antar golongan). Paling tidak tudingan terhadap kelompok agama lain membesar. Padahal belum tentu seperti itu. Perlunya ketepatan aparat keamanan paling tidak sudah menghindari isu SARA berkembang. Apalagi kita harus faham bisa saja tujuan penyebaran itu untuk mendorong pendangkalan akidah umat Islam. Saat ini para ulama sudah semakin khawatir dengan banyaknya media yang menjadikan umat Islam tersudut. Banyak sekali hal-hal yang harusnya bisa dihindari tapi kini menjadi konsumsi mulai anak-anak sampai orang tua. Berbagai informasi negatif yang melanda umat Islam sebenarnya tidak saja dari VCD dan buku yang dikirim ke ustadz-ustadz. Intisari Tantangan anak-anak umat Islam sekarang lebih banyak dari media. Terutama dari internet, handphone, Jadi selain VCD yang komik, tayangan televisi dan media lain. diedarkan, lama-lama Dalam satu seminar di Jakarta terungkap kemajuan teknologi telah menyependangkalan akidah itu bahwa babkan anak-anak sekarang di luar jalur. sendiri sudah ditabur Penggunaan SMS Alay, perpaduan anhuruf dan angka dan harus dibaca melalui jejaring internet. tara terbalik kini sudah diadopsi anak-anak dari Kita berharap para orang kalangan umat Islam. Setelah dibaca tertua tetap mengawasi nyata isi SMS-nya mengajak seseorang berbuat amoral. anak-anak. Belum lagi dengan akses internet yang semakin cepat telah mendorong anak-anak tidak lagi menghiraukan pelajaran di sekolahnya. Tantangan di dunia internet ini sering pula membuat orang tua untuk mengabaikan pendidikan kepada anaknya. Banyak sekali orang tua yang tidak terlalu peduli dengan orang tuanya. Mereka lebih ingin agar anak-anaknya mandiri dan menggunakan media internet sendirian. Padahal kita tahu bahwa dengan membebaskan anak bisa membuat mereka terjebak berbagai situs yang mendangkalkan akidah. Berdasarkan informasi yang ada sebenarnya seorang anak yang masih lugu belum dapat menilai baik atau buruknya suatu hal, maka seorang anak usia 8-12 tahun sering menjadi sasaran. Dikutip dari media online, menegaskan bahwa dengan usia seperti ini, otak depan seorang anak belum berkembang dengan baik. Sedangkan otak depan adalah pusat untuk melakukan penilaian, perencanaan dan menjadi eksekutif yang akan memerintahkan tubuh untuk melakukan sesuatu. Pada otak belakang merupakan pendukung dari otak depan. Di sini juga dihasilkan dopamin, yaitu hormon yang menghasilkan perasaan nyaman, rileks atau fly pada seseorang. Seorang anak yang kecanduan akan sulit menghentikan kebiasaannya sehingga dia akan melakukan hal tersebut berulang kali. Anak dapat merasa bersalah tetapi tidak berani mengutarakan perasaannya kepada orang-tuanya karena takut atau kesibukan ayah dan ibunya. Dalam keadaan cemas, otak berputar 2,5 kali lebih cepat dari putaran biasa pada saat normal. Akibat perputaran yang terlalu cepat ini, otak seorang anak dapat menciut secara fisik sehingga otak tidak berkembang dengan baik. Suatu keadaan yang dapat merusak masa depan seorang anak. Selain itu, gambar-gambar cabul yang ada di situs web porno, biasanya akan melekat dan sulit untuk dihilangkan dalam pikiran anak dalam jangka waktu yang cukup lama. Jadi selain VCD yang diedarkan, lama-lama pendangkalan akidah itu sendiri sudah ditabur melalui jejaring internet. Kita berharap para orang tua tetap mengawasi anakanak. Punya filter dan mampu menghadirkan “Tuhan“ dalam keseharian anak.*

Surat Untuk Kapolri Saya Afrida Ayu, perempuan, umur 16 tahun, Agama Islam, siswa kelas 2(Dua) SMA, alamat : Jalan Bersama Keluraha Bantan, Kecamatan Medan Tembung, Kota Medan. Melalui surat ini datang memohon keadilan dan perlindungan kepada Bapak Kapolri, atas penderitaan yang saya alami, yaitu penyekapan dan pemerkosaan yang saya terima dari pelaku berinisial NF, pelaku beralamat di Jalan Titi Sewa Gg. Kenari, Kelurahan Bandar Kalipah, Kecamatan Medan Tembung. Sesuai pengaduan saya yang pertama di Poltabes Medan, nomor STBL/150/I/2010Tabes Medan. Bapak Kapolri, semoga memberi perhatian kepada saya kenapa Kapolda Sumatera Utara dan Kapoltabes Medan terkesa melindungi pemerkosa saya. Padahal pernyataan Kapolda di berbagai media yang mengatakan tidak air mata dikantor polisi. Karena sudah beberapa kali saya melayangkan surat ataupun tembusan kepada Bapak Kapolda, terutama pemerkosaan yang saya alami, tapi Bapak Kapolda seperti menganggap sepele pemerkosaan dibawah umur dan mungkin hal itu bagi Kapolda adalah hal biasa. Malah Kanit PPA Poltabes Medan mengatakan “ Pelaku tidak bisa ditahan karena anak seorang polisi”. Bapak Kapolri, supaya menempatkan Kapolda dan Kapoltabes Medan yang bisa melindungi masyarakat, buka melindungi pemerkosa. Bapak Kapolri saya mohon pengaduan saya ini cepat dituntaskan dan pelaku supaya ditangkap, tanpa embelembel perlindungan yang diberikan Kapolda dan Kapoltabes terhadap pelaku. Dan saya mohon Bapak Kapolri tidak ikut melindungi pemerkosa. Demikianlah permohonan dan penderitaan saya sampaikan, semoga bapak bisa berlaku adil, Terima kasih. Hormat Kami, Afrida Ayu Indarani (Ibu Afrida Ayu)

APA KOMENTAR ANDA SMS 081265134674

Faks 061 4510025

Email komentar@waspada.co.id

+6281397005470 Bravo WASPADA” tolong berita maling beras di terbitkan kembali dengan cetak tebal jangan pemekaran yang di besar - besarkan trims +6285261292297 Selamat malam, saya penjaga sekolah SD Negeri No.115494 Suka dame, Kec.Silangkitang, Kab.Lab.Batu Selatan, Sumut, tidak mendapat Intensif, sedangkan Guru mendapat, mohon bantuannya, selamat malam,sekian dan terima kasih! +6281362495479 Apalah artinya sebuah nama kalau akhir2 ini kita lihat sebahagian besar masyarakat Indonesia tidak mengetahui dan menghormati lagi jasa2 Pahlawan pendiri republik ini. Jadi adilnya mengenai nama Bandara baru yang. sedang di bangun di Sumut saya ada usul (I.)Tabalkan siapa orang pertama kali jadi Gubernur Sumut contoh. Bandara Soekarno Hatta masyarakat(rakyat) segala suku 2 yang ada di Indonesia tak keberatan. Begitu juga kalaupun Gubernur yang. pertama kali bukan orang Sumut dan bulan pula salah satu suku yang ada di Sumut. Saya rasa adilkan? Seperti Bandara Soekarno Hatta tersebut.

WASPADA Sabtu 29 Januari 2011

Penerimaan Siswa Baru Yang Berkeadilan Oleh Muhammad Rais Agar Sistim Penerimaan Siswa Baru relatif lebih adil, maka dilaksanakan secara online dan calon siswa setiap hari dapat melihat di internet sampai di mana posisinya

T

ulisan ini sengaja disampaikan jauh hari sebelum proses penerimaan siswa baru (PSB) pada tahun ini dilaksanakan. Hal ini dimaksudkan agar pihak-pihak terkait dapat mengkaji dan melakukan persiapan-persiapan yang lebih matang. Tulisan ini juga bertepatan dengan akan dibahasnya Ranperda Pendidikan di Kota Medan. Tentu saja tulisan ini dimaksudkan agar ke depannya proses peneriman siswa baru menjadi lebih baik. Semoga sumbang saran ini bisa menjadi bahan pertimbangan dalam membuat petunjuk teknis PSB di kabupaten/kota pada tahun ini. Mengacu pada Keputusan Menteri Pendidikan Nasional No. 051/U/2002 tentang PSB taman kanak-kanak dan sekolah. Keputusan ini menimbang bahwa penerimaan siswa dengan cara lebih baik dapat meningkatkan mutu pendidikan dan mencapai sumber daya manusia yang berkualitas sesuai kompetensi yang ditetapkan secara nasional. Azas-azas penerimaan siswa Pada pasal 2 Kepmendiknas Tahun 2002 tersebut juga menyebutkan tujuan penerimaan siswa adalah memberi kesempatan yang seluas-luasnya bagi warga negara usia sekolah agar memperoleh layanan pendidikan yang sebaik-baiknya. Seterusnya pada pasal 3 dijelaskan azas penerimaan siswa yaitu : Objektivitas, artinya bahwa penerimaan siswa, baik siswa baru maupun pindahan harus memenuhi ketentuan umum yang diatur di dalam keputusan menteri. Transparansi, artinya pelaksanaan penerimaan siswa bersifat terbuka dan dapat diketahui oleh masyarakat termasuk orangtua siswa untuk menghindakan penyimpanganpenyimpangan yang mungkin terjadi. Akuntabilitas, artinya penerimaan siswa dapat dipertanggungjawabkan kepada masyarakat, baik prosedur maupun hasilnya. Tidak diskriminatif, artinya setiap warga negara yang berusia sekolah dapat mengikuti program pendidikan di wilayah Negara Kesa-

tuan Republik Indonesia tanpa membedakan suku, daerah asal, agama, dan golongan Sisttim PSB solutif Yang dimaksud penerimaan siswa dalam tulian ini adalah PSB. Permasalahan PSB di berbagai daerah dari tahun ke tahun sepertinya terus saja berlanjut. Karenanya diperlukan langkah-langkah solutif sehingga kita tidak mengalami permasalahan yang sama. Ada dua tahapan PSB. Pertama, Undangan Siswa Unggul. Setiap sekolah dengan petunjuk dari Dinas Pendidikan menyebarkan undangan ke sekolah-sekolah untuk mengirimkan siswa terbaiknya untuk mengkuti seleksi berkas portofolio siswa. Seleksi berkas ini meliputi nilai akademik dari nilai raport tingkatan sebelumnya, serta nilai akademik yang diperoleh dari kegiatan akademik di luar sekolah. Jika diperlukan bisa ditembahi dengan Tes Potensi Akademik. Persentase yang diterima untuk Undangan Siswa Unggul ini bisa mencapai 5 persen dari daya tampung sekolah. Kedua, Sistim Penerimaan Siswa Baru Terpadu. Dalam hal ini dibuat panitia tingkat kabupaten/kota. kepala sekolah atau pejabat yang ditunjuk membentuk dan menetapkan panitia tingkat sekolah. Penyelenggaraan PSB ini dibuat terpadu untuk semua sekolah negeri pada masing-masing tingkatan di satuan pendidikan. Setiap calon siswa mempunyai hak untuk memilih tiga sekolah sekaligus. Mekanismenya dapat dilakukan seperti berikut : Siswa yang mendaftar di sekolah A, maka pilihan pertamanya adalah sekolah A, dan sisanya ia bebas memilih sekolah yang ia inginkan. Bagi calon siswa yang berprestasi, baik di tingkat kabupaten/kota, provinsi, nasional maupun internasional mendapatkan tambahan nilai secara proporsional, baik prestasi akademik maupun non akademik. Tempat tinggal calon siswa juga merupakan salah satu kriteria dalam perangkingan. Untuk siswa dalam kabupaten/kota tentunya mendapat prioritas dibandingkan yang berasal dari sekolah di luar kabu-

paten/kota. Ketentuan ini sesuai dengan kebijakan Kepmendiknas tentang Penerimaan Siswa Tahun 2002 pasal 9 dan 10, yaitu mempertimbangkan aspek jarak tempat tinggal ke seolah Agar Sistim Penerimaan Siswa Baru relatif lebih adil, maka dilaksanakan secara online dan calon siswa setiap hari dapat melihat di internet sampai di mana posisinya. Jika posisinya tidak memungkinkan untuk lulus pada ketiga pilihannya, ia masih diberi kesempatan untuk menukar pilihannya. Jika ia menarik berkas pendaftarannya, maka ia secara otomatis batal menjadi calon siswa. Dengan demikian rangkaian proses PSB ini mulai dari entri pendaftaran menggunakan sistim basis data terpusat, proses seleksi (rangking) secara otomatis oleh sistim komputer sampai dengan pengumuman hasil seleksi dapat dilihat setiap saat melalui internet. Inilah yang disebut dengan Real Time Online (online waktu nyata). Kesempatan bagi keluarga miskin Sesuai dengan azas tidak diskriminatif, maka sistim PSB ini tetap memberikan peluang bagi Keluarga Miskin (KM). Waktu pendaftaran bagi KM ini dibedakan dengan pendaftaran

yanglain.TentusajabagiKMinitetapharus menunjukkan Kartu Keluarga Miskin (KKM) yang sudah terlebih dahulu dikeluarkan oleh pemerintah daerah setempat. Proporsi PSB dapat dibuat sebagai berikut : 5 % dari daya tampung untuk Undangan Siswa Unggul, 10 % dari daya tampung untukcalonsiswadariKMdenganpembulatan ke atas, dan sisanya diperebutkan oleh pendaftaran regular lainnya. Aturan ini sesuai dengan Kepmendiknas tahun 2002 tentang penerimaan siswa pasal 9 dan 10 yang mempertimbangkan dari keluarga ekonomi lemah. Inilah sistim Penerimaan Siswa Baru yang relative bisa memenuhi keinginan berbagai pihak. Seperti di awal tulisan ini, saya berharap agar kita semua bisa duduk bersama untuk mencari format Penerimaan Siswa Baru yang tepat di kabupaten/ kota masing-masing. Pihak Dinas Pendidikan kabupaen/kota, Dewan Pendidikan, Anggota Legislatif dan para pakar pendidikan di kabupaten/kota. Semoga tulisan ini tidak sekadar tawaran, tapi sekaligus bisa menjadi solusi atas permasalahan yang selama ini pernah terjadi. Penulis adalah Guru SMAN 3 Medan, Penanggungjawab Pelaksana Pusat Sumber Belajar SMAN 3 Medan

Elit Alwashliyah: Dakwah Dan Politik Oleh Dedi Iskandar Batubara, S.Sos, SH, MSP Untuk mengetahui alasan elit Alwashliyah berpolitik praktis dapat dilakukan dengan mengklasifikasi elit ke dalam kelompok artikulatif

