Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Sabtu Medan 25-330C

Berastagi 19-30 C 0

R. Prapat 25-340C

Parapat 19-30 0C

P. Siantar 18-280C

Sibolga 21-33 0 C

Berawan

BMKG Polonia

Hujan guntur

http://epaper.waspadamedan.com

SABTU, Pahing, 16 Oktober 2010/8 Zulqaidah 1431 H

No: 23298 Tahun Ke-64

ISSN: 0215-3017 Harga Eceran: Rp2.500,-

Bupati Langkat Lepas Kloter 5, Seorang Calhaj Sakit MEDAN (Waspada): Bupati Langkat Ngogesa Sitepu melepas secara resmi jamaah calon haji (Calhaj) kloter 5, sebanyak 454 orang. Jumat (15/10) dari Aula Asrama Haji Embarkasi Medan. Hadir Gubernur Sumatera Utara, H Syamsul Arifin, Ketua Panitia Penyelenggara Ibadah Haji Embarkasi Medan, Drs H Syariful Mahya Bandar MAP bersama Sekretaris Drs H Abd Rahman MA, Humas Drs H Sazli dan udangan lainnya. Dalam sambutannya, Ngogesa mengatakan, keinginan masyarakat Langkat untuk menunaikan ibadah haji cukup tinggi, semoga saja hal ini menjadi perlambang meningkatnya mutu keagamaan masyarakat di daerah ini. Kepada jamaah saya berharap agar dapat mengikuti rangakain kegiatan dalam

warna hijau metalix yang dilarikan pelakunya bisa kembali,” tuturnya. Ingatan Karmiati masih begitu jelas di saat-saat terakhir dia berkomunikasi dengan sang suami. Pada Sabtu (9/10) pukul 11:00, Syahrun menerima telefon dari dua temannya, satu di antaranya berinisial H. Saat itu mereka berangkat ke Lhokseumawe, Aceh Utara karena ada sesuatu pekerjaan. Pukul 14:00, Karmiati menelefon sang suami, yang dijawab masih dalam perjalanan di perbatasan Langkat dengan Tamiang. Pada pukul 21:00, lagilagi Karmiati menghubungi suaminya, dan mendapat jawaban berada di Lhokseumawe.

Lanjut ke hal A2 kol. 6

Dosen USU Yang Ramah Tewas Di Tali Gantungan MENJELANG Isya, Kamis (14/ 10), dalam sekejab warga Bakaran Batu, Kec. Lubukpakam, Kab. Deliserdang, heboh mendengar kabar tewasnya seorang dosen USU diduga akibat bunuh diri. Sontak, mereka mengerumuni sebuah rumah di Jalan Kesaktian Pancasila Dusun III, Desa Bakaran Batu, Lubuk Pakam. Semua tak menyangka melihat sosok pria yang terbujur kaku di dalam rumah itu. Pria itu tak lain adalah sang dosen di Fakultas Pertanian Universitas Sumatera Utara, Medan, Ir Kasmal Arifin Lubis, 51.Dia tewas dengan tali terjerat di lehernya, dan tergantung dari broti asbes kamar tidurnya.

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999)

Terbit 20 Halaman (A1-12, B1-8)

SMS Tidak Dibalas, Ternyata Suami Tewas KARMIATI, 55, tak menduga tak menduga kalau suaminya Syahrun Effendy Batubara, 59, warga Jl. Cemara, Gang Cemara, Lingkungan XIV, Kel. Kotamaksum II, Kec. Medan Area, begitu cepat dipanggil Tuhan. Jumat (15/10) siang, duka menggelayuti keluarga Syahrun. Ia tewas dalam kondisi mengenaskan diduga akibat penembakan. Korban dibunuh dengan keji. Saat ditemui Waspada di rumah duka, Karmiati mengatakan, kematian suaminya sangat tidak wajar dan meminta polisi segera mengungkap kasus tersebut. “Semua permasalahan ini kami serahkan kepada polisi. Kami berharap agar mobil Kijang Innova BK 1072 GP

Harian Umum Nasional Terbit Sejak 11 Januari 1947

TAWAF:

Tak ada yang menyangka, kenapa sang dosen yang selama ini dikenal ramah nekad dan gelap mata mengakhiri hidupnya di tali gantungan. Padahal sore hari sebelum ditemukan tewas tergantung, sang dosen masih terlihat warga membersihkan rumput di halaman rumahnya. “Kok kaya gak yakin ya bapak itu (Kasmal-red) nekad bunuh diri,” kata warga saat melihat mayat dosen diturunkan dari seutas tali di dalam kamarnya.Sedangkan, isi lemari sudah berserakan di atas lantai dan tempat tidurnya. Ada desas desus di balik kematian sang dosen ini, menurut beberapa

Lanjut ke hal A2 kol. 3

Antara

Ribuan umat muslim melakukan Tawaf ketika melaksanakan Ibadah Umrah di Masjidil Haram, Makkah, Jumat (15/10) dini hari. Menjelang pelaksanaan Ibadah Haji, jutaan umat muslim dari berbagai penjuru dunia mulai berdatangan ke Makkah dan Madinah.

pelaksanaan ibadah haji di tanah suci. Diharapkan agar tetap menjaga persatuan dan kesatuan sesama jamaah. “Kepada petugas saya harapkan melaksanakan tugas sebaik-baiknya karena tugas ini adalah amanah. Seluruh jamaah diharapkan menjaga kesehatan dan mempersiapkan diri menghadapi perubahan udara dengan mengkonsumsi makanan dan buah-buahan. Saya harapkan juga untuk mendoakan masyarakat Langkat dan Sumatera Utara agar tetap diberikan kesehatan dan kesempatan melaksanakan ibadah haji. Kemudian doakan seorang Calhaj yang sakit dan harus dirujuk ke rumah sakit di Medan, agar kelak dia berangkat ke tanah suci untuk melaksanakan