A

rsyad Thalib Lubis (seperempat Abad Al Washiyah, 1955) mengatakan : “…dalam memperjuangkan cita-cita Islam kita melihat dua lapangan yang amat penting. Pertama, lapangan politik. Lapangan ini telah diisi oleh umat Islam dengan membangunkan berbagai partai politik yang berazaskan Islam. Kedua lapangan pembangunan dan pembinaan. Lapangan ini telah diisi umat Islam dengan membangun dan membina Islam dalam jiwa dan amal umat. Kita harus menginsafi bahwa di samping soal-soal politik yang hangat dan bersimpangsiur yang dihadapi seharihari, soal pembangunan dan pembinaan Islam dalam jiwa umat tidak kurang pentingnya untuk mendapat perhatian yang istimewa. Pada suatu saat perjuangan dalam lapangan politik Islam akan kandas dan patah di tengah jalan jika perjuangan dalam lapangan yang kedua diabaikan. Menarik untuk menelaah pesan salah seorang ulama besar sekaligus pendiri Alwashliyah tersebut, dikaitkan dengan apa yang berlangsung sejak masa lalu dikalangan tokoh dan elit pengurus Alwashliyah yang memang sering bersentuhan dengan kegiatan politik dan menjadi anggota serta pengurus partai politik. Tujuan utama berdirinya Alwashliyah adalah sebagai sarana pemersatu umat yang berpecah belah dan berbeda pandangan. Perselisihan tersebut merupakan bagian dari strategi Belanda untuk terus berkuasa di bumi Indonesia , kemudian Organisasi Alwashliyah menggalang persatuan umat untuk melawan penjajahan belanda di muka bumi indonesia, hingga diraihnya kemerdekaan . Penjajah Belanda yang menguasai bumi Indonesia terus berupaya agar bangsa Indonesia tidak bersatu, sehingga mereka terus mengadu domba rakyat. Upaya memecah belah rakyat terus merasuk hingga ke sendi-sendi agama Islam. Umat Islam kala itu dapat dipecahbelah karena disibukkan dengan perbedaan pandangan dalam hal ibadah dan cabang dari agama (furu’iyah). Kondisi ini terus meruncing, hingga umat Islam terbagi menjadi dua kelompok yang disebut dengan kaum tua dan kaum muda. Dan perbedaan paham di bidang agama ini semakin hari semakin tajam hingga pada tingkat meresahkan. Perselisihan di kalangan umat Islam di Sumatera Utara khususnya kota Medan pada masa itu mendorong para pelajar yang menimba ilmu di Maktab

Islamiyah Tapanuli Medan berupaya untuk mempersatukan kembali umat yang terpecah belah.Upaya mempersatukan umat Islam terus dilakukan dan akhirnya terbentuklah organisasi Al Jam’iyatul Washliyah sebagai sarana pemersatu sesuai dengan namanya ” Perkumpulan yang menghubungkan”. Maksudnya adalah menghubungkan manusia dengan Allah Swt. dan menghubungkan manusia dengan manusia (sesama umat Islam) dan menghubungkan manusia dengan lingkungannya. Dibanding dengan organisasi kemasyarakatan Islam lainnya seperti, Muhammadiyah (1912), Nahdhatul Ulama (1926), Persis (1923), Alwashliyah dapat dikatakan masih muda. Energi kemudaannya itulah yang membuat umat Islam umumnya dan warga Alwashliyah pada khususnya banyak berharap dengan organisasi ini untuk dapat merealisasikan tujuantujuannya seperti yang termaktub dalam AD/ART Alwashliyah. Tidak kalah menariknya, sebenarnya semangat yang mendasari berdirinya Alwashliyah adalah semangat keagamaan yang dibungkus dengan etos intelektualitas. Reaksi yang diberikan pelajar Mandailing menghadapi serangan paham keagamaan Muhammadiyah bukanlah dalam bentuk fisik, melainkan dengan debat, mencari argumen-argumen yang kuat dan dapat dipertanggungjawabkan secara ilmiah. Alwashliyah memiliki potensi yang besar untuk dapat mengartikulasikan gerakannya khususnya dalam bidang pendidikan, dakwah dan sosial. Potensi itu terlihat; pertama, Alwashliyah memiliki sekolah-sekolah dari tingkat dasar/madrasah sampai perguruan tinggi seperti Universitas Alwashliyah (UNIVA) dan Universitas Muslim Nusantara Alwashliyah (UMN Alwashliyah) di Sumatera Utara, demikian juga dengan sekolah tinggi di daerah-daerah lain. Kedua, Alwashliyah memiliki ulama-ulama yang menguasai khazanah intelektual Islam klasik. Ketiga, jumlah dai-dai, mubaligh, ustadz yang relatif cukup besar merupakan keunggulan tersendiri bagi Alwashliyah dalam rangka mengkomunikasikan pemikiran keagamaannya. Keempat, Alwashliyah memiliki jamaah atau anggota yang cukup banyak. Alasan berpolitik Kajian tentang motif pengurus organisasi massa terutama organisasi sosial keagamaan telibat dalam dunia

politik praktis didasarkan oleh banyak faktor. Mengutip buku Elit Muhammadiyah dan Kekuasaan Politik, (Jurdi, 2004), bahwa keterlibatan tokoh-tokoh Muhammadiyah pada dunia politik sangat terkait dengan aspek sejarah, dimana para pendiri Muhammadiyah pada mulanya juga merupakan tokohtokoh yang juga ikut terlibat dalam pergerakan kemerdekaan Repubik Indoensia. Kondisi yang sama juga terjadi di Nahdhatul Ulama. Demikian pula berlaku hal serupa di Alwashliyah. Meskipun secara pasti individu bersangkutanlah yang paling tahu tentang motifasinya terlibat dalam politik praktis. Namun untuk mengetahui alasan elit Alwashliyah berpolitik praktis dapat dilakukan dengan mengklasifikasi elit ke dalam kelompok artikulatif yang dibagi atas : 1) Elit yang secara murni mengambil sikap dan pendirian politik sesuai dengan independensi Alwashliyah dengan tidak memasuki wilayah real politics secara langsung. 2) Elit yang mengambil sikap masuk ke partai politik berazaskan nasionalis dan sejenisnya atau bukan partai berazas Islam karena alasan pengembangan dan pembinaan. 3) Elit yang masih memegang prinsip untuk tetap mendukung partai Islam dengan argumentasi bahwa hanya partai Islam-lah yang akan bisa bersama-sama dengan Alwashliyah mewujudkan mayarakat yang islami. Bila memperhatikan klasifikasi di atas, maka terlihat dengan jelas bahwa setiap kelompok tentunya akan memiliki motifasi yang berbeda ketika mereka terlibat dalam dunia politik. Slogan Alwashliyah ada dimana-mana dan tidak kemana-mana, menjadi alasan bagi elit Alwashliyah untuk merdeka memasuki partai politik manapun. Secara sederhana, motif umum yang bisa dilihat dari keterlibatan elit Alwashliyah dalam dunia politik adalah karena alasan : 1) Memperluas wadah atau jaringan untuk memperjuangkan kepentingan umat dan organisasi. 2) Strategi adaptif untuk menghindari benturan kepentingan dengan penguasa. 3) Ekonomi, bahwa dengan terlibat dalam dunia politik maka sumber daya ekonomi pribadinya dan lembaga secara bersamaan akan terbantu, dan alasan-alasan lainnya. Berdasarkan konstitusi organisasi, secara terang dijelaskan bahwa Alwashliyah adalah organisasi independen,, tidak terlibat dalam salah satu partai politik, tidak mendirikan partai politik dan bukan menjadi bagian partai politik. Sikap tersebut adalah rambu organisasi yang harus dipatuhi oleh seluruh anggota dan pengurus Alwashliyah. Maksudnya bahwa secara kelembagaan, Alwashliyah mengambil posisi berada diatas semua kelompok. Dan sebaliknya, apa yang dikemukakan

oleh Arsyad Thalib Lubis adalah sebuah penegasan bahwa wilayah politik bagi para kader secara personal menjadi bagian penting dalam usaha Alwashliyah memperjuangkan cita-cita Islam dan organisasi, tentunya dalam konteks pembinaan umat. Dengan banyaknya kader dan tokoh Alwashliyah yang ikut berpolitik praktis (selajutnya menjadi anggota DPR/DPRD) mengindikasikan bahwa lapangan politik sekaligus menjadi medan da’wah bagi aktifis organisasi dalam mengembangkan organisasi. Menjadi penting bagi elit dan kader Alwashliyah hari ini, khususnya bagi mereka yang secara aktif terlibat dalam partai politik (baik yang sudah menjadi wakil rakyat maupun belum) untuk memahami secara komprehensif pesan Arsyad Thalib Lubis diatas, bahwa peran kader sebagai politisi adalah sarana da’wah organisasi dan keberadaan mereka harus bermanfa’at bagi organisasi dan umat Islam terutama dalam memperjuangkan kepentingan umat secara luas. Para politisi Alwashliyah tidak boleh meninggalkan umat, karena itulah sesungguhnya medan perjuangannya, seperti pesan Tuan Arsyad, bahwa perjuangan lewat partai politik akan kandas jika pembinaan dan pengembangan umat ditinggalkan. Wallahu ‘alam. Penulis adalah Sekretaris Ikatan Alumni Pelajar Alwashliyah Sumut

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Ical: Belum saatnya gaji naik - Padahal harga beras dan cabe mahal lo! * Wagubsu: Negosiasi take over Inalum alot - Tapi jangan pula jadi loyo * Hutan jadi perkebunan, Sumut tak peroleh apapun - Inalum saja pun tak terambil

oel

D Wak

Ekonomi & Bisnis

WASPADA Sabtu 29 Januari 2011

Armin Nasution

Analisis

Redaktur Ekonomi

Kenaikan Harga Beras HINGGA saat ini harga beras sudah sempat menembus level Rp10.000 per kg. Bagi yang biasa mengkonsumsi beras, ini berarti level baru harga tertinggi yang pernah tercapai. Kenaikan harga beras memang sudah terjadi di hampir semua daerah Suamtera Utara. Mulai dari Medan hingga ke daerah tingkat dua. Tidak terawasi sama sekali dan hingga saat ini belum ada solusi. Sebagian pemerintah daerah dan Bulog setempat menggelar operasi pasar beras. Tapi efektivitasnya hingga sekarang belum juga mendapatkan hasil. Kenapa harga beras terus melonjak? Menurut Badan Pusat Statistik (BPS) harga beras internasional pada 2011 bakal melonjak hingga dua kali lipat. Kondisi cuaca yang ekstrim dan pembatasan ekspor beras diperkirakan bakal menjadi pemicu utama. Dua produsen utama beras dunia, Vietnam dan Thailand, sudah mengumumkan niatnya membatasi kegiatan ekspor. Kebijakan itu sebagai antisipasi dari kekhawatiran anomali cuaca yang semakin ekstrim. Harga beras internasional terus melambung. Di Thailand harga beras telah mencapai 500 dolar AS per ton, dan di Vietnam 470 dolar AS. Sedangkan di Amerika Selatan 565 dolar AS, di California 875 dolar AS, dan di Argentina 535 dolar ASper ton. Gejala kenaikan harga ini tentu saja ikut mengguncang ke dalam negeri. Hingga saat ini harga beras pun terus melonjak. Kalau dibiarkan kita malah khawatir harganya akan terus melonjak hingga ke angka yang lebih tinggi. Apalagi di pasar negara yang sedang berkembang seperti India dan China permintaan komoditas seperti beras memang sedang tinggi-tingginya. Jadi wajar kalau kemudian harga beras terus mengalami peningkatan. Data di Barclays menunjukkan jumlah aktiva komoditas yang dikelola hingga akhir tahun mencapai 340 miliar dolar AS. Naik dari awal tahun sebesar 270 miliar dolar AS. Melonjaknya aktiva ini tidak lain karena peningkatan harga yang tinggi. Barclays mengungkap harga komoditas masih sangat tergantung pada permintaan China. Investor akan mengamati tindakan-tindakan pemerintah China dalam menekan inflasi mereka. Dalam sebuah survei yang dilakukan terhadap lebih dari 300 investor institusi,

termasuk hedge fund dan pengelola dana profesional, 69 persen responden mengatakan akan memulai atau meningkatkan eksposur terhadap komoditas selama tiga tahun ke depan. Sekitar 60 persen mengatakan bahwa harga komoditas rata-rata tahunan kembali naik sekitar 6 - 10 persen pada 2011. Kebanyakan investor mengaku mencari komoditas untuk diversifikasi portofolio. Tapi, 36 persen lain mengatakan membeli komoditas untuk keuntungan absolut. Kondisi ini sebenarnya menunjukkan walau fenomena yang terjadi di pasar internasional sangat spekulatif tapi akhirnya warga menengah ke bawah di daerah ini terimbas. Pemerintah tak bisa berbuat apa-apa. Hanya dengan mengimpor beras, kemudian mencoba mengintervensinya dengan operasi pasar walau tidak efektif. Kontra indikasi dengan kejadian yang selalu muncul setiap harga beras mulai naik. Harusnya pemerintah sudah punya prediksi kapan harga beras akan naik. Atau kapan terjadi panen raya. Sehingga lumbung padi yang harusnya dipersiapkan mampu menyangga harga ketika pasok mulai berkurang. Tapi itu tidak dilakukan. Setelah harga naik baru semua berusaha dengan strategi masingmasing. Tiap departemen menyiasati agar harga beras bisa tertahan untuk tidak naik signifikan. Masing-masing berupaya menunjukkan prestasi. Departemen Perdagangan, Pertanian, Perindustrian dan pihak terkait lainnya menginginkan agar harga beras kembali ke level awal. BPS saja sudah memprediksi harga beras akan mendongkrak inflasi. Namun penanganannya tidak maksimal. Bahkan sama sekali tidak ada langkah konkrit jangka panjang yang dipersiapkan mengantisipasi kenaikan harga beras. Antara Januari dan Februari 2011 saja harga beras eceran rata-rata nasional diperkirakan mencapai Rp7.500-7.700 per kg. Jadi wajar saja kalau kemudian harga beras ada yang sampai Rp10 ribu di wilayah tertentu. Faktor yang menyebabkan kenaikan tidak saja di luar negeri. Tapi juga di dalam negeri, karena ada pengaruh perubahan iklim tahun ini. Intensitas kebanjiran dan kekeringan semakin tinggi sehingga risiko pun bertambah. Beras dalam negeri selain dipicu naiknya biaya pokok, juga dipengaruhi meningkatnya harga pangan substitusi.

Bantu Kelancaran Bongkar Muat Barang, XL Tingkatkan Jaringan Di Belawan MEDAN (Waspada): PT XL Axiata, Tbk terus meningkatkan kapasitas jaringannya di Pelabuhan Belawan agar pelaku bisnis bisa melakukan komunikasi dengan lancar. Vice President West Region Agus Simorangkir berbicara dengan wartawan Kamis (27/ 1) siang di Ocean Pacifik Belawan saat melakukan uji jaringan XL di hadapan para pelanggan maupun pelaku bisnis lainnya. Agus Simorangkir menyebutkan, guna mendukung kelancaran berkomunikasi di seputaran Pelabuhan Belawan, XL menempatkan empat BTS (Base Transceiver Station) serta dua Micro BTS. Keenam BTS tersebut, kata

Agus Simorangkir, khusus ditempatkan di area sekitar Pelabuhan Belawan saja. Berdasarkan pemantauan tim network, hasilnya sangat baik hingga mampu menjangkau penduduk diseberang lautan Belawan. Dalam kesempatan uji jaringan ini, tim XL menggunakan perangkat Blackberry serta laptop. Hasilnya cukup menggembirakan, karena dari tiga operator menjadi bahan uji coba, jaringan XL mampu mencapai 3,8 Mpbs menggunakan Blackberry dan 2,7 mb pada penggunaan laptop. Agus Simorangkar juga menyatakan, bulan April mendatang pihaknya akan menambah

sekitar 150 BTS Node B bagi penggunaan 3G untuk wilayah Medan dan sekitarnya. “Sekarang ini kami lagi mengganti seluruh perangkat jaringan dan prosesnya sudah berjalan agar pelanggan tidak lagi mengalami kendala dalam berkomunikasi”, jelasnya. Menjawab pertanyaan pelanggan tentang kesiapan XL tentang generasi terbaru GSM yaitu 4G, disebutkannya, pihaknya di Jakarta sudah melakukan uji coba termasuk penggunaan LTE (Long Term Evolution. “Sekarang ini pemerintah lagi melakukan tender pita frekuensinya, jadi belum bisa digunakan pelanggan,” tandasnya.(m19)

126,26 persen dan deflasi terjadi di Sorong 1,30 persen dengan IHK 144,73 persen. Dinar mengatakan, beberapa komoditas mengalami kenaikan harga selama bulan desember 2010 di Kota Sibolga antara lain, cabai merah, beras, ketupat/lontong sayur, tongkol, kelapa, kontrak rumah, emas perhiasan, kue kering berminyak, kaos oblong, cabai rawit, es, kentang, pecal, kembung/ gembung,bumbu masak jadi, semen, biskuit, upah pembantu RT, cabai hijau, ayam goreng, dencis, gembolo, bawang merah, udang basah, buncis, susu untuk tulang manula, pembersih penyegar, pembalut wanita, handuk, sampho, ikan mas, minyak goring, kembang kol, kacang tanah, tauge, obat luka, vitamin, semir sepatu, ikan palu-palu, ikan dalam kaleng, obat gosok, deodorant dan obat flu. Sementara yang mengalami penurunan harga antara lain teter, cumi-cumi, telur ayam ras, ketimun, teri, sabun detergent bubuk dan wortel. Menyangkut kenaikan harga beras di Kota Sibolga terjadi perbedaan dan tanggapan beragam dari peserta diantaranya kansilog bulog dana siregar mengakui 22-30 desember 2010 pihaknya sudah menyalurkan beras jenis medium sebanyak 80 ton, sedangkan untuk Januari

BATU MAMAK, ASAHAN (Waspada): PT PLN (Persero) menargetkan penyelesaian pembangunan proyek Pusat Listrik Tenaga Air (PLTA) Asahan 3 pada tahun 2013 dengan kapasitas terpasang 2 x 87 MW. Dengan selesainya pengerjaan proyek tersebut hal ini akan menurunkan angka krisis listrik bahkan memenuhi kebutuhan listrik Sumatera Utara pada dua tahun mendatang. Direktur Utama PT PLN (Persero) Dahlan Iskan, di Batu Mamak, Asahan, Jumat (28/1) menyatakan pihaknya akan terus memantau dan menargetkan bahkan siap jika ada perusahaan yang dibelakang hari melakukan penuntutan. “Ada lima perusahaan sebagai rekanan yang saat ini siap menyukseskan pembangunan Asahan III dalam waktu 15 bulan terhitung sejak penandatanganan kerjasama dan kami yakin mereka akan mampu menyelesaikannya,” ujarnya. Hal tersebut, lanjutnya, dikarenakan pihaknya benarbenar melakukan penyeleksian terhadap para pemenang tender dalam penyuksesan pembangunan PLTA Asahan 3.

“Baik didalam finansial, profesionalisme, dan managejemen perusahaan rekanan ini sepertinya mereka siap dan sesuai dengan prosedural yang telah ditetapkan oleh PLN,” lanjutnya. Sementara adanya izin pembangunan yang dipegang perusahaan swasta, Dahlan Iskan siap menerima tuntutan dibelakang hari, hal ini menurutnya sesuai dengan keputusan presiden (Keppres). “Jadi tidak ada alasan akan membangun, yang pastinya dibangun dan pada hari ini kita melakukan peletakan batu pertama disaksikan oleh dua kepala daerah baik Bupati Asahan yang diwakiliWabup Surya, dan Bupati Toba Samosir Kasmin Simanjuntak,” ujarnya kembali. Sementara pada pembangunan proyek pusat listrik tenaga air (PLTA) Asahan 3 kapasitas terpasang 2 x 87 MW mulai dikerjakan. Pembangu-

nan PLTA yang terletak di Kabupaten Asahan dan Kabupaten Tobasa Sumatera Utara ini ditandai dengan peletakkan batu pertama (ground breaking) pembangunan akses jalan (access road) dan base came oleh Dirut PT PLN (Persero) Dahlan Iskan, Jumat (28/1) di Dusun Batu Mamak, Asahan. Pembangunan access road dan base camp merupakan tahap awal dari rangkaian panjang pengerjaan proyek PLTA Asahan 3. Terkait proyek ini, jauh sebelumnya pada pekan pertama bulan Juni tahun lalu. Dirut PLN, Dahlan Iskan telah menandatangani contract agreement dengan Nippon Koei, Ltd untuk engineering services pembangunan proyek PLTA Asahan 3. Nippon Koei bekerjasama dengan konsultan dalam negeri, diantaranya PT Connusa Energindo, PT Kwarsa Hexagon, PT Arkonin Engineering Manggala Pratama, PT Tata Guna Patria, dan PT Jaya CM. Untuk membiayai proyek ini, PLN telah mendapatkan jaminan pinjaman dari investor sehingga diperlukan upaya percepatan untuk segera membangun PLTA

bulan ini 85 ton beras. Walikota Sibolga Drs HM Syarfi Hutauruk dalam kesempatan itu mengakui, inflasi pada bulan Oktober 2010 Kota Sibolga masih di bawah rata-rata nasional, sementara pendapatan masyarakat hanya dari perikanan dimana akhir-akhir ini tingkat pendapatan menurun karena nelayan tidak menentu melaut akibat cuaca. Walikota menekankan agar segera dilakukan efektivitas untuk menekan tingginya angka inflasi di kota Sibolga dan secara bersama-sama dengan tim pengendalian inflasi daerah Kota Sibolga melakukan koordinasi sekali dalam sebulan guna memantau harga-harga komoditas di pasaran. Walikota juga menekankan agar PMK dan Bulog untuk melakukan gebrakan menurunkan harga beras dengan segera menyalurkan raskin Januari ini, termasuk operasi pasar. (a34)

London Murni

“Dengan peran strategis seperti itu, PLN sangat mengharapkan dukungan dari semua pihak khususnya pemerintah daerah propinsi Sunatera utara beserta seluruh jajarannya agar pengerjakan proyek PLTA Asahan 3 dapat berjalan sesuai rencana yang telah ditetapkan,” kata dia. Sehingga nantinya dengan kapasitas terpasang 2 x 87 MW, PLTA Asahan 3 dapat memberikan kontribusi yang signifikan bagi system kelistrikan di wilayah Sumatera Utara. Dengan semakin membaiknya system kelistrikan di Sumatera utara, maka akan dapat memberikan dampak positif pada terciptanya iklim usaha yang lebih baik, sekaligus mampu mempercepast pertumbuhan ekonomi masyarkat Sumatera Utara. Hadir pada peresmian tersebutWakil Bupati Asahan Surya, Bupati Toba Samosir, Kasmin Simanjuntak, GM Pikitring Suar Bintatar Hutabarat, Pembangkit Sumatera Utara, Ikuten Sinulingga, GM Wilayah Sumatera Utara, Krishna Simbaputra, dan pejabat PLN lainnya. (m38)

MEDAN (Waspada): Arus kunjungan kapal pelayaran luar negeri dari dan ke Pelabuhan Dumai selama tahun 2010 meningkat mencapai 1.889 call, dibandingkan tahun sebelumnya hanya 1.796 call. Humas Pelabuhan Dumai Harlen Susanto Purba menjelaskan, Kamis (27/1), arus kunjungan kapal untuk pelayaran luar negeri selama tahun 2010 mengalami kenaikan sebanyak 93 call dibanding selama tahun 2009. Data di PT Pelabuhan Indonesia I Cabang Dumai menunjukkan, dari 1.889 call arus kunjungan kapal tersebut 995 call adalah kapal nasional yang berarti, “kapal nasional untuk pelayaran luar negeri meningkat di banding tahun sebelumnya karena tahun 2009 arus kunjungan kapal nasional untuk pelayaran luar negeri dari dan ke Pelabuhan Dumai hanya 852 call, jelas Harlen. Perkembangan menggembirakan ini, jelas humas, juga terlihat pada kunjungan kapal asing untuk pelayaran luar negeri rute tramper (tidak tetap) tahun 2009 hanya 487 call maka pada tahun 2010 menjadi 513 call. Dari Trend negatif untuk pelayaran luar negeri hanya di tunjukkan kunjungan kapal liner (tetap) dengan jumlah 513 call dari 487 call tahun sebelumnya.(m35) Waspada/Bustami Chie Pit

BUAH IMPOR: Buah impor dari China dan Amerika banjiri pasar buah Jl.Tengku Umar kota Kisaran, Asahan. Buah seperti jeruk, pir, anggur, buah naga, dan apel. Buah impor ini diyakini lebih tahan dari buah lokal, Jumat(28/1).

Jelang Perayaan Imlek Buah Impor Diburu Pembeli KISARAN (Waspada): Jelang perayaan Imlek 2562/2011 yang jatuh pada, Kamis (3/2). Buah impor seperti jeruk, pir, anggur, apel dari China dan Amerika banyak diburu pembeli. Selain untuk parsel kepada rekanan atau kerabat keluarga, buah-buahan juga digunakan untuk sembahyang pada perayaan imlek di altar sembahyang pada klenteng/vihara. Buah impor lebih diburu karena lebih tahan dibandingkan produk lokal, ujar pedagang Br.Siahaan dijumpai Waspada di Jalan Tengku Umar kota Kisaran, Kabupaten Asahan. Buah-buahan impor juga

dijual secara door to door atau pada acara arisan ibu-ibu oleh ibu rumah tangga yang ingin menambah income tambahan pada perayaan tahunan ini. Pantauan Waspada buah impor seperti jeruk shantang super dijual berkisar Rp22.000/kg, jeruk ponkam Rp11.000/kg, jeruk shantang biasa Rp13.000/ kg, pir xian lie Rp24.000/kg, pir century Rp20.000/kg. Apel fuji besar Rp30.000/kg, apel merah Rp22.000/kg, apel fuji kecil Rp18.000/kg, dan apel fuji sonmoon Rp35.000/kg, buah naga Rp25.000/kg, Selain itu buah lainnya anggur merah dihargai Rp50.000/

BIREUEN (Waspada): Harga beras di pasar tradisional kian melambung. Sementara lokasi operasi pasar murah beras Dolog Lhokseumawe sebanyak 10 ton di Bireuen hingga Rabu (26/ 1) tak jelas dan tidak dibuka di lokasi yang mudah diketahui masyarakat. Masyarakat ekonomi lemah amat kecewa sistem operasi pasar beras di Bireuen yang dilakukan Dolog Lhokseumawe tidak memberi informasi dan membuka lokasi operasi pasar terbuka seperti yang sudah lazim dilaksanakan Disperindag setempat sebelumnya. Sumber Waspada di Perindagkop Bireuen Rabu (26/1) mengaku tidak megetahui program operasi pasar beras dilakukan Dolog Lhokseumawe, lantaran belum diberitahu. Kabag Humas Serdakab Bireuen Darwansyah ketika dikonfirmasi di kantor juga mengaku tidak mengetahui adanya operasi pasar beras di Bireuen. Darwansyah langsung mengecek soal OP beras Dolog di Bireuen ditangani Kabag Ekonomi Setdakab setempat.

Ironisnya, operasi pasar beras Dolog di Bireuen terkesan informasi dan lokasi oeperasi pasar tertutup amat mengecewakan masyarakat miskin untuk dapat membeli beras Dolog yang harganya jauh lebih murah dibanding harga beras di pasar tradisonal saat ini makin melambung tidak terjangkau masyarakat miskin. Camat Kota Juang Dahlan, SE yang dikonfirmasi di kantornya juga mengaku tidak mengetahui adanya operasi pasar beras Dolog di Bireuen. Sebaiknya pihak Dolog memberi tahu camat agar menentukan lokasi strategis di kota Bireuen, sehingga masyarakat miskin dapat membeli beras Dolog yang lebih murah. Pantauan Waspada, operasi pasar dilakukan Dolog Lhokseumawe Rabu (26/1) dilakukan dalam sebuah truk tertutup yang diparkir di depan RSU Dr Fauziah tidak dilakukan secara terbuka di suatu lokasi lebih tepat. Lantaran tidak adanya kordinasi dengan Camat Kota Juang pelaksanaan operasi pasar beras Dolog tidak menyen-

Harga Emas Di Medan Jenis

tersebut. Dahlan melanjutkan, memperkirakan dengan tingkat pertumbuhan ekonomi yang relatif tinggi hal ini mempengaruhi pertumbuhan permintaan listrik di Sumtera Utara sehingga kehadiran PLTA Asahan 3 sangat relevan sebagai solusi masalah kelistrikan di Sumatera Utara, sehingga kebutuhan pasokan listrik di masa mendatang dapat tercukupi dengan baik. “Saat ini, sistem kelistrikan Sumatera Bagian Utara dipasok dari sejumlah pembangkit dengan daya mampu sekitar 1.517 MW dan beban puncak (peak load) sekitar 1.365 MW. Dengan cadangan daya yang terbatas, diperkirakan tidak bisa mengejar tingkat pertumbuhan listrik yang cukup tinggi sehingga diperlukan tambahan pembangkit listrik baru,” ujarnya. Bagi PLN, lanjutnya, PLTA Asahan 3 ini memberikan kontribusi yang signifikan didalam efisiensi menekan biaya pokok produksi listrik, mengingat listrik yang dihasilkan dari PLTA memiliki biaya produksi yang jauh lebih rendah dari jenis pembangkit lainnya.