Lanjut ke hal A2 kol. 1

Ratusan Ribu Jamaah Padati Masjid Nabawi MADINAH(Waspada): Masjid Nabawi dipadati ratusan ribu jamaah dari berbagai penjuru dunia untuk melaksanakan shalat Arbain. Jamaah mulai memadati Masjid Nabawi Jumat (15/10) menjelang shubuh Waktu Arab Saudi (WAS) untuk melakukan shalat shubuh. Di Masjid Nabawi, mereka melakukan shalat Arbain lima waktu selama 8 hari berturut-turut atau untuk mendapatkan shalat 40 waktu. Demikian dilaporkan dari Arab Saudi diterima Waspada Jumat malam. Shalat Arbain diberi pahala berlipat ganda, termasuk shalat di Masjidil Haram Makkah.Para jamaah Indonesia ikut melaksanakan shalat Arbain di sana. Kondisi Masjid Nabawi penuh sesak.Para jamaah pun berebutan mencari tempat di sana. Menurut data, hingga Jumat jamaah Indonesia yang tiba di Madinah sekitar 14 ribu orang. Jamaah mengutamakan shalat di Masjid Nabawi, seperti shalat dzuhur, ashar, maghrib dan isa.Pada malam hari, Masjid Nabawi jauh lebih hidup pada musim haji ini. Masjid Nabawi ditutup sekitar pukul 00.00 WAS, dan dibuka pukul 03:00. (m16/m06)

Tiga KPUD Tunggu Dana MEDAN (Waspada): Komisi Pemilihan Umum Daerah di tiga kabupaten/kota Sumatera Utara yang harus menggelar Pilkada ulang dalam waktu dekat, masih menunggu dana yang seyogyanya disiapkan pihak eksekutif, setelah Mahkamah Konstitusi mengeluarkan putusan sela mengulang Pilkada. Sementara, pihak eksekutif hingga kini belum memberi jawaban.

KTP Orang Medan Pakai Chip, Gratis MEDAN (Waspada): Demi untuk keamanan warga, Pemko Medan segera merancang pembuatan kartu tanda penduduk (KTP) yang diberi-chip secara gratis untuk mempermudah pendeteksian identitas warga. Jika terlaksana, maka ibukota Provinsi Sumatera Utara ini yang pertama di Indonesia menerapkan program administrasi kependudukan tersebut. Hal itu disampaikan Walikota Medan Rahudman Hara-

Ketiga KPUD tersebut yakni, Kabupaten Mandailing Natal, Kota Tebing Tinggi dan Kota Tanjung Balai. Hal itu terungkap dalam pertemuan Komisi II DPR-RI dengan Gubsu H Syamsul Arifin,Wakil Gubsu Gatot Pujonugroho, Kapolda Sumut Irjen Pol Oegroseno dan perwakilan Pangdam I Bukit Barisan, di Kantor Gubsu, Jumat (15/10). Ketua rombongan Komisi II DPR-RI Chairuman Harahap yang menerima laporan tiga KPUD ini berjanji membahas masalah tersebut di tingkat pusat. Lanjut ke hal A2 kol. 6

hap setelah melakukan pertemuan dengan Kapoldasu Irjen Pol. Oegroseno, Jumat (15/10), yang sebelumnya mendesak Pemko untuk segera menerapkan KTP ber-chip tersebut. Pada kesempatan itu, Kapoldasu juga mengatakan pelayanan kepengurusan Surat Izin Mengemudi (SIM) juga dapat mencontoh pembuatan KTP yang diberikan gratis oleh Pemko.

Lanjut ke hal A2 kol. 3

Pedagang Aksara Cegat Wakil Walikota

Waspada/Surya Efendi

KUNJUNGI JAMAAH CALON HAJI: Gubsu H Syamsul Airifn, SE mengunjungi jamaah calon haji Kloter 5 asal Langkat dan Medan di Asrama Haji, Jumat (15/10). Gubsu berfoto bersama jamaah calon haji berusia lanjut dan mengenakan kursi roda.

Transformasi Diri ‘There were tens of thousands of pilgrims, from all over the world … We are all participating in the same ritual, displaying a spirit of unity and brotherhood that my experiences in America had led me to believe never could exist between the white and non-white … [W}hat I have seen, and experienced, has forced me to rearrange much of my thought-patterns previously held, and to toss aside some of my previous conclusions’. (Malxolm X, 1965). TERDAPAT puluhan ribu jamaah haji berasal dari seluruh penjuru dunia. Kami semua berpar-tisipasi dalam ibadah yang sama, menampilkan semangat persatuan dan persaudaraan yang menurut pengalaman saya di Amerika Serikat tidak mungkin terjadi antara kaum kulit putih Lanjut ke hal A8 kol. 1

BACA DI HALAMAN DALAM Limbah Ternak Babi Penuhi Parit Limbah berupa kotoran ternak babi di Kec. Medan Denai masih memenuhi saluran parit. A5

Pencemaran Sei Padang Dikecam Dengan pencemaran air Sei Padang yang dilakukan Pabrik Kelapa Sawit Kebun Pabatu PTPN IV, menimbulkan reaksi keras dari masyarakat Tebingtinggi. B1

Anggota Polsek Kutalimbaru Tewas Di Kamar Hotel MEDAN (Wapada): Diduga penyakit jantungnya kambuh, seorang anggota Polsekta Kutalimbaru ditemukan tewas di salah satu kamar hotel di Jalan Anggrek Jaya Simpang Selayang Kec. Medan Tuntungan, Jumat (15/10). Oleh petugas Polsekta Delitua, mayat Bripka Usaha Julius Barus segera dibawa ke rumah sakit untuk divisum.