Kunjungan Kapal Ke Pelabuhan Dumai Naik

kg, anggur hijau Rp60.000/kg, dan anggur hitam Rp70.000/kg. Pir shandong Rp14.000/kg, pir anjau Rp33.000/kg, pir singo Rp30.000/kg. Lim Siang Mi, 42, salah seorang ibu rumah tangga kepada Waspada mengatakan setiap perayaan imlek dapat menambah penghasilan sampai jutaan. Karena sudah banyak relasi memesan padanya dalam bentuk kotak-kotak dikemas dalam ukuran 3 kg/kotak dan 5kg/ kotak. Ami mengaku mendatangkan buah-buahan tersebut dari distributor di Medan. (a36)

Beras Di Bireuen Makin Melambung

Desember, Sibolga Inflasi 2,94 Persen SIBOLGA (Waspada) : Selama Bulan Desember 2010, Sibolga inflasi sebesar 2,94 persen terjadi kenaikan indeks harga konsumen dari 127,53 pada bulan November 2010 menjadi 131,28 pada bulan Desember. Inflasi terjadi adanya kenaikan harga ditunjukkan oleh naiknya indeks harga konsumen pada kelompok bahan makanan 6,56 persen yakni kelompok makanan jadi antara lain rokok dan tembakau 2,75 persen, perumahan, air, listrik, gas dan bahan bakar 0,65 persen, sandang 1,58 persen, kesehatan 0,22 persen serta kelompok pendidikan, rekreasi dan olahraga 0,22 persen. Hal itu dipaparkan Kepala BPS Sibolga Dinar Butar-butar pada High Level Meeting 1 2011 bersama tim pengendalian inflasi daerah Kota Sibolga yang dihadiri Walikota Sibolga Drs HM Syarfi Hutauruk, Kepala BI Sibolga Muhammad Noer dan para SKPD Pemko Sibolga diaula kantor BI Sibolga, pekan lalu. Dijelaskan Dinar, Desember 2010 dari 66 kota diamati Indeks harga konsumennya (IHK) di Indonesia, 65 Kota mengalami deflasi, sedangkan inflasi tertinggi terjadi di Lhokseumawe 2,97 persen dengan IHK 128,44 persen dan terendah di Singkawang 0,11 persen dengan IHK

B9 PLN Targetkan Asahan 3 Selesai 2013

Kadar 99%

Valuta Asing Di Medan

Harga Rp403.000

London

97%

Rp371.000

24 Karat

90 s/d 93%

Rp350.000

Emas Putih

75 %

Rp310.000

22 Karat

70%

Rp281.000

Suasa

20 s/d 35%

Rp180.000

tuh harapan masyarakat, bahkan masyarakat kecewa tidak tahu di mana Dolog melakukan operasi pasar. Hajidin, salah seorang pedagang kebutuhan bahan pokok di pasar Sabtu yang dikonfirmasi mengatakan, harga beras makin melonjak, beras lokal IR64 kualitas nomor satu cap panah dan cap UB sudah tembus Rp140 ribu per zak ukuran 15 kg. Beras olak kualitas nomor dua Rp123 ribu per zak ukuran 15 kg, beras lokal kualitas nomor tiga Rp120 rbu per zak ukuran 15 kg dan Dolog impor Thailand Rp8 ribu per kg atau Rp13 ribu per bambu. Dikatakan, selama melonjak harga beras warga kurang mampu membeli beras Dolog impor Thailand secara ceren satu bambu dan ada juga setengah bambu. Sementara harga bahan kebutuhan pokok lainnya, telur ayam masih bertahan Rp29 ribu per papan (30 butir), migor Rp11 ribu per kg, gula pasir Rp11 ribu per kg, beras pulut putih lokal Rp14 ribu perbambu dan beras pulut lokal hitam Rp15 ribu per bambu. (b16)

(m40)

Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.140 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.890 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800

Pelindo I Investasi Rp1.993 T MEDAN (Waspada): Komisaris Utama (Komut) PT Pelabuhan Indonesia I Hastjarja Harijogi dalam sambutannya pada pembukaan Rapat Kerja, Rabu (26/1) mengharapkan agar Pelindo I bekerja lebih keras dalam merealisasikan investasi 2011. Untuk mendukung itu BUMN pengelola seluruh pelabuhan di kawasan Sumbagut akan melakukan investasi sebesar Rp1,993 T. Kepada peserta Raker dihadiri anggota komisaris, dewan direksi Pelindo I, pejabat struktural, pimpinan pelabuhan di Aceh, Sumut, Riau dan Kepulauan Riau, Komut menegas-kan investasi 2011 ini harus diimplementasikan secara maksimal. Karena tantangan ke depan semakin besar, ‘’Pelindo I harus siap menyambut tantangan-tantangan tersebut.” Harijogi juga mengingatkan walaupun Pelindo I adalah perusahaan diamanatkan negara dan mempunyai tugas public service, namun Pelindo I juga harus berusaha untuk meraih keuntungan sebesar-besarnya. “Pelindo I harus berinovasi dan berani melakukan berbagai terobosan yang unsual untuk menciptakan peluang-peluang bisnis baru,” ungkapnya. Direktur Utama Harry Sutanto dalam sambutannya mengingatkan Pelindo I akan berhadapan dengan kompetisi tinggi. “Pasca penerapan UU Nomor 17 tahun 2008 tentang Pelayaran sehingga memungkinkan munculnya banyak badan usaha yang bergerak di pelabuhan. Hal ini menjadi warning pagi Pelindo I untuk meningkatkan pelayanan dan mengutamakan Customer Service,” jelasnya. Menurut Harry tahun ini, Pelindo I akan melakukan transformasi bisnis perusahaan yang meliputi pengembangan organisasi dan SDM, inovasi dan efisiensi pelayanan, penguatan infrastruktur dan peralatan serta pengembangan logistik. “Walaupun Pelindo I telah menerima berbagai penghargaan pada tahun 2010, pada tahun 2011 kita harus melakukan kerja extra ordinary untuk mencapai target laba 278 M pada tahun 2011. Rapatkan barisan dan kuatkan tekad untuk menyambut masa depan,” tegasnya. Humas M Taufik Fadillah menjelaskan PT Pelabuhan Indonesia I (Persero) I menggelar Rapat Kerja (Raker) 2011 pada 26-27 Januari 2011 di Kantor Pusat Jl. Krakatau Ujung 100 Medan. Raker ini menduhului Pe-lindo yang lain (Pelindo II, III dan IV) dan mengusung tema “Change to Grow Based on Integrity, Teamwork and Innovation”. Pemilihan tema ini sesuai dengan semangat sedang dikobarkan di tahun 2011 ini pada setiap pegawai agar siap menghadapi persaingan dalam bisnis kepelabuhanan. Raker tahun ini diseleng-garakan secara sederhana namun di-design untuk fokus mengempowerment sumber daya di Pelindo I. Jadi tidak mengundang pihak eksternal sebagai pembicara dan juga tidak ada acara-acara tambahan. Fokus raker kali ini untuk mengevaluasi dan merumuskan kebijakan perusahaan dalam mencapai target tahun 2011 karena ditahun ini banyak kerja besar harus diselesaikan. Untuk itu, dibentuk pokja-pokja (kelompok kerja) yang membahas isu strategis perusahaan antara lain tentang investasi, pengembangan usaha, human capital, dan permasalahan hukum. (m35)

Harga Berbagai Jenis Bahan Pokok Cabai rawit Cabai merah Cabai hijau Tomat Kentang Wortel Kol

Rp40 ribu Rp35 ribu Rp18 ribu Rp6000 Rp7000 Rp4000 Rp2000

per kg per kg per kg per kg per kg per kg per kg

Harga Beras: KKB Ramos Jongkong IR 64 Beras Kita Bulog OP Gula Putih Minyak goring Tepung Trigu

Rp8000 Rp9500 Rp7300 Rp7500 Rp7400 Rp6170 Rp11 ribu Rp11 ribu Rp7000

per kg per kg per kg per kg per kg per kg per kg per kg per kg

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000

WASPADA 3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318i tahun 90. Warna putih BK Medan asli (Panjang). Lengkap. Mulus, body kaleng. Mesin sehat. Harga 32Juta. Hub. 0878 6912 2651 DAIHATSU Taruna CSX Thn. 2004, Warna hitam. Metalik. BK Medan asli, orisinil. Lengkap. Harga Nego. Hub. 0821 6567 4881 - 061.7765 3444

DAIHATSU Hiline 1998 Dijual. Orisinil. Siap pakai. Hub. 0813 9734 3498

TROOPER Thn. 88. Warna hitam abu. 5 pintu long 4x4. AC, Tape, VR, BR, P. Steering, PW, 5 Speed. Jok kulit. Rp. 40 Juta/Nego. 0812 6578 790 - 77788647

DAIHATSU Taft GTS Thn. 88. Biru, AC, Tape, VR, PS, Siap pakai. Telp. 0852 6108 9110 DAIHATSU Espass tahun 98 Dijual BU. W. Merah hati metalic, AC, VR, BR, Rolling Door. Kondisi sangat mulus. Hub. (0821 6604 1073) DAIHATSU 100% BARU PAKET MURAH...!!

Xenia Li....DP 12 Jt-an......Angs. 3 Jt-an Terios........DP 14Jt-an.......Angs 4 Jt-an Luxio.........DP 9 Jt-an........Angs 4 Jt-an Hub. JOSUA - 061.77004944 / 0812 6311 0820

HONDA Accord Maestro Th. 91 W. Htm. Mulus, siap pakai 38Jt Nego. BR, Velg Racing, AC, Tape, 0812 6328 0528 HONDA Jazz IDSI A/T. Th. ‘05, Wrn Merah, Balik DP 25 Jt. Sudah Byr 5 kali. Per bln Rp. 3.720.000. Mobil ctk sekali. sdh lapis sarung merah, asuransi All Risk. Kembar Ponsel. Jl. SM. Raja No. 200 (Depan UISU). 0812 6038 5555 / 785 1402

ISUZU Panther LDX Coklat Metalik. P. Steering, P. Window, 4 Pintu. BK Asli Medan. BK Panjang, Tape, Accesories, Remote Alarm, Cantik luar Dalam. Mulus Bang. Harga 45Jt/Nego Hub. 0812 6568 818 / 77305875

ISUZU Panther LDX Thn. 91 (Diesel) Hrg. 39 Jt Hub. 0852 5485 9636 DIJUAL SALAH SATU 1. Isuzu Panther Challenger thn. 94. RS AC, DB, PW, Remot. H. Rp. 45Juta Nego. 2. Isuzu Panther Miyabi thn. 93/94. PS, AC, Alarm, Remot, H. 45Jt Nego. 3. Isuzu Panther LDX Thn. 92. PS, AC, Remot. Alarm. H. Rp. 40 Jt. Mobil cantik, mulus. Hub. Ibu Hj. Mualimah Telp. 061-7624 7369 - 0852 9641 9220 (maaf + sms TP)

ISUZU Panther Box Th. ‘04, Box cantik Rp. 75 Jt. Colt Diesel PS 100 4 Roda Th. 04. Rp. 134 Jt. Hub. 0813 9682 8808

GRANDIA ‘02. Merah, Solar, Lengkap Rp. 106.000.000/ Nego. HP. 0812 6358 1395 - 0815 3004 395 MITSUBISHI Kuda Grandia 2002, Diesel warna hitam, BK Medan asli, AC, VR, lengkap, mulus. Harga 108juta nego. Hub. 0812 6447 8688 MITSUBISHI Colt Diesel Th. 05, 6 Roda. PS 120. Ban Baru, Bak tinggi, siap kerja Rp. 153Jt. Hub. (061) 7851 402

5 CM 6 CM

Rp. 65.000 Rp. 78.000

MITSUBISHI L300 Minibus Sparta Dijual. Thn. 2005. Warna biru, siap pakai. Hub. 0813 6233 0005, 061.75400167 MITSUBISHI Eterna 90. BK Asli Medan. Kondisi mulus original. Hub. 0815 3374 8820

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA Kijang Kapsul LX Thn. 97 (Bensin). Silcer metalik Hrg. 81 Jt. Hub. 0821 6056 4141

OPEL Blazer LT DOHC Thn. 01 Warna biru Silver Hrg. 68Jt. Hub. 0812 6542 4866

!! TOYOTA 100% BARU !!