Informasi yang diperoleh di kepolisian menyebutkan, Bripka Usaha Julius Barus ditemukan tewas tergeletak di kamar 11 Hotel Vijay sekira pk 15:00. Beberapa jam sebelumnya, korban masih terlihat segar. Namun, tak berapa lama kemudian, petugas room-boy menemukan korban telah meninggal dunia. Petugas Polsekta Delitua

telah memintai keterangan dua orang saksi. Kapolsekta Kutalimbaru AKP Bambang Rubianto yang dikonfirmasi Waspada membenarkan anggotanya meninggal dunia di salah satu kamar hotel. “Bripka Usaha Julius Barus adalah bintara yang bertugas di SPK Polsekta Kutalimbaru dan meninggal karena sakit dan

Lanjut ke hal A2 kol. 3

Warga Medan Terkurung Macet Kondisi kemacetan kendaraan di Kota Medan semakin parah. Kondisi ini terjadi setiap hari. A4

Arab News

PARA pendorong kursi roda menunggu orang yang membutuhkan mereka di bawah Jembatan Misfala di Makkah.

MEDAN (Waspada): Wakil Walikota Medan Dzulmi Eldin dicegat para pedagang Pasar Aksara Medan saat meninjau kebersihan pasar tersebut bersama Tim Adipura Kota Medan, Jumat (15/10). Para pedagang melakukan aksi protes dan curhat kepada Wakil Walikota, karena mendapat perlakuan berbeda-beda. Selain itu, para pedagang mengeluh dan menganggap kunjungan Wakil Walikota Medan hanya sebatas seremonial sehingga membuat pengelola pasar takut hingga menyulap pasar

Mumpung Masih Muda

Jembatan Misfala, Makkah Jadi Tempat Tinggal MESKI mendorong jamaah jompo, cacad atau sakit dengan kursi roda adalah pekerjaan yang tidak menarik, sebagian warga Saudi di Makkah menjadikan itulah satusatunya jalan untuk menjadikan hidup terhormat guna menghidupi dirinya dan keluarga. Berpangkalan di bawah Jembatan Misfala di kawasan Makkah Pusat, sejumlah pria meminta bayaran kecil untuk mengangkut para jamaah jompo yang akan pergi ke Masjidil

tidak ditemukan tanda yang mencurigakan di tubuh korban,” jelas Bambang Rubianto. Namun, AKP Bambang Rubianto tidak mengetahui persis mengapa anggotanya itu meninggal dunia karena dirinya baru pulang menghadiri pemakaman Kapolsekta Patumbak AKP Darwin Pardede di Kab. Simalungun, Jumat siang. (cat)

Warung Depan Terminal Amplas Manyomak

AP

Ronaldinho Pede Lagi

MEMILIKI orang tua yang mapan serta lebih menganjurkan memanfaatkan penggunaannya untuk kegiatan ibadah, menggugah semangat dan kemauan perempuan bernama Azli Rizki Wasila Fachrial,20, mahasiswi Fakultas Kedokteran UISU ini melaksanakan ibadah haji ke tanah suci. Puteri pasangan Aidil Fachrial SH dan Riza Ferilinda SPd ini tercatat sebagai Calhaj termuda asal Kota Medan yang bergabung dalam kloter 5, berangkat ke tanah suci, Jumat (15/10). “Sejak kecil orang tua saya memberikan bimbingan dan arahan bagaimana sebaiknya memanfaatkan uang yang

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 2

Warga Aceh Dihukum Gantung Di Malaysia KUALA LUMPUR (Waspada): Fakhrurazi Hasan, 34, seorang warga negara Indonesia (WNI) asal Aceh diganjar hukuman gantung sampai mati oleh Mahkamah Tinggi Malaysia, Jumat (15/10), karena membawa ganja seberat 2,681 Kg ganja. Jaksa Penuntut Umum di Mahkamah Tinggi Sultan Salahuddin Abdul Aziz Shah, Shah Alam, Selangor, Malaysia,

Lanjut ke hal A2 kol. 1

MILAN ( Waspada): Rasa percaya diri (pede) playmaker AC Milan Ronaldinho Gaucho bangkit lagi, kendati dirinya sedang diterpa rumor bakal cabut dari San Siro. “Kontrak saya memang hampir kadaluarsa, tapi saya tidak khawatir,” ujar Ronaldinho, seperti dilansir Goal, Jumat (15/10).

Lanjut ke hal A2 kol. 6

menjadi tertata. “Biar bapak tau, karena bapak datang kemari di sini jadi rapi. Kalau bapak tidak ada, pasar ini amburadul. Didepan toko saya ini, ada buka lapak lagi, Pak, sampai lima meter ke depan. Ini karena bapak kemari aja, lapak itu gak ada bersih semua,” keluh seorang pedagang bersama beberapa rekannya pada Eldin. Pedagang lainnya menunjukan pos satpam yang berada di antara lantai I dekat tangga

erampang Seramp ang

Waspada/Anum Saskia Antara AZMI Rizki Wasila,20 (kiri) calhaj termuda asal Medan.

- KTP pake chip sekalian ATM? - He.... he....he....

P.Sidimpuan 19-30 0C

R.Prapat 25-34 0C

Penyabungan 19-30 0C

Berastagi 18-280C

Sibolga 21-33 C

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 25-34 0C

0

Hujan guntur

BMKG Polonia

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

SABTU, Pahing, 16 Oktober 2010/8 Zulqaidah 1431 H z No: 23298 * Tahun Ke-64

Terbit 20 Halaman (A1-12, B1-8) z zHarga Eceran: Rp 2.500,-

Kapolri Harapkan Penggantinya Tuntaskan Kasus Century

MANOKWARI (Antara): Kapolri Jenderal Pol Bambang Hendarso Danuri berharap, Komjen Pol Timur Pradopo yang kelak menggantikannya bisa turut serta menuntaskan kasus Bank Century. “Ini tentunya jadi agenda Pak Timur, tapi semua dalam ‘track’ untuk diselesaikan semua kasus Century ini,” kata Bambang Hendaso ketika ditemui di Manokwari, Papua Barat, Jumat (15/10), di sela-sela kunjungan Presiden Susilo Bambang Yudhoyono untuk meninjau korban banjir bandang di kawasan itu. Bambang Hendarso menjelaskan, Polri bisa bekerja untuk mengusut dugaan tindak pidana perbankan atau pencucian uang dalam kasus Century. Dia juga menegaskan, Polri bisa berperan dalam upaya pengembalian aset bank tersebut yang sekarang berada di luar negeri. Menurut Bambang Hendarso, Polri telah berusaha maksimal dalam mengusut kasus itu. Polri kini harus fokus dalam menyelesaikan sisa-sisa kasus Bank Century yang belum tuntas. Selain kasus Century, Bambang Hendarso juga menegaskan Polri hendaknya tetap waspada untuk mencegah dan menindak tegas tindak pidana terorisme. Oleh sebab itu Polri perlu bekerjasama dengan instansi terkait untuk menumpas aksi teror yang masih ada hingga saat ini. Bambang Hendarso juga berharap Polri di bawah kepemimpinan Timur Pradopo semakin menjadi mitra masyarakat yang humanis dan dapat mereformasi diri menjadi lebih baik. “Yang jelas, dengan prioritas yang ada ini bisa terukur, bisa dirasakan masyarakat dan diawasi DPR dan masyarakat,” katanya. Lanjut ke hal A2 kol 7

Harian Umum Nasional Terbit Sejak 11 Januari 1947

KPUD Tebingtinggi, Madina Dan Tanjungbalai Tunggu Dana Pilkada Ulang

Antara

TEMPAT KELAHIRAN NABI MUHAMMAD. Sejumlah jamaah calon haji berkumpul di samping sebuah bangungan tempat Nabi Muhammad SAW dilahirkan di sekitar Masjidil Haram, Makkah, Jumat (15/10). Tempat tersebut telah menjadi perpustakaan yang saat ini masih ditutup sementara untuk umum.

MEDAN (Waspada): Komisi Pemilihan Umum Daerah di tiga kabupaten/kota Sumatera Utara yang harus menggelar Pilkada ulang dalam waktu dekat, masih menunggu dana yang seyogyanya disiapkan pihak eksekutif, setelah Mahkamah Konstitusi mengeluarkan putusan sela mengulang Pilkada. Sementara, pihak eksekutif hingga kini belum memberi jawaban. Ketiga KPUD tersebut yakni, Kabupaten Mandailing Natal, Kota Tebingtinggi dan Kota Tanjungbalai. Hal itu terungkap dalam pertemuan Komisi II DPRRI dengan Gubsu H Syamsul Arifin, Wakil Gubsu Gatot Pujonugroho, Kapolda Sumut Irjen Pol Oegroseno dan perwakilan Pangdam I Bukit Barisan, di Kantor Gubsu, Jumat (15/10). Ketua rombongan Komisi II DPR-RI Chairuman Harahap yang menerima laporan tiga KPUD ini berjanji membahas masalah tersebut di tingkat pusat. Sebab, sesuai UU Nomor 32 Tahun 2004 tentang Pemerintahan Daerah, tanggung jawab pendanaan Pilkada ulang di daerah berada di tangan pemerintah kabupaten/ kota. “Masalah ini harus segera diselesaikan. Karena Menteri Dalam Negeri sudah menegaskan, tanggungjawab dana Pilkada ulang ada di tangan Pemda. Tapi kalau seperti ini kondisinya, kita harapkan Gubsu bisa menjembataninya sehingga pelaksanaan demokrasi di tiga daerah tersebut bisa berlangsung aman, tertib dan lancar,” ucap Harahap. Gubsu mengaku, kendala dana Pilkada ulang di tiga daerah itu akibat kemampuan keuangan daerah yang terbatas. Begitu pun Gubsu memastikan pemecahan Lanjut ke hal A2 kol 1

Fatwa MPU Aceh:

Membiarkan Pemurtadan Haram

BANDA ACEH (Waspada): Maraknya praktik pendangkalan akidah dan permurtadan di beberapa daerah Provinsi Aceh telah menimbulkan kerawanan dan keresahan masyarakat. Dalam sidang paripurna V Majelis Permusyawaratan Ulama (MPU) Aceh mengeluarkan fatwa disertai rekomendasi, di antaranya membentuk satgas pengawasan pendangkalan akidah dan pemurtadan.