OPEL Blazer Thn. 96 Dijual. Warna silver, DOHC, AC, Tape, Compact Disc. PW, satu nama dari baru, mobil siap pakai. Harga Nego. Hub. 0813 7066 7070

TOYOTA Kijang LGX, DSL ‘00. Htm, AC DB, VR, BR, Jok Klt. Rp. 26Jt. Angs: 3,59Jt (langsung BW Plg). Toyota Soluna XLI ‘02, BK Medan asli, silver, AC, RT, VR, BR (baru), DP 16Jt. Angs: 2,23Jt. Hub. 061.76700 976

SUZUKI Sidekick Thn. 96, warna biru tua met, AC, CD, VR, BR, CL, Asli Medan, Kondisi bagus. Hub. 0812 6338 789 - 77603984

TOYOTA Corolla DX Thn. 81. Warna biru, mulus. Hub. 061-77763162

SUZUKI Katana ‘95 Dijual. W. Ungu. Body mulus. Harga Nego. Hub. 0812 6014 791 SUZUKI Cary th. 85/86 Dijual. W. Biru, Alexander, kondisi sangat mulus. Rp. 13,5Juta (Nego). Hub. 0813 9642 3289

TOYOTA SE Salon Thn. 86. W. Silver. BK Panjang, Des, mulus. BU. Hub. 0816 3177 984 - 77967599

SUZUKI Side Kick Drag One Thn. 97, ungu tua met, BK Mdn Rp. 77Jt. Hub. 0812 6594 2789 SUZUKI Carry Extra (Adi Putro) 87/ 88. Sehat/Mulus/VR/BR/Tape (Merah Dunhill). Hub. 061-7772.1957 / 0852 6215 9494 (TP)

SUZUKI Minibus extra 1987/88 lampu petak extra, w. hitam metalic, tape, jok kulit oscar asli baru, reben necle tranparan baru, velac racing, belimbing, ban baru, Hub. Acuan Jl. Kirana 17 bisa tukar tambah, mobil sangat mulus & terawat, tinggal pakai saja. Cash Credit. 77159251 - 0811 635 101

SUZUKI Katana GX Power Steering 1997 w ungu metallic, ac, Tape Kenwood, body originil, hub. Acuan Kirana 17 bisa tukar tambah, cash credit. 77159251 0811635101 mobil terawat, tinggal pakai, sehat, mulus, tgn. 1 SUZUKI Katana GX Thn. 1998. AC, Teve, PR, PWS. Hijau metalic. Nego. Rp. 51 Jt Nego. Suzuki Futura MB Real Van Thn. 1994, Rp. 41 Jt Nego. Suzuki Futura Pick Up 2001 Rp. 41 Jt Nego Hub. 0812 6345 8099

TOYOTA Innova E Plus Th. ‘08, Solar, wrn hitam, mobil ctk sekali, Bln. 7 1 tangan dari baru, Plat BB, Rp. 179Jt. Kembar Ponsel Jl. SM. Raja No. 200 (depan UISU). 0857 6097 8888 / 7851 402 TOYOTA Kijang Kapsul New 1,8 EFI Pemakaian 2004 Tangan pertama, W. Silver, Pjk baru, ban baru, remot, komplit, AC DB, Tape, CD, VR, BR, PS, CL, Mulus, original luar dalam. BU. Hub. HP. 0812 6021 2106 Mdn. Toyota Avanza Type-S VVTi Hitam 2008 Toyota Avanza Tyoe-G VVTi Hitam 2006 Toyota Kijang Krista Diesel Hitam 2003 Toyota Kijang LGX Diesel Hijau Tua 2003 Toyota Kijang LGX Bensin Silver 2003 Toyota Kijang LSX Diesel Abu-abu 1997 Toyota Kijang Grand Extra Hijau 1993 Suzuki Carry Aduputro 1.3 Abu-abu 1996 Daihatsu Zebra Escada 1.3 Merah 1995 Cash - Credit - Tukar Tambah Jl. Mustafa Depan Gudang Bulog Telp. (061-6624884 / 061-30089303)

# TOYOTA BARU # Ready Avanza, Altis DP 58 Jt-an. Yaris DP 22 Jt an. Innova DP 34 Jt-an. Fortuner DP 61 Jt-an. Hub. FERY 0852 6113 7592 atau 7781 6673

TOYOTA Twincam Liftback Th. 89. W. biru met. BK Mdn AC, Tape, BR, Velg Racing 35Jt. 0812 632 80528 TOYOTA Great Corolla Thn. 94, Biru Muda Met, AC, CD, Pwr, EM, PWS, CTL, Asli Medan. Kondisi bagus. Hub. 0812 650 77009

TOYOTA BARU Innova, Fortuner, Yaris, Vios, Altis, Camry, Rush, Avanza. Hub. 0813 7043 7766

9 CM Rp. 126.000 10 CM Rp. 140.000

TOYOTA Kijang Commando Thn. 91 Akhir. Warna Biru mett, AC, TP, VR, BR, BK Asli Medan, mulus, siap pakai. Harga Rp. 49Jt/ Nego. Hub. 6625188 / 0813 6214 8312

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + BUNGA RINGAN. Hub. 0813 7512 7297 - (061) 7795 1428

TIMOR Sedan Thn. 97. W. biru met, AC, VR, DVD Power, Body kaleng, luar dalam. Mulus sekali. Hrg. 40Jt/Nego. Jl. Gaperta Ujung Komplek Tata Alam Asri. Bakti Indah VII No. 111. HP. 0813 9710 8282

VW Combi Brazil Dijual. Warna biru tahun 1982, Siap pakai. Hub. 06176294338 Jl. Karya Wisata Ujung Door Smeer Jasa Prima. Harga Nego.

BURSA

BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0816.314.1807

0

DANA Th. 75 - 2010 MOBIL + Sp. MOTOR % D. TRUCK + TRONTON, BM: KILAT T.OVER: SHM + SKC + DP & KTA BPKB Mr. JG.0813 7548 5990, 777 90 557 BUTUH UANG KONTAN CAIR 3 HARI

(SETELAH SURVEY USAHA DAN JAMINAN) - SK CAMAT 10JT S/D 100JT - SHM 100JT S/D MILIAR - TAKE OVER 500JT KE BAWAH HUB. 0812 643 7095

BURSA

SEPEDA MOTOR

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

TURUT BERDUKA CITA

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

NURLELI

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

BARU “HARGA” SPECIAL -

PANASONIC - LG MITSUBISHI - AUX SAMSUNG - DAST GENERAL - FUJI CHANGHONG - DAIKIN SHARP PLASMA CLUSTER

SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk

TOKO SUPER ELECTRONIC Simp. Gandho

TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

TV LCD, PS, DVD, AMPLI, COMPO

TV LED Samsung 32”= 4,4Jt, LCD LG 32”=3,4 jt. 42” LCD TOSHIBA P : 2,5JT 29” Flat Baru LG= 2,1Jt, 29” Bekas 1Jt1,7Jt, 14-21=300rb- 650rb,17” LCD Monitor 1 Jt, 22”=1,5Jt,PS1=400rb, PS2=800rb- DVD Cina 200rb, H. Teater LG 950rb. Compo DVD AIWA - PMPO 10.000. PSP 60 = 1,2Jt. Ampli/Mixer/Spk, BMB, Kenwood, Black Speder, dll.

PROJECTOR HANDICAM, CAMERA, FAX, PROJECTOR Handicam Sony Hi-8 = 1 Jt. P. Sonic DVD=3jt. Mini DV= 2jt. Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax, Printer= 600rb Projector LCD= 3Jt.

AC, KULKAS, M. CUCI, STABILIZER, GENSET Jual AC Bermacam Merek 1/2, 3/4, 1,1 1/2, 2Pk-1,3Jt2 Jt. Kulkas 1 Pt - 2 Pt=600rb- 1,2Jt. 2 Pt -Jumbo - 2 Jt. Prejer 5 rak = 1,2Jt, 6 rak SOCES 1,8Jt. M. Cuci 1 Tb2 Tb= 600rb- 1,2 Jt. M. Cuci Baru= 2,2 Jt (1 tb 9 kg). Genset 3000 w. 2,5Jt. Stabilizer 3000 watt, 10.000 Watt Hub. UD. SENANG HATI: 4517509 - 6967449 Jl. Sekip 67 A (Jual & Beli) Cash/Credit

JUAL DAN BELI TV, LCD, Kulkas, M. Cuci, Handycam, DSLR, Laptop, LCD Projector, Laptop, PS 1, 2, 3, H. Theater, Sound System, dll. Hub. CV. MARKET, Telp. 7632 4682 - 0812 65393000 S. Budi T. Sari No. 424 B Psr. IV Dkt BNI

BURSA

ALAT MUSIK

ELEKTRONIK Cuci AC, Isi Freon, Bongkar Psg, AC Tambah Freon, Perbaikan, Spare parts. AC - KULKAS - MSN CUCI Hub.06177972065 / 0813 6149 7921

CUCI + B. PASANG

KULKAS, DISPENSER, M. CUCI HUB. MAJU TEKNIK Tel. 7030118, Flexi 76750084 SERVICE BERGARANSI Cuci AC/Tambah Obat Bongkar Pasang

HP. 0813 7536 4412 7767 7220

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757- 0812 1671 84742 Siap Ketempat

SERVICE REPARASI, CUCI AC, B. PASANG

AC

AC

AC

Servis Kulkas, M. Cuci. Hub. MANDIRI TEKNIK 061-7676 4660 0812 6557 521

SINAR TEKNIK

SERVICE/REPARASI : AC - KULKAS - M. CUCI

HUB: 0857 6078 7441061.69678231

BARU 100% / GARANSI

Murah hanya Rp. 2090.000 + Pipa + Breket. (Stock Terbatas) NB: Bersedia Bongkar Pasang, Service, dll. Hub. TOKO SUMATERA JAYA G. Subroto 401 Medan Tel. 061-4143670 / 061.77555550 AHLI Toshiba, Sony, polytron & Segala

Merek TV, Siap ditempat. Garansi

MASTER TV RIDWAN 0812 6303 4400 77621674 JAYA TV 0813 7071 3504

KARYA SERVICE Service: AC, Kulkas, M. Cuci, TV, PABX, CCTV, B. Pasang. Jual AC Bekas, Bergaransi. Hub. 061-77913537, 0813 7553 3375

BURSA

KOMPUTER

Ingin Promosikan Produk Anda Harian

PROMO KOMPUTER BARU

Intel P4 + LCD (Mon 17 + Printer warna) 2,3Jt 512/80/DVD/DRW/Garansi Full/Siap Pakai. Hub. WINNIE COMPUTER Telp. 4538243 Jl. Nibung II No. 72 Medan, Telp. 4576780

GREAT SALE LAPTOP MURAH TERDAHSYAT 2010

WASPADA

JANUARY WONDERFULL TOSHIBA, ACER, HP, SUZUKI, IBM, Merk Terkenal, Kwalitas oke, Desain Mantap, Tahan Lama, Terjamin & Digaransi. Dapatkan barangnya skrg juga, banjir Bonus & Haidah. Utk Pembelian Hari ini tanpa syarat Hubungi dan Miliki segera di:

4151359

* * * * * * *

Millenium Plaza Aksara Plaza Siantar Plaza Binjai Supermall Medan Plaza Millenium Plaza Merak Jingga

USD 2.300 USD 2.600 USD 2.800

NB: untuk perubahan type kamar menjadi : Triple menambah USD 50 Double menambah USD 100 AKOMODASI HOTEL BERBINTANG HOTEL MADINAH: DALLAH TAIBA, Setaraf ***** HOTEL MAKKAH : JAWHARAT ANFAL, AL BUSTAN, Setaraf **** HOTEL JEDDAH : AL AZHAR ***** Harga Ekonomis Fasilitas Paket Bisnis

Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis OFFICE: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061- 7326981, 0811647795 Fax. 061-7326981

: : : : : : :

0852 0813 0813 0813 0812 0812 7643

1090 9742 9650 7078 6498 8882 2047

2

BURSA

HILANG/TERCECER HILANG/TERCECER 1 (Satu) Berkas Surat2 Tanah a/n. JURAN ARITONANG. Akte Penjualan dan Pembelian No. 4 Tgl. 5 Mei 1998. yang diperbuat oleh SUNDARI SIREGAR, SH. Notaris di Medan, Tercecer disekitar Jl. AH. Nasution. Bagi yang menemukan akan diberi hadiah sepantasnya. Hub. JORAM ARITONANG HP. 0813 7652 6998

TERCECER 1 (Satu) Buah BPKB Asli STNK BK 1662 VJ. a/n. Kalisun. Alamat DSN IX DS. Simpang Empat.

* TELAH TERCECER *

Asli Surat Ganti Rugi Tanggal 4 Juni 1981. Yang diketahui Oleh Lurah Titi Papan. Abdul Wahab Dong. Tercecer sekitar Titi Papan. Hub. 0813 61977 123 - 0812 6016 668 tahun 2000.

HILANG

Surat Jual Beli Tanah - tanggal 1411-1972. An. Mohd. Nuh Lubis. Seluas 1200m2. Terletak di Jl. Panglima Denai s/d Jermal Baru Lk. III Kel. Denai - Kec. Medan Denai. HILANG BPKB Asli BK 1998 EW. A/n. LINI. Alamat Jl. K.L. Yos Sudarso No. 46 Medan.

BURSA

MATERIAL

PIPA SCREEN

Jl. Brayan Medan

8442246 08126427 1725 Ada Garansi ADI

WC WC 0813 6147 0812 WC 0812 60444275 WC 845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F

Setia Budi

JL. SETIA BUDI

Hub. TUMPAT / SEDOT WC/GRANSI

ANDA TUMPAT - SEDOT

PAGAR EURO

R

EUROMESH BAJA U-50

127 Pengemudi. Komisi, Bonus, Insentif, GPS, Mess, Mobil baru, dll. Syrt: 23 - 50 thn, SIM & KTP, Tdk bertato/ bekas tato, Segera dtg/ kirim lamaran ke: Jl. Kapt. Muslim No. 92 Medan Telp. 7637.5840

R

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

BURSA JASA

PT. BINTANG REZEKI UTAMA (B.R.U)

BUNGA O % atau

Hadiah KACA FILM V-KOOL FILM V-KOOL + GPS DP RINGAN

KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

LOWONGAN KERJA

Dibutuhkan segera, ±20 orang Sales, Tamatan minimal SMA/ sederajat Ditempatkan: Sbg Tenaga Marketing Dibidang: Product Kesehatan Syarat Utama: Mempunyai kendaraan sendiri/ SIM C Benefit: Gaji + Bonus/ Insentive Uang transportasi: Rp. 15.000/ hari Lamaran diantarkan langsung ke: Jl. Brig. Katamso No. 795A (depan Kebun Binatang Lama/ Samp. Bank Mega) Lamaran diterima 1 Minggu setelah iklan terbit

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

WASPADA

CASH BACK 12 Juta

SIM B1, Jujur, Tanggung jawab, Rajin Hub. Alamat Komplek Sunggal Indah Blok A 2 No. 280 Medan - Sunggal Telp. 847.5377

BLUE BIRD MEMBUTUHKAN

GALVANIS

Hub. 8219951 Jl. Setia Budi No. 2

Harian

LOWONGAN

DICARI SUPIR

ALUMINIUM ZINC - AZ - 150

Telp.:

TUMPAT/ SAL. AIR

DIBUTUHKAN

Tkg Pangkas Berpengalaman, Jaminan Ada, Muslim, Disiplin, Sopan Hub. Pks. Rido Full AC Jl. Laksana 0812.601.8581

ATAP & DINDING EURODEK

BURSA

Tumpat Sedot

DIBUTUHKAN Tukang Pangkas berpengalaman Muslim, Jaminan 50 Rb/ Hr Hub. Pangkas Mutiara Jl. Panglima Denai No. 105 Medan HP. 0812.634.9901

Dicari untuk jadi Guru TK/ PAUD Hub Jl. Gatot Subroto No. 103 Binjai T e l p . ( 0 6 1 ) 8 8 2 . 5 8 9 5 H P. 0852.6270.4985, Bp. E. Saragih, SH

Jutaan

7422 2213 7030 2829 7006 1068

BURSA

LOWONGAN LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. Bpk Ridho (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan

UNTUK SUMUR BOR MERK JHONSON, DLL HARGA BERSAING 2” S/D 6” HUB HP. 0812.6329.4227 - (061) 2671.5093

Mulai

KONSTRUKSI

WC

HARGA USD 1.575 USD 1.750

NOKIA N97 PRIBADI DIJUAL. Warna putih, komplit, mulus, tidak kecewa. H. 2.050 Jt/Nego. Hub. 0812 60824 824 / (061) 7734 7734

MADINA SERVICE

GARANSI

TV

Meninggal dunia pada Jumat, 28 Juni 2011 Pukul 09: 55 wib. Disemayamkan di rumah duka Jl. Dua Lr-3 B-28 P. Brayan Bengkel Medan dan telah dimakamkan pada hari yang sama di Pemakaman Porta, P. Brayan Bengkel Medan

Izin Usaha : 503/1099.SK.HO/SL/NT/08 JADWAL HARGA UMROH TAHUN 2011 / 1432 H

PROGRAM TANGGAL UMROH REGULER 9 HARI 1, 4, 14, 25 MARET 1, 11, 22 APRIL UMROH REGULER 14 HARI 9 , 23 MARET 8, 22 APRIL UMROH + CAIRO 12 HARI 16 MARET, 21 APRIL UMROH + TURKEY 12 HARI 22 MARET, 19 APRIL UMROH + AQSHO 11 HARI 25 MARET, 26 APRIL

BURSA

SERVICE

AC AC AC AC

Ibunda sdr AZWAN SITUMORANG, Kabag Reprographie

AMANAH UMROH

KOMUNIKASI

BURSA

AC

74 tahun

Erucakra Mahameru & Keluarga

061-4576602. Terimakasih

ELEKTRONIK

Telah meninggal dunia

Semoga arwah beliau diterima disisi Allah SWT dan keluarga yang ditinggalkan diberi ketabahan

silahkan hubungi kami di

YAMAHA Zupiter Z Thn. 2007. Wrn Merah Maron. Hrg. 7,5Jt/Nego. Keadaan mulus dan mesin sehat. Hub. 0812 6374 042 - 0852 7543 0376

Media yang Tepat untuk Iklan Anda

FAX.4561347

Pelanggan Yang Terhormat

TOYOTA Kijang Super Thn. 92. W. Biru met, BK Medan, AC, RT, VR AC, mulus. BU. Hub. 77919728 - 0812 6004 3002 TOYOTA Corolla SE Salon, 87. Merah Lengkap, PR, BR, Tape, AC + P. Steering. Harga 28 Juta/Nego Boleh TT. dengan Kijang, Panther, Taft GT. Honda Grand Civic 88, Hitam, lengkap, mulus sekali, nama sendiri. Harga 33 Juta/Nego. Hub. 0811 645 684. HSB.

11 CM Rp. 165.000 12 CM Rp. 180.000

Sabtu, 29 Januari 2011

Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Melayani Jasa Pengiriman Barang Tujuan Kota² di Pulau Sumatera & Pulau Jawa, Baik Barang Eceran, Pindahan, dll Alamat: Kantor Pusat: Jl. Administrasi Negara I No. 24 Penjernihan/ Pejompangan, Jakarta Pusat Telp (021) 570.8414 / 5733.275 Fax (021) 573.3275 Kantor Cabang: Jl. Letda Sujono No. 133 Medan Telp (061) 7388.222 - 7388.333 Fax (061) 7388.333

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

MINI & EFEKTIF IKLANKAN PRODUK ANDA

BURSA

PELUANG BISNIS

BELAJAR FOREX DENGAN ROBOTIC TRADING

Tingkat Keberhasilan Trading 90% Pelatihan Privat dan Kelas Hub. Mr. WAM RAN : 0811.602.033

TEMPAT PENITIPAN ANAK ASSAKINAH

Usia mulai dari 3 bulan, Martubung Jl. Pancing 5 Kebun Lada Gg. SBY samping Mesjid Mukhlisin No. 9 HP. 0821.6055.9840

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

TERMURAH

BERKUALITAS

PELUANG USAHA PEMASANGAN DEPOT AIR MINUM ISI ULANG STANDAR DEPKES

15 Jt s/d 38 Jt (Nego)

AIR MINERAL DAN SISTEM RO JUAL ALAT-ALAT DEPOT ISI ULANG

CV. MITRA INTERNUSA JL. YOS SUDARSO KM. 15,5 NO. 121 MEDAN

RINALDI: (061) 685.0456 MOBILE 0813.6214.3160

FD CD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

WASPADA Sabtu 29 Januari 2011

Ekonomi & Bisnis

Bank Sumut Syariah Sibolga Jalin MoU Bersama SMA Plus Matauli Pandan SIBOLGA (Waspada) : Banyaknya permintaan pihak sekolah agar PT Bank Sumut Syariah Cabang Sibolga melakukan transaksi demi mempermudah para pelajar dan guru akhirnya, Selasa (25/1) jalin Mou bersama SMA plus Matauli Pandan. Hal itu dikatakan kepala PT Bank Sumut Syariah Cabang Sibolga Riri Yesfri Ivan melalui Pemimpin Seksi M. Nazri kepada Waspada di kantor PT Bank Sumut Syariah Cabang Sibolga, Rabu (26/1). Dikatakan, penandatanganan MoU antara Kepala Sekolah SMA Matauli Sumartono dengan Kepala PT Bank Sumut Syariah Cabang Sibolga Riri Yesfri Ivan di halaman sekolah disaksikan para dewan guru dan pelajar. Dalam kesepakatan itu, kata Nazri, pada setiap hari dilakukan open table (buka meja) di SMA Matauli guna melakukan transaksi, sedangkan di SMA Tri Ratna Sibolga dilakukan transaksi setiap hari Rabu. Program dilaksanakan merupakan program pemerintah yakni ‘Tabunganku” sekaligus menggiatkan para pelajar gemar menabung dimana program itu tetap berkelanjutan kepada sekolah-sekolah lain, kata Nazri. Nazri mengakui, PT Bank Sumut Syariah Cabang Sibolga sejak berdiri 1 Oktober 2010 diresmikan Walikota Sibolga hingga saat ini sudah menghimpun dana pihak ketiga (DPK) sebanyak Rp7,3 miliar dengan po-

Ketua Lembaga perlindungan Konsumen Sibolga Nauli Erwin S Simatupang kepada Waspada, Rabu (26/1) meminta agar pelaku usaha tidak melakukan spekulasi harga dengan lonjakan harga beras yang ma-

Waspada/Alamsatriwal Tanjung

PLN Seminarkan Pengaruh Petir Bagi Pasokan Listrik

RUMAH DIJUAL

Anggaran Minim, RI Tidak Bisa Swasembada Beras DENPASAR ( Waspada): Kebijakan pemerintah hanya mengalokasikan anggaran di sektor pertanian sebesar Rp16 triliun atau dua persen dari total APBN, sulit diharapkan bisa membawa Indonesia mencapai swasembada beras tahun 2011. Minimnya anggaran untuk pertanian untuk tahun ini hanya Rp16 triliun atau tidak lebih dari dua persen dari total APBN yakni sebesar Rp1.200 triliun, sangat disayangkan Sekjen Himpunan Kerukunan Tani Indonesia Fadli Zon. Berdasar perhitungannya, untuk bisa memajukan per-tanian di Indonesia, maka minimal anggaran pertanian harus dinaikkan hingga 15 persen sehingga mampu mengopti-malkan sektor pertanian, bukan malah sebaliknya. “Bila sektor pendidikan meningkat hingga 20 persen, kenapa sektor pertanian harus berada dibawah dua persen,” kata Fadli disela-sela Musda keenam HKTI Bali di Gedung Wisma Sabha, Denpasar, Jumat (28/01). Menurut dia, peningkatkan anggaran di sektor pertanian mutlak diperlukan sebab hingga saat ini sebagain besar rakyat Indonesia menggantungkan hidupnya di pertanian bahkan berdasar catatannya saat ini jumlah petani mencapai 50 hingga 70 persen dari jumlah penduduk. Kecilnya anggaran tersebut kata dia menunjukkan peme-rintah Indonesia belum mampu merumuskan kebijakan pertanian secara nasional terkait Swasembada beras. Dia menunjukkan bukti tahun 2010 lalu, Indonesia ter-nyata belum mampu mewujudkan swasembada beras. Bah-kan yang terjadi untuk memenuhi kebutuhan makanan po-kok dalam negeri, kegiatan impor beras mencapai 1,8 juta ton. Ditambahkan Fadli, suatu kali usai Menteri Pertanian memaparkan kegiatan impor beras jumlahnya sekira 600 ribu ton, namun setelah HKTI mengontak organisasi petani di Vietnam, ternyata angkanya jauh lebih tinggi sebesar 1,8 juta ton. Masih tingginya impor beras itu, sambung dia, tentunya menjadi beban tersendiri karena kebijakan nasional pertanian Indonesia belum tepat sasaran. Peningkatan angka impor beras tersebut sangat berbeda dibanding data versi pemerintah sebab sifatnya lebih politis. (okz)

Pelaku Usaha Jangan Permainkan Harga Beras SIBOLGA (Waspada) : Masih tingginya lonjakan harga beras di Kota Sibolga dan Tapteng mengakibatkan sejumlah masyarakat ekonomi lemah mulai kesulitan membelinya, sementara penghasilan ekonomi sangat minim akibat kurangnya hasil tangkapan ikan dengan kondisi cuaca tak menentu.

TANDATANGAN: Kepala PT Bank Sumut Syariah Cabang Sibolga Riri Yesfri Ivan saat penandatanganan MoU disaksikan kepala Sekolah SMA Matauli Sumartono di halaman SMA Plus Matauli Pandan, Rabu (25/1). Nazri mengharapkan, PT sisi laba Rp 120 juta. Menyangkut penyaluran Bank Sumut Syariah merupakredit di wilayah Sibolga dan kan satu-satunya aset Sumut Tapteng, Nazri mengakui sudah sebagai tuan rumah di negeri mencapai 4,1 M dari berbagai sendiri dimana Bank Sumut nasabah mikro kecil menengah Syariah nasabahnya bukan di hampir 70 persen dengan sis- kalangan muslim saja dimana tem diterapkan jual beli dimana hingga sekarang para nasabah bank mendapat marjin keun- m a s i h d i d o m i n a s i w a r ga tungan, terang Nazri. Sibolga. Nazri menjelaskan, bagi FLPP hasil dimaksud jual beli mudhaSementara secara terpisah rabah dan musyarabah dengan bagi hasil sedangkan dalam dalam acara sosialiasi Fasilitas bentuk pinjaman atau Qardh Likuiditas Pembiayaan Perubank mendapat jasa dimana mahan (FLPP) dihadiri deputi Bank Syariah Cabang Sibolga Menpera RI bidang pembiasudah sistem online di seluruh yaan, Bupati Tapteng, Bank SuSumut dan Jakarta bahkan su- mut Syariah Cabang Sibolga dan dah memiliki ATM bersama pengembang dengan tujuan maupun fasilitas lainnya. memudahkan masyarakat umum mendapatkan perumahan. Namun hal itu masih disosialisasikan dari pihak deputi Menpera RI, Pemkab dapat fasilitas dan belum berjalan, seMEDAN (Waspada):Untuk meningkatkan pengan-dalan dalam dangkan Bank Sumt Syariah Sirancangan kerja penyusunan standarisasi dan pengelolaan inovasi bolga hanya sebagai mediator didalam menyongsong 275kVac, 500 kVac. PT PLN menggelar dan fasilitator untuk FLPP. Kata seminar sehari “Pengaruh Petir pada Instalasi Ketenagalistrikan Nazri dan menambahkan bagi yang berpenghasilan minimal di Sumatera”, kemarin. Dalam acara tersebut dibuka oleh Manager SDM PT PLN Rp 2,5 juta per bulan masyarakat Wilayah Sumut, Setiabudi Suhut di Upt. Tuntungan, Medan, dihadiri bisa mendapat fasilitas rumah. pembicara dari universitas ITB, Prof Ngapuli Sinisika, Reynaldo kata Nazri. (a34) Zoro, Syarief Hidayat, pembicara dari BMKG, Subarjo, dan PLN Edy Iskanto serta Eko Yudho. BURSA Pada seminar tersebut di-ambil kesimpulan Sumatera memiliki PROPERTY potensi besar didalam banyaknya jumlah petir sehingga hal ini dapat menguntungkan bagi petugas dalam instalasi ketenagaInformasi Pembaca listrikan. Bursa Property “Tentunya hal ini akan memberikan masukan berkaitan dengan GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah implementasi standar PLN dan peningkatan kinerja diperoleh KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu dari hasil karya inovasi,” ujar Manager SDM Setiabudi Suhut. SHM: Sertifikat Hak Milik GM PT PLN (Persero) Wilayah Sumut Krisna Simbaputra mengajak segenap jajarannya agar terus menggalang kerjasama DIJUAL yang baik seperti selama ini untuk mengatasi berbagai tantangan Rumah Permanen, Jl. Sakti Lbs di depan dalam memberi pelayanan berkualitas kepada seluruh Gg. Bali Hub. 0812.6397.456 pelanggan. RUMAH BARU DIJUAL Jl. Denai Gg. Giat “Melalui kerjasama yang harmonis termasuk dengan H u b H P. 0 8 1 3 . 8 1 2 5 . 4 1 7 0 pemerintah daerah maupun mitra PLN sendiri, diyakini pelayanan 0813.6224.2468 - 0813.7566.4136 dapat ditingkatkan seperti yang didambakan masyarakat,” harapnya pada acara terpisah Pisah Sambut GM PT PLN (Persero) Wilayah MURAH Rmh Jl. Sei Padang/ 13 M. Baru, 2 Rmh, COcok utk Kantor/ Klinik, Sumut dari Denny Pranoto kepada Krisna Simbaputra dan Sestijab LT. 1252m, H. Damai, Serius call: Ketua Persatuan Ibu PT PLN Wilayah Sumut. (061) 7728.7459- 0819.827.459 Krisna Simbaputra sebelumnya menjabat GM PLN Sumatera RUMAH DIJUAL Barat. Sedangkan Denny Pranoto menjadi GM PLN Semarang Jawa Rumah tinggal di Jl. Ayahanda Tengah. Hadir dalam pisah sambut tersebut antara lain GM PLN (T/ LB. 405/300, SHM), 5 KT, 3 KM, Pembangkitan Sumbagut Ir Ikuten Sinulingga, GM PLN Pikitring Garasi Hub. (061) 457.8039/ Suar Ir Bintatar Hutabarat, GM PLN Pembangkitan Sumatera I 0821.6652.6080, TP Ir Sulaiman Daud, Staf Ahli Gubsu Alexius Purba. RUMAH DIJUAL Krisna melukiskan Medan merupakan miniatur Indonesia Jl. Eka Warni Seroja Gedung karena daerah ini memiliki tehnologi di bidang kelistrikan. SeJohor Medan, SHM, KT 3 bagai putera kelahiran Sumut ini, dia berjanji terus berupaya meningkatkan pelayanan seperti yang dilakukan pak Den-ny KM 2, Tanah 8x27m², 2 Lantai Harga nego, Bisa KPR Pranoto selama ini. Hub. 0813.7694.9191 Sementara itu Denny mengatakan pada akhir 2011 nanti PLN Wilayah Sumut sudah mencukupi daya untuk mela-yani sektor industri dan bisnis maupun sektor lainnya. “Kita berharap PLN daerah ini berkembang pesat. Kita haJl. Sunggal Gg. Baru No. 16, rapkan pula kepada pak Krisna Simbaputra lebih baik dari saya sehingga PLN tetap berjaya untuk memberi pelayanan kepada ± 500m dari Jl. Ringroad se-genap pelanggan”, pinta Denny Pranoto. (m38)