Ketua MPU Aceh H. Muslim Ibrahim, MA menerangkan, sidang Dewan Paripurna Ulama yang ke-5 di Banda Aceh selama tiga hari tersebut diikuti MPU se-Aceh, melahirkan tiga fatwa dan dua rekomendasi, “Salah satu fatwa

menjelaskan, membiarkan pendangkalan akidah dan pemurtadan umat Islam adalah haram,” ujarnya, Jumat (15/ 10) usai penutupan sidang paripurna ulama kelima. Sedangkan rekomendasi yang dilahirkan dari sidang

paripurna diantaranya pembentukan satgas dari MPU serta membentuk tim dakwah terpadu, untuk penguatan akidah Islamiah dalam penanggulangan pendangkalan akidah pemurtadan, juga mengupayakan peningkatan

peran ormas/OKP Islam dalam pembinaan dan pengawasan akidah umat. Muslim Ibrahim mengatakan, akibat meluasnya upaya pendangkalan akidah dan pemurtadan, dikhawatirkan akan menjurus kepada sikap

anarki masyarakat dan disharmonisasi, untuk itu perlu menetapkan fatwa dan rekomendasi/taushiah tentang hukum pendangkalan akidah dan pemurtadan. Adapun rekomendasi untuk Pemerintah Aceh dari

hasil sidang dikatakan Muslim Ibrahim, Pemerintah Aceh harus mengambil tindakan tegas terhadap NGO/LSM yang melakukan kegiatan pendangkalan akidah di Aceh, dan

Lanjut ke hal A2 kol 2

Presiden Pastikan Bangun Hunian Bagi Pengungsi Wasior MANOKWARI (Antara): Presiden Susilo Bambang Yudhoyono memastikan, pemerintah akan membangun tempat tinggal sementara bagi para pengungsi dan korban banjir bandang di Wasior, Papua Barat, yang terjadi beberapa waktu lalu. “Pemerintah menetapkan akan membangun hunian sementara itu,” kata Presiden Susilo Bambang Yudhoyono dalam keterangan pers di Bandara Rendani, Manokwari,

Papua Barat, Jumat (15/10). Presiden berada di bandara tersebut untuk bertolak kembali ke Jakarta, setelah meninjau korban dan lokasi banjir bandang di Manokwari dan Wasior selama dua hari. Kepala Negara menegaskan, hunian sementara itu akan lebih baik dari lokasi pengungsian yang sekarang ditempati oleh para pengungsi.

Lanjut ke hal A2 kol 3

Waspada/Surya Efendi

KUNJUNGI JAMAAH CALON HAJI: Gubsu H Syamsul Airifn, SE mengunjungi jamaah calon haji Kloter 5 asal Langkat dan Medan di Asrama Haji, Jumat (15/10). Gubsu berkesempatan berfoto bersama para jamaah calon haji berusia lanjut dan mengenakan kursi roda. Bupati Langkat Ngogesa Sitepu bersama isteri turut menunaikan ibadah haji ke tanah suci Makkah tahun ini.

‘Mumpung Masih Muda” MEMILIKI orang tua yang mapan serta lebih menganjurkan memanfaatkan penggunaannya untuk kegiatan ibadah, menggugah semangat dan kemauan perempuan bernama Azli Rizki Wasila Fachrial,20 (foto), mahasiswi Fakul-tas Kedokteran UISU ini me-laksanakan ibadah haji ke tanah suci. Puteri pasangan Aidil Fachrial SH dan Riza Ferilinda SPd ini tercatat

sebagai Calhaj termuda asal Kota Medan yang bergabung dalam kloter 5, berangkat ke tanah suci, Jumat (15/10). “Sejak kecil orang tua saya memberikan bimbingan dan arahan bagaimana sebaiknya memanfaatkan uang yang kita miliki untuk kegiatan keagamaan. Kebetulan saya suka menabung dan mengumpulkan

Lanjut ke hal A2 kol 4

PBNU Tegaskan Tidak Terlibat Rencana ‘Penggulingan’ SBY PDIP Tidak Ikut-ikutan JAKARTA (Waspada): Pengurus Besar Nahdlatul Ulama (PBNU) menyatakan, tidak terlibat dalam rencana aksi “penggulingan” pemerintahan Susilo Bambang Yudhoyono (SBY) dan Wakil Presiden Boediono pada 20 Oktober . Ketua Umum PBNU, Said Agil Siraj usai diterima Wakil Presiden Boediono di Jakarta, Jumat (15/10)mengatakan, ruangan di lantai 8 Kantor PBNU memang disewakan untuk menggelar rapar-rapat.

Transformasi Diri Oleh Nur A. Fadhil Lubis (Rektor IAIN–SU)

Lanjut ke hal A8 kol 1

Lanjut ke hal A2 kol 6

Mendiknas: Mahasiswa Miskin Berprestasi Wajib Kuliah Rektor Unsyiah Dan Unimal Dilantik BANDA ACEH (Waspada): Pelantikan dua rektor universitas di Aceh oleh Menteri Pendidikan Nasional Prof Dr Ir Mohammad Nuh, DEA diwarnai aksi demonstrasi belasan mahasiswa, Jumat (15/10). Prof. DR Darni M. Daud, dilantik sebagai Rektor

Universitas Syiah Kuala (Unsyiah) dan Apridar, MSi selaku rektor Universitas Malikulsaleh (Unimal). Aksi belasan mahasiswa ini dimulai sejak pukul 09:30 bersamaan dengan pelantikan dan pengambilan sumpah jabatan Darni M. Daud selaku