LT. 263m², LB. 144m², KT 3, KM 3, R. Tamu, R. Keluarga, Dapur, Buka, Harga nego Hub. 0852.7807.1375

sih melambung tinggi dimana Kota Sibolga tidak memproduksi beras beras. “Akibat kenaikan harga beras kondisi masyarakat sudah sangat memprihatinkan dimana beras merupakan makanan

pokok sehari-hari, sementara lonjakan harga belum bisa di stabilkan oleh Pemerintah dan diharapkan agar segera bisa diantisipasi dengan melakukan pengawasan ekstra ketat terhadap pelaku usaha khususnya beras,” jelas Erwin. Erwin meminta agar operasi pasar untuk tetap dilanjutkan guna menstabilkan harga beras terutama bulog agar berperan aktif, sehingga stok di Bulog tetap ada guna menghindari kelangkaan beras di pasaran. Secara terpisah Kadis Perin-

dagkop Pemko Sibolga Benyamin Tarigan melalui Kabid Perdagangan Barmin mengakui walaupun sudah dilakukan operasi pasar murni sejak 23 desember 2010 hingga sekarang belum bisa menstabilkan harga beras. Dijelaskan Barmin, OP pasar beras bulog dilakukan kepada 67 pengecer di setiap kelurahan se-Kota Sibolga dengan harga Rp 6.200 per kg guna mencegah kelangkaan beras di pasaran, sedangkan di pasarpasar tidak ada disalurkan.

Jatah yang diberikan paling banyak untuk 1 KK hanya 1 sak berat 50 kg sedangkan bagi kalangan warga yang pesta diberikan jatah 2 sak, namun walaupun sudah dilakukan operasi pasar tetapi damfaknya hingga sekarang belum ada. Birman juga menampik adanya permainan ditingkat pengecer menaikkan harga termasuk membawa ke daerah lain, namun sampai sekarang secara nasional harga beras masih tetap tinggi dan bukan hanya di Kota Sibolga saja. (a34)

Cuaca Ekstrim

Permintaan Ikan Asin Melonjak MEDANGDERAS (Waspada): Akibat terbatasnya bahan baku disebabkan cuaca ekstrim, permintaan ikan asin mulai melonjak dan dan berdampak dengan kenaikan harga jual barang. Pasalnya, selama beberapa bulan terakhir ini, angin kencang selalua melanda pantai timur, sehingga sebagian nelayan enggan melaut disebabkan ombak terlalu besar, akibatnya penagkapan ikan menurun. Hal sama dengan produksi ikan asin di Kecamatan Medang Deras, Kabupaten Batubara, persediaan bahan baku terbatas sementara permintaan terus meningkat, baik itu sekala lokal maupun dari luar. Dengan demikian permintaan harus disesuaikan dengan persediaan barang, dan hal itu sangat mempengaruhi pasar ikan asin di wilayah itu. “Angin kencang terus melanda di pantai timur, akibatnya tangkapan ikan petani berkurang, dan persediaan ikan asin ikut berkurang, sementara permintaan pasar terus meningkat,” ujar penguasa ikan asin di Kecamatan Medang Deras, Batubara, Hamdani, ditemui

Waspada, Rabu (26/1). Biasanya dia mampu memproduksi ikan asin mencapai 500 kilogram perhari, namun karena cuaca ektrim, menurun menjadi 300 kilogram perhari, sebulan hanya bisa memproduksi 9 ton ikan asin yang dipasarkan di Kota Medan, Kabupaten Serdangbedagai. Namun dia tidak mampu berbuat banyak dan pasrah dengan kondisi itu. Namun terpenting dia mampu memenuhi permintaan pasar walaupun tidak sepenuhnya. “Yang terpenting produksi ikan asin berjalan terus, walaupun semua permintaan belum bisa mereka penuhi,” ungkap Hamdani. Untuk produksi ikan asin paling diminati pasar adalah ikan tamban, dengan harga tolak kepada pembeli Rp 7.500 perkilogram, sedangkan ikan kepala batu tawar dan asin dijual 9.500 perkilogram. Na-mun harga itu jauh bertambah bila sudah dipasarkan berda-sarkan banyaknya permintaan. Dan untuk saat sekarang ini har-ga itu sudah pasti berubah disebabkan persediaan barang sedikit. “Kami hanya memproduksi ikan asin, dan menjulanya

RUMAH PERMANEN 2 LANTAI DIJUAL

RUMAH DIJUAL/ DISEWA

LT. 200m², LB. 160m, Fas. 3 KT, Garasi mobil bisa 2 mobil, Harga nego Jl. Ibrahim Umar Gg. Reda Hati No. 8 HP. 0852.9670.9192

RUMAH DIJUAL CEPAT

Komplek Taman Alamanda Indah Blok D No. 19, Asam Kumbang - Sunggal (Medan), LT. 170m², Bertingkat, 4 KT, 2 KM, Carport, Harga nego, TP No SMS Hub HP. 0812.6972.897 - 0878.9069.2662

RUMAH BARU JOHOR !

Bisa KPR, LT. 255, LB. 200, 4 KT, 3 KM, Ada garasi, Carport, SHM, PLN, PAM, Gas, Di depan Taman Blok G No. 3 Harga Rp. 650 Jt (Include AJB) Hub. 0813.7533.4051

DIJUAL CEPAT

Rumah baru, Sudut/ Hook, Perumahan AMBASSADOR, No. III Jl. Setia Budi Psr. II/ Jl. Pertambangan, Tanjung Sari, LT. 90/ LB. 75 (7x14), 3 KT, 1 KM, Atap cor beton Hub. 0821.6653.3640

PERUMAHAN SAMANHUDI PERMAI

Type 36/ 72 RST (KPR BTN) Dengan DP Rp. 1.150.000, Langsung akad kredit dan sudah dapat menempati rumah tanpa biaya Sertifikat dan biaya proses KPR. Berlokasi Jl. Samanhudi Pasar V Tanah Merah Kota Madya Binjai Dengan Harga 80 Jt Hubungi: 0813.7553.2355 - (061) 7744.5855 0813.6239.2579 - 0857.6250.9899

RUKO DIJUAL

Jl. Jamin Ginting No. 444/ 888 Sumber Pd. Bulan Medan SHM, UT. 6x29, UB. 5x29m 2½ Tingkat

Hub. 0813.9631.2333, TP

JUAL CEPAT

Rumah permanen L. 8x17m, 3 Kamar (Keramik), PAM, PLN Jl. Besar Delitua Gg. Melati No. 16 Harga Rp. 125 Jt/nego Hub. 0852.9723.0252

DIJUAL DEKAT ASRAMA HAJI

Rumah Type 70, 90, 2 Tkt LT. 7x20m, Harga 300 Jt-an SHM, KPR Tanpa DP Lokasi Jl. Karya Kasih

Hub. 0813.7528.1809 - 0852.6280.6726 0812.6438.0168

BANGUNAN BARU KOST2AN

Khusus Karyawan/ Karyawati Fas: AC, Wifi, Ruang olah raga, Km Dalam, Dapur, Parkir mobil/ Motor, Harga mulai Rp. 700 Rb s/d 1,5 Jt Jl. Sei Bagerpang No. 23/ 30 Medan Baru HP. 0812.6208.272/ Ibu Icut 0821.6755.1041 / Audi

Ingin Promosikan Produk Anda Harian

WASPADA 0812 6040 8948 0812 6324 3111 0813 7575 8643 (061) 661 0666

B11

Media yang Tepat untuk Iklan Anda

kepada agen kemudian dipasarkan,” ungkap Hamdani, yang merauk keuntungan dari bisnis ikan asin sebanyak Rp 10 juta tiap bulannya. Bisnis ini, menurut Hamdani, merupakan pekerjaan yang diminati bagi warga yang tinggal di pesisir pantai. Hanya saja bisnis ini kurang begitu diperhatikan oleh pemerintah, sehingga para pengusahanya hanya berjalan ditempat. Bila saja bisnis ini terus diperhatikan, sudah barang tentu, Kabupaten Batubara bisa menjadi no 1 dalam hal produksi ikan asin, dan bisa menambah pendapatan daerah. “Bila itu semua kita lakukan, maka perekonomian masyarakat pesisir akan merangkak naik, dengan meningkatnay produksi ikan asin,” katanya. (csap) MENJEMUR: Dua orang pekerja terlihat sedang menjemur ikan asin, di Desa Nanasiam, Kecamatan Medang Deras, Kabupaten Batubara. Ikan asin itu berhasil menembus pasar di Kota Medan dan Kabupaten Serdang Bedagai. Foto direkam, Rabu (26/1).

Sangat murah, 6 Km Tidur, Full keramik, Luas 380m, SHM Hub. 0813.9682.9214 0852.7539.1494

RUMAH MAKAN DIJUAL

KESEHATAN

BISNIS KESEHATAN PROPOLIS

Permanen + Peralatan usaha, SHM, 10x16m², Omset lumayan, Lokasi strategis Jl. Pasar III No. 132 (Krakatau) depan Pabrik Hub. (061) 662.6731 HP. 0852.6299.3232 Rp. 750 Jt

Solusi sehat dan Income + an Hub. (061) 9109.0060 - 0813.8761.7353

RUKO HALAT 123 PERMAI

Colostrum 100% Made in New Zealand, untuk jantung, diabetes, rematic, stroke, maag, asma, dll langsung HP. 0852.6134.6604

3 TKT COCOK UNTUK USAHA INTI KOTA, DP 100 JT Dijual 4 pintu ruko Jl. Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri), LB. 4x16m, LT. 4x29m, Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha, Perhotelan, Fotocopy, Praktek dokter, Kost²an, hospital, warnet, kantor NB:300meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Jt, Harga 575 Jt, Sisa I unit, Full keramik, Siap huni ± 80 Jt Hub: 7772.2123 / 7759.8123 HP. 081.165.1123

TANAH

TELAH TERSEDIA

KUSUK & LULUR

MBAK ALIN

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

BAKTERI PROBIOTIK PELANGSING

UK. 7X29M : 76 JT UK. 11X29M : 120 JT JL. KSATRIA GAPERTA DEKAT SEKOLAH EKA PRASETYA Hub. 0852.7013.9207

TANAH DIJUAL

Luas Tanah 11x54mtr, Jln Besar Ta n j u n g S e l a m a t d e p a n Swalayan Ido Kec. Medan Sunggal, Contac Person Bu Ani (061) 7707.6327

TANAH DIJUAL

Jl. Delitua Biru-biru Psr. 9 Gg. Sari (Dpn Perumahan Pensiunan ABRI) Luas 836m² (P. 44m, L. 19m) SK Camat, Harga nego Hub. 0812.6540.4810 0813.9687.9211

TANAH DIJUAL

BURSA

Free WiFi

KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

- Investasi Rp. 500.000/ orang (Staterkit, Bibit F3, Sertifikat, Konsumsi & Konsultasi) - Biaya ditransfer ke Rek: 057 801 009 839 502 BRI Kranggan Cibubur AN. Muhtarudin

PUSAT PENGOBATAN SPESIAL ALAT VITAL

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN

-

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

DITANGANI LANGSUNG

BPK. HARYONO ASLI DARI BANTEN

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663

NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

TERAPI JIWA MENTAL & KEROHANIAN

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

PELUANG USAHA JAMUR KONSUMSI

Forum Usaha Jamur Nusantara (Forsamura) Mengadakan Pelatihan singkat budidaya jamur Materi pelatihan: - Teknik budidaya Jamur konsumsi - Managemen rumah jamur - Teknik aplikasi pembibitan jamur - teknik pembuatan media jamur - Prospek usaha jamur - analisa usaha jamur - Produk olahan jamur - strategi pemasaran Waktu pelatihan: - Kelompok belajar (Pokjar) 1, Sabtu, 12 Feb 2011 Pokjar 2, Minggu 13 Feb 2011 - Jam: 09.00-17.00 WIB - Selasa, 15 Feb 2011, Kunjungan Lapangan Tempat pelatihan: - Aula Wisma Haji Jl. Raya Binjai Km. 6,5 Medan Pendaftaran: - Bpk. Sembiring: Jl. Jamin Ginting Gang Pembangunan No. 4 Pdg. Bulan Medan HP. 0812.6028.3362 - 0813.8761.7353 - Adi: 0813.7033.1003 - Muchtar:: 0813.8197.7962 Investasi:

Call Center: 0818 090 73481

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

TANAH KAVLING SHM

TRAVEL/ WISATA

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

TURUN 20 KG AMAN MUDAH CEPAT 0813.3207.7899 GARANSI

DIJUAL 2 BIdang Tanah Darat dekat Lampeunurut, ±6km dari Banda Aceh di Pinggir rencana ringroad, Cocok utk, Bangun perumahan (Bebas tsunami 2004), Ukuran luas 8236m² (SHM) dan 1367 (SHM), Harga Rp. 200 Rb/m², Bisa nego Hub. 0812.6432.006

1. Uk: 8x18 Harga Rp. 30 Jt (Psr. 1) 2. Uk: 8x12 Harga Rp. 25 Jt (Psr. 2) 3. Uk: 8x16 Harga Rp. 45 Jt (Psr. 2) 4. Uk: 7x16 Harga Rp. 42 Jt (Psr. 2) 5. Uk: 8x21 Harga Rp. 35 Jt (Psr. 4) 6. Uk: 11x16,5 Harga Rp. 35 Jt (Psr. 4) Semua Milik Pribadi (SK Camat) MARELAN Hub. 7781.7402 / 0813.6244.7000