Ibu Dan Anak Tewas Digorok Perampok

DAMPAK HAJI

‘There were tens of thousands of pilgrims, from all over the world … We are all participating in the same ritual, displaying a spirit of unity and brotherhood that my experiences in America had led me to believe never could exist between the white and non-white … [W}hat I have seen, and experienced, has forced me to rearrange much of my thought-patterns previously held, and to toss aside some of my previous conclusions’ (Malxolm X, 1965). Terdapat puluhan ribu jamaah haji berasal dari seluruh penjuru dunia. Kami semua berpar-tisipasi dalam ibadah yang sama, menampilkan semangat persatuan dan persaudaraan yang menurut pengalaman saya di Amerika Serikat tidak mungkin terjadi antara kaum kulit putih

“Ruangan di lantai 8 itu memang disewakan. Itu tidak terkait dengan PBNU. Kalaupun kita tahu rapatnya soal itu, kita akan larang,” kata Said. S e m e n t a r a i t u , Ke t u a PBNU, Slamet Effendi Yusuf menegaskan, PBNU menolak aksi inkonstitusional “menggulingkan” pemerintahan Presiden Susilo Bambang Yudhoyono dan Wakil Presiden Boediono.

Antara

BOCAH WASIOR. Seorang bocah bersepeda di depan bangunan yang ambruk akibat terjangan banjir bandang beberapa waktu lalu di Wasior Papua Barat, Kamis (14/10). Banjir bandang yang menerjang kawasan itu mengakibatkan ratusan korban jiwa dan dan ribuan lainnya kehilangan tempat tinggal karena rumah dan bangunan yang porak poranda.

GOTONG: Seorang wali murid menggotong anaknya yang kserurupan dari SMAN I Bireuen, Jumat (15/10), hendak membawa pulang.

GUNUNGTUA (Waspada): Mengingat menjamurnya warung internet (Warnet) di wilayah Kabupaten Padanglawas Utara, Dinas Pendidikan dan Satpol PP setempat diminta agar mengawasi para pelajar yang masuk Warnet pada jam belajar. Demikian dikatakan anggota DPRD Paluta Ashar Ependi Hasibuan, Jumat (15/10) di Gunungtua. “Pihak terkait, khususnya Dinas Pendidikan

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 3

Waspada/Sori Parlah

Awasi Pelajar Dan PNS Masuk Warnet

Lanjut ke hal A2 kol 3

Rp500 Juta APBD Taput TTersedot ersedot Untuk Parpol

PEKANBARU ( Waspada): Kawanan perampok di Indonesia, kini makin mengganas dan semakin tidak mengenal belas kasihan. Seperti yang terjadi di Riau, seorang janda berusia 35 tahun dan putrinya Fitri Ayu,9, menjadi korban kebiadaban para bandit. Keduanya tewas dengan cara digorok oleh pelaku hingga nyaris putus Aksi kejahatan yang terjadi di kompleks Graha Garuda Permai, Kelurahan Simpang Baru, Kecamatan Tampan, Pekanbaru, Riau, Jumat (15/10) dini hari, selain membunuh, para perampok menggondol sepadamotor dan uang korban. Sedangkan,

WARNET: Seorang pelajar sedang bermain internet di salah satu warung internet saat jam belajar, Jumat (15/10) pagi.

rektor Unsyiah untuk masa jabatan yang kedua kalinya. Acara itu berlangsung di Gedung AAC Dayan Dawood, Darussalam. Para mahasiswa yang dikoordinir Sopian itu menuntut

Waspada/Abdul Mukthi Hasan

Puluhan Siswi Kesurupan BIREUEN (Waspada): Mengatasi gangguan kesurupan siswi SMAN-1 Bireuen yang sudah berlangsung seminggu, ketua OSIS bersama 1.496 siswa-siswi dan seluruh dewan guru menggelar baca Yasin bersama di halaman SMAN1 Bireuen, Jumat (15/10). Acara baca Yasin bersama yang dimulai pukul 08:00. Setelah satu jam lebih membaca Yasin bersama, sekira pukul 09:00 dikejutkan dengan jeritan histeris puluhan

TARUTUNG (Waspada): Pemkab Tapanuli Utara untuk tahun anggaran 2010 harus memplot dana sebesar Rp500 juta lebih untuk dana pembinaan partai politik (Parpol) hasil Pemilu tahun 2009-2014. Besaran dana tersebut akan diplot selama lima tahun (satu periode) sepanjang tidak ada perubahan dalam PP 05/2009, tentang bantuan keuangan kepada Parpol. Demikian ditegaskan

Lanjut ke hal A2 kol 6

Serampang - Pening pikirkan dana Pilkada ulang ... - He.... he....he....

Berita Utama

A2

AMI Turunkan 25,9 Persen Kasus Malaria Di Madina

Tgk Abrar Muda Lepaskan Anak Harimau Demi Pelestarian AUUUM harimau Sumatera (Panthera Tigris Sumatera) yang menggema di Gampong Titi Poben, Kecamatan Trumon Timur, Kabupaten Aceh Selatan, Kamis (14/10) sekira pukul 14.00 wib, mendadak terhenti, ketika seekor anak harimau lari dan menghilang ke semak-semak di desa setempat. Auman itu ternyata suara seekor harimau betina yang sedih bercampur marah akibat anaknya terjerat jaring babi beberapa jam sebelumnya. Namun ketika anaknya dilepaskan, sang induk berhenti mengaum karena mengetahui anaknya selamat. Menurut Camat Trumon Timur H. Lahmuddin, S.Sos yang dihubungi Waspada Jumat sore kemarin, anak harimau yang terjerat jeratan babi itu dilepas mantan GAM Wilayah Lhok Tapaktuan Tgk Abrar Muda yang datang ke lokasi bersama Unsur Muspika setempat. Abrar kata Lahmuddin, nekad melepaskan harimau karena warga resah akibat auman sang induk itu. Meski sebelumnya dilarang Muspika dengan dalih bisa mengancam keselamatan. “Tetapi Tgk Abrar tidak peduli resiko mengingat keselamatan warga,”sebut Lahmuddin. Tragedi yang menimpa anak harimau itu berakhir. Dari atas sebatang pohon sejarak lima meter, Abrar berhasil menumbangkan kayu pancang pengikat jerat babi, melalui sebatang galah sepanjang lima meter yang diikat pisau di ujungnya. “Anak harimau itu lepas dengan membawa jeratan babi ke semak belukar bersama sepotong kayu yang terikat jeratan babi itu,”tambah Lahmuddin seraya menyebutkan, para warga menjadi lega dengan lepasnya anak harimau tersebut. Selain mengakhiri keresahan warga, motif pelepasan anak harimau itu juga sebagai pelestarian binatang langka yang dilindungi. Apalagi harimau tersebut, meski sering berkeliaran di pemukiman, tetapi sejauh ini belum pernah mengganggu penduduk termasuk ternak warga. Karenanya menurut Lahmuddin tak ada alasan membiarkan seekor anak harimau, mati kesakitan terjerat jeratan babi. “Kita harus melindungi binatang langka, sepanjang binatang berbelang itu tidak mengganggu manusia.” Hal serupa juga dilakukan warga Gampong Lhok Sialang Rayeuk, Kec. Pasie Raja, Aceh Selatan, beberapa waktu lalu. Bedanya, anak harimau di desa ini terperangkap dalam kandang ayam dan pemilik kandang ayam bersama warga setempat melepas kembali anak harimau tersebut. Sebagaimana diberitakan harian ini sebelumnya, seekor anak harimau yang masih menyusui ditemukan terperangkap jaring babi di Gampong Titi Poben, Kec. Trumon Timur, Kamis (14/10) siang. Si raja hutan itu selamat setelah dilepas Tgk Abrar Muda. (b19)

KPUD Tebingtinggi ....

masalahnya akan dibicarakan dengan Mendagri. “Melalui Mendagri, kita akan minta agar daerah perlu diingatkan untuk mencadangkan dua kali dana Pilkada. Sehingga saat terjadi Pilkada ulang, dananya sudah tersedia. Dan bila tidak, maka bisa dikembalikan ke kas daerah,” jelas Gubsu. Pola pendanaan seperti ini diharapkan Gubsu bisa diakomodir Kabupaten Karo yang segera menggelar Pilkada pada 27 Oktober 2010 dan Kabupaten Nias Selatan pada 2 Desember 2010. Sebelumnya, Ketua KPU Sumut, Irham Buana Nasution menjelaskan, anggota KPUD di tiga daerah tersebut mengaku resah menghadapi respon eksekutif di wilayah masingmasing yang kurang tanggap mengalokasikan dana Pilkada ulang. Padahal, setiap muncul kendala atau masalah dalam pelaksanaan Pilkada, justru KPUD yang disalahkan, bukan eksekutif. Irham mengungkapkan, dari tiga daerah itu baru Pemkab Madina dan Pemko Tebing Tinggi saja yang sudah menya-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. 2. 3. 4.

......, b3. h4, Baxa4. Gxb3, Bec4+. Gc2, Ba1+mat. (Jika 1. ......., Bxa4. 2. GxB, b3. 3. Bc4, BxBc4+. 4. Bc2, BxG. 5. Rc1, Ba1+mat)

Jawaban TTS: TTS Topik

A I D A R N M O L A S K D R A R I S D A F G A A Y N A S I N T R I

Musik & Filem

S A S K H U A Y A N R T A R I I L E L A I N S P A N K P I E M A T N D H O

I A P K A G S A R I I I O S C A G N G K L U N A U E R T A C U S O U M T A N G O S Y N O G R A F I N C G A M E L A

G I T A R G

N

Jawaban Sudoku: 9 1 5 8 4 0 7 2 6 3

4 6 1 3 9 2 8 5 7 0

7 0 4 2 6 1 9 3 8 5

2 3 7 0 8 5 1 6 4 9

5 8 9 6 3 7 0 4 1 2

8 4 0 5 7 9 2 1 3 6

3 9 8 1 5 4 6 0 2 7

0 5 3 7 2 6 4 8 9 1

6 7 2 4 1 3 5 9 0 8

1 2 6 9 0 8 3 7 5 4

takan kesiapan menampung dana Pilkada ulang pada APBD. “Kedua daerah itu menyatakan kesanggupan menampung dananya pada APBD. Tapi masih belum jelas apakah pada APBD murni atau pada P-APBD 2011. Yang pasti, Pilkada ulang di dua daerah ini akan digelar tahun depan,” beber mantan Direktur LBH Medan ini. Kebutuhan dana Pilkada ulang di Kabupaten Madina dan Kota Tebing Tinggi antara Rp4,5 miliar sampai Rp5 miliar. Sementara Pilkada ulang Kota Tanjung Balai yang membutuhkan dana sekitar Rp1,57 miliar, sampai kini belum ada kejelasan. (m19)

Membiarkan ....

menyusun buku panduan sebagai pedoman tentang tatacara berkehidupan dan kultur masyarakat Aceh bagi wisatawan dan non-muslim. Sementara itu, Wakil Ketua MPU Aceh H Gazali Mohd Syam mengatakan, masuknya ajaran sesat dan pendangkalan akidah, setelah Aceh mengalami bencana tsunami, sehingga peluang untuk mempengaruhi masyarakat Aceh sangat besar. “Pendangkalan akidah dan pemurtadan dilakukan melalui makanan, pakaian, dan dana, itulah cara yang dilakukannya untuk menjerumuskan masyarakat Aceh,” terang Gazali. Sebelum bencana tsunami, Aceh dikenal tertutup sehingga pihak yang ingin mempengaruhi bangsa Aceh sangat sulit dicapai. Oleh karena itu MPU di tingkat dua kabupaten/kota harus gencar mengawasi hal-hal yang dianggap melenceng dari ajaran agama Islam, jika terjadi segera berkoordinasi dengan MPU provinsi untuk diambil tindakan. (gto)

Awasi Pelajar ....