Waspada/Sapriadi

BURSA

KEJATI B.109/DSP 4.3/11/2009

KI TUBAGUS ROHMAN TOHA Mengatasi peyakit dan problem antara lain: - Kelainan sex, bysex (homo/ lesbi) - Gangguan jiwa/ mental, kegelisahan, gila BUKA SETIAP HARI KERJA JAM 08.00 S/D - Kurang percaya diri 21.00 WIB - Dendam, marah, stres berat, cemas, dll hari libur tetap buka Penyakit yang dapat disembuhkan secara langsung di tempat seperti: Lumpuh, stroke ( Komplikasi) bisa kembali normal, gondok, liver, amandel, hernia, ginjal, rematik, tumor, diabetes, impoten, spilis, singa, dll

MOTO

Kenalilah hati nurani (fitroh dirimu) karena, disitulah kunci Kebahagiaan ketentraman kesuksesan yang hakiki abadi dan pasti

PRAKTEK: Jl. SM. Raja, samping UISU masuk Jl. Sempurna, 300m No. 49Medan HP. 0812.8481.8889 KLINIK TERAPY MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Kreasi

B12

WASPADA Sabtu 29 Januari 2011

Bimbel Itu Tetap Penting Lho... NGGAK terasa Ujian Nasional (UN) udah di depan mata. Pastilah bagi kamu yang udah duduk di kelas XII atau IX sedang melakukan berbagai persiapan menyambut sang tamu agung itu. Persiapan buat menghadapi UN pun semakin gencar dilakukan para siswa memasuki semester genap ini. Selain masih harus menyelesaikan sebagian materi kelas akhir, mereka juga dilatih terbiasa dengan soal-soal prediksi ujian nanti. Namanya ujian, apalagi ini ujian nasional, tentunya butuh persiapan khusus dan nggak cukup hanya dengan belajar semalam suntuk di rumah alias sistem kebut semalam (SKS). Yang pasti ada persiapan khusus, misalnya mengikuti berbagai bimbingan belajar (Bimbel) di luar. Nah, inilah momen yang tepat bagi setiap Bimbel mempromosikan program baru kepada para siswa yang ingin lulus ujian tahun ini. Pada satu sisi, Bimbel baik bagi para pelajar karena semakin banyak latihan soal, maka akan terbiasa dengan soal ujian nantinya. Di sisi lain, banyak lembaga pendidikan menawarkan bimbel intensif jelang UN. Hal tersebut pun dinilai ampuh mendongkrak kemampuan siswa dalam menghadapi soal ujian. Tapi, semua itu tentunya nggak akan berarti apa-apa jika kita nggak serius belajar dan nggak punya komitmen untuk lulus. Komitmen alias kesadaran bertanggungjawab secara penuh akan sesuatu yang telah kamu pilih ini adalah bagian terpenting dalam proses belajar menghadapi ujian. Tanpa komitmen, kamu akan ngerasa cuek dan lebih banyak toleransi untuk diri sendiri. Menurut Kepala Cabang Ganesha Operation (GO) Medan-Binjai, Ir Jamso

Haryono, banyak hal yang bisa siswa dapatkan dengan mengikuti Bimbel. Selain dilatih selalu mengerjakan soal-soal bervariasi, siswa juga dilatih mengerjakan soal-soal dalam waktu singkat. “Di GO ini, kami sudah mempersiapkan banyak bekal untuk siswa agar siap dalam menghadapi UN, mulai dari fasilitas buku, jadwal belajar, soal-soal latihan yang variatif, kiat-kiat serta strategi menjawab soal plus yang terpenting motivasi bagi siswa,” urainya sembari mengingatkan siswa tidak lupa berdoa serta mempersiapkan mental jelang ujian. “Untuk menyambut ujian tahun ini, tentunya udah banyak persiapan yang aku lakukan. Salah satunya mengikuti Bimbel yang bakal ngajarin aku banyak hal, seperti cara cepat dan tepat menjawab soal serta berbagai kiat maupun trik menjawab soal, “ ujar Indira Khairuna Nasution, siswa 12 SMA Harapan 1 Medan. Indira menambahkan, suasana belajar di Bimbel memompa semangat lebih dibanding belajar di sekolah atau rumah. “Di sini, banyak latihan soal yang memungkinkan kita terbiasa pas UN nanti. Kalo di sekolah, gurunya hanya ngulang pelajaran,” papar Indira. Sesulit apapun Ujian Nasional itu nantinya, yang penting kita harus tetap yakin mampu melewatinya. Ingat, jika ingin menjadi manusia berguna bagi banyak orang, maka kita harus terus berusaha untuk meningkatkan kualitas yang kita miliki. So, good luck guys... *Arianda Tanjung

Tiga siswa tengah mempelajari brosur salah satu lokasi bimbingan belajar di Kota Medan sebelum bergabung demi persiapan jelang Ujian Nasional nanti. -Waspada/Khairil Umri Batubara-

Andai Aku Gayus Tambunan Sekolah Jurnalis Dibutuhkan Di Tengah Menjamurnya Media 11 Maret, Diriku masuk penjara Awal ku menjalani, Proses masa tahanan Hidup di penjara, Sangat berat kurasakan Badan ku kurus, Karena beban pikiran Kita orang yang lemah, Tak punya daya apaapa Tak bisa berbuat banyak, Seperti para koruptor Andai Ku Gayus Tambunan,Yang bisa pergi ke Bali Semua keinginannya, Pasti bisa terpenuhi Waspada/Khairil Umri Batubara

Lagu Andai Aku Gayus Tambunan kian menjadi buruan para remaja. NAMA Bona Paputungan sebelumnya tidak pernah menjadi pemberitaan di media massa, sebelum dirinya menciptakan lagu berjudul Andai Aku Gayus Tambunan. Tak tanggung-tanggung, pengunjung lagu ini di situs jejaring You Tube mencapai 345,743 pengunjung. Lagu ciptaan pria berusia 32 tahun ini menjadi fenomenal sebab lagu ini mainmain dengan dampaknya bukan main. Karena, lagu ini bertema protes dan setengah menghujat sistem peradilan negeri ini. Tak hanya itu, para remaja berlomba memburu lagu ini untuk menjadikan nada dering di selulernya. Setelah keluar dari penjara akibat kasus Kekerasan Dalam Rumah Tangga (KDRT), Bona membuat video klip unik ini. Lagu itu juga tengah hangat dibahas lewat situs-situs jejaring sosial, seperti Facebook dan Twitter. “Pertama dengar lagu ini, wah! Hebat, saya terus mencari Ring Back Tones-nya tapi belum ada,” ujar Fahruri Tarigan, mahasiswa Fakultas Hukum UMSU ini. Fahruri berharap lagu ini bisa membuka

Lucunya di negeri ini, Hukuman bisa dibeli Kita orang yang lemah, Pasrah akan keadaan 7 Oktober, kubebas dari penjara Menghirup udara segar, Lepaskan penderitaan Wahai saudara, Dan para sahabatku Lakukan yang terbaik, Jangan engkau salah arah Pasrah akan keadaan, Biarlah semua menjadi kenangan Kenangan yang pahit, dalam hidup ini

mata para aparatÿþur negara, agar tidak terpuruk karena uang dan menyadarkan bahwa hukum di Indonesia tidak ditambah jadi bobrok lagi. “Semoga dengan terciptanya lagu ini, menjadi kritikan untuk membangun hati nurani aparatur negara, supaya lebih kritis dalam melihat dan menilai suatu polemik diÿþ negara yang kita cintai ini,” harap Iskandar Zulkarnain Siahaan, mahasiswa ilmu Jurnalistik STIK-P Medan. *Hajrul Azhari

KEDATANGAN Pemimpin Redaktur Femina, Petty S Fatimah, ke Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan, baru-baru ini, memberikan wawasan dan pencerahan tentang jurnalistik di tengah menjamurnya media elektronik. Motivasi dan tantangan tak henti-hentinya terlontar dari bibir mungil jurnalis handal ini untuk menumbuhkan niat dan bakat mahasiswa STIK-P di bidang jurnalistik khususnya. Petty bahkan menantang mahasiswa STIK-P untuk mengirimkan tulisan feature dengan batas deadline satu jam pasca kuliah umum tentang “Media Now” tersebut. “Ini tantangan untuk mereka agar menjadi jurnalis. Saya pun menerapkan itu pada bawahan saya,” ungkapnya kepada Kreasi. Jurnalis dan pengelola media yang pernah mengikuti pelatihan di dalam dan luar negeri ini mendalami bidang gaya hidup, musik, film dan media. Petty mengungkapkan profesi jurnalis sangat dibutuhkan di tengah menjamurnya media cetak dan elektronik. Terkaitparadigmmediacetak akan mati nantinya karena persaingan,menurutnyatidakbenar. Justru media cetak dan elektronik memiliki kelebihan dan kekurangan masing-masing. Sebab itu, pemimpin maupun redaktur harus pintar-pintar menyeleksi wartawannya, “Pintar saja tidak cukup, wartawan harus pandai ilmu mar-

Waspada/Hamdani

Pemimpin Redaksi Majalah Femina, Petty S Fatimah (tengah), didampingi Ketua STIK-P Medan Hj Ida Tumengkol BComm MHum memberikan pemaparan tentang dunia jurnalistik terkait perkembangan media sekarang. keting dan liar atau bandel di luar sekolah. Maksudnya, harus aktif juga organisasi di luar kampus,” tambahnya. Karena sesungguhnya yang bisa membunuh media tersebut adalah redaktur atau editor yang melupakan, mengesampingkan keinginan dan interest para pembaca serta kurangnya kepe-

kaan tentang siapa yang akan menjadi segmen pembaca media itu sendiri. Petty, juga gemar olahraga, mengungkapkan sekolah jurnalistik berperan melahirkan jurnalis-jurnalis handal dan profesionalyangbisamenyeimbangkan kegiatan belajar mengajar formal dan mengaktifkan maha-

siswa di organisasi yang berkenaan dengan jurnalistik, seperti halnya STIK-P. “Sekolah jurnalis dibutuhkan di tengah menjamurnya media cetak dan elektronik,” tegasnya. Dalam waktu dekat ini, Femina juga akan mengadakan event “Femina Campus to Campus” dalam rangka menumbuh-

kan niat dan bakat anak muda menggali kreativitasnya baik itu di bidang penampilan, life style maupun innerbeauty. “Ini adalah pemikiran bersama untuk merangsang anak muda berekspresi di bidang yang ia geluti,” lanjut Petty menutup pembicaraan. *Silfa Humairah

Manusia Diciptakan Saling Berpasangan Acara Debat Mahasiswa

Waspada/Khairil Umri Batubara

Acara debat turut mendatangkan tiga panelis yang terdiri dari Dra Aprilia MSi Psi (kiri), Drs Asyro Efendi dan Dra Hj Erma S Tarigan SH MHum.

MANUSIA terkadang suka mencari sesuatu yang belum jelas, padahal dalam agama dikatakan bahwa setiap manusia yang terlahir di muka bumi ini memiliki pasangan masing-masing. Demikian disampaikan Drs Asyro Efendi dalam penjelasannya pada acara debat bertemakan “Kontroversi Homoseksual” yang digelar mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan, khususnya yang mengambil mata kuliah

Rhetorics and Public Speaking di aula kampus tersebut, Jl SM Raja, Selasa (25/1) lalu. “Agama sudah menuntut kita mencari pasangan terbaik dalam hidup agar nantinya tercipta peta konsep yang baik dalam hidup. Apabila manusia itu berani keluar dari apa yang sudah ditetapkan, maka resiko yang timbul menjadi tanggungannya sendiri,” terang dosen Pengantar Sosiologi itu. Dalam acara debat tersebut, narasumber terdiri

dari dua tim, Pro dan Kontra, yang masing-masing memiliki pandangan berbeda terhadap tema tersebut. Tim Pro diwakili Ade Irwanto dan Versi Indria Gayatri cs, sedangkan kubu Kontra diwakili Intan Jamiah dan Akbar Satria Wijaya cs. Diwakili Versi, pihak Pro mengatakan homoseksual itu bukanlah penyimpangan seksual namun masyarakat umumnya mengganggap itu merupakan kelainan atau penyimpangan. Padahal homoseksual itu merupakan

Waspada/Khairil Umri Batubara

Waspada/Khairil Umri Batubara

Tim Pro tengah memberi argumen terkajt tema “Kontroversi Homoseksual”.

Anggota tim Kontra serius mendengarkan penjelasan dari kubu Pro.

ketertarikan seksual yang ditimbulkan dari berbagai faktor, terutama lingkungan. Beda halnya dengan tim Kontra yang menjelaskan homoseksual itu merupakan penyimpangan seksual dan sudah pasti memiliki dampak negatif terhadap masyarakat. Apalagi jika dilihat dari budaya bangsa yang masih menganut budaya ketimuran dengan nilai serta normanorma sosialnya. Selain Asyro, dua panelis adalah Dra Aprilia MSi, Psi sebagai ahli Psikologi dan Dra Hj Erma S Tarigan SH MHum sebagai pakar Hukum. Dari segi hukum, Erma mengatakan hingga kini belum diatur dalam undangundang di Indonesia tentang pernikahan sejenis kendati para kaum homoseksual sendiri berkeinginan untuk itu. Idealnya, dalam pembentukan hukum itu yang harus dilihat adalah mayoritas serta nilai yang ada pada masyarakat agar nantinya hukum tersebut dapat berjalan sebagaimana mestinya. “Hukum yang terbaik yaitu hukum yang berasal dari firman Tuhan. Karena itu, sudah semestinya pembentukan hukum berikutnya harus beracuan pada hukum agama,” ujar

Erma. Jika dilihat dari segi psikologi, Aprilia menjelaskan dalam ilmu Psikologi itu sendiri, homoseksual dulunya memang merupakan penyimpangan seksual tapi sekarang tidak. Hal ini berkat ahli psikologi yang terus melakukan studi-studi tentang homoseksual sehingga kini dikatakan homoseksual lebih condong kepada gaya hidup. “ Kemampuan kita dalam menyerap sesuatu dipengaruhi oleh tingkat daya kritis yang kita miliki. Memang ada beberapa orang yang gampang untuk dipengaruhi karena daya kritis yang dimiliki belum maksimal, misalnya remaja,” ungkap dosen STIK-P itu. Ditandai hujan interupsi dari audiens kepada kedua tim, acara tetap menampilkan suguhan menarik dan hidup. Hal ini juga menandakan tema “Kontroversi Homoseksual” sendiri merupakan tema yang pantas untuk diperdebatkan karena menimbulkan banyak pertanyaan di kalangan masyarakat, khususunya mahasiswa. *Arianda Tanjung


Waspada, Sabtu 29 Januari 2011