Kabupaten Paluta dan Satpol-PP diminta agar proaktif untuk terus mengawasi para pelajar yang bolos ke warung internet,” kata Hasibuan. Dikatakannya, bukan untuk pelajar saja, PNS di Kabupaten Padanglawas juga masih banyak yang bolos pada jam kerja dan berada di warnet. Untuk itu, pengawasan seperti ini sudah memang pantas untuk dilakukan demi terciptanya Paluta yang cerdas dan disiplin. Menurut dia, Satpol-PP dan Dinas Pendidikan mesti melakukan razia. Sebab, pada jam kerja dan belajar, para PNS Pemkab Paluta banyak yang nongkrong di beberapa warnet di wilayah Paluta Untuk itu, Pemkab Paluta melalui Dinas Pendidikan, imbuh dia, mesti memberikan imbauan atau penegasan kepada pengelola warnet agar tidak menerima pelajar berseragam saat jam-jam pelajaran. (csp)

WASPADA Sabtu 16 Oktober 2010

Waspada/H.AR Djuli

DIGOTONG: Para siswa dan siswi sedang menggotong puluhan temannya yang bertumbangan kesurupan saat membaca Yasin bersama di halaman sekolah Jumat (15/10) untuk diberikan pertolongan di ruang kantor dan ruang kelas kelas.

MELALUI Program Annual Malaria Incidence (AMI) yang dilaksanakan Pemerintah Kabupaten Mandailing Natal melalui Kantor Pusat Penanggulangan Malaria dari tahun 2008-2009, berhasil menurunkan persentase kasus penyakit malaria di daerah itu hingga 25,9 persen. Itu sesuai laporan evaluasi dan hasil kegiatan penanggulangan penyakit malaria tahun 2009 oleh Kakan Pusat Penanggulangan Malaria Kabupaten Madina Arifin Fauzi Lubis kepada Bupati Madina nomor: 443.41/048/KPPM/ 2010 tanggal 3 Februari 2010. Secara rinci dijelaskan, kasus penderita penyakit malaria di Madina tahun 2008 tercatat 12.175 kasus dari 423.714 jiwa penduduk dengan persentase AMI 28,73 per seribu. Kemudian tahun 2009 sebanyak

9.671 kasus malar ia dar i 429.888 jiwa dengan persentase AMI 22,5 perseribu. Itu berarti AMI 2008 ke 2009 mencapai 6,23 persen (28,73 perseno-22,5 perseno). Kemudian, dari 23 kecamatan di Madina, satu kecamatan yakni Kecamatan Hutabargot berada dalam endemis tingkat tinggi (zona merah). Kemudian 14 kecamatan di tingkat endemis sedang (zona kuning) meliputi Kecamatan Suabu, Bukit Malintang, Naga Juang dan Panyabungan Utara. Selanjutnya Kecamatan Panyabungan Barat, Panyabungan Selatan, Lembah Sorik Marapi, Puncak Sorik Marapi, Ulu Pungkut, Natal, Batahan, dan Sinunukan. Sedangkan 8 kecamatan dengan endemis rendah (zona hijau) meliputi Kecamatan Tambangan, Kota-

nopan, Muarasipongi, Batang Natal, Pakantan, Lingga Bayu, Muara Batang Gadis, dan Ranto Baek. Program AMI merupakan indikator untuk mengetahui dan menghitung jumlah kasus malaria klinis selama satu tahun di suatu wilayah perseribu penduduk. Dengan program AMI itu, perkembangan penderita malaria dapat diketahui. Kemudian dapat mengetahui keberhasilan penatalaksanaan dan penanggulangan malaria, serta sebagai bahan acuan program penatalaksanaan dan penanggulangan malaria pada tahun berikutnya berdasarkan jumlah kasus malaria selama satu tahun, dibagi jumlah penduduk dalam satu tahun, kemudian dikali perseribu. (csh)

siswi jatuh bertumbangan kesurupan lagi. Gangguan kesurupan itu tidak menyurutkan semangat para siswa-siswi dan dewan guru terus melanjutkan membaca Yasin hingga selesai. Kecuali beberapa siswa dan siswi langsung bangkit menggotong temannya yang jatuh bertumbangan kesurupan dievakuasi ke ruang kantor dan ruang belajar untuk diberikan pertolongan. Kepala SMAN-1 Drs Sofian Mahdi dalam percakapan dengan Waspada kemarin mengatakan, gangguan kesurupan yang menimpa siswi SMAN-1 Bireuen sudah berlangsung seminggu. Gangguan kesurupan itu terjadi saat upacara pagi, sedang belajar dan pada jam istirahat. “Baca Yasin yang digelar Jumat pagi sebelum jam belajar sebagai upaya untuk menangkal roh-roh jahat yang membuat puluhan siswi mengalami kesurupan, sangat mengganggu kegiatan belajar mengajar,” ujarnya. Kasek mengemukakan, gangguan kesurupan mulai melanda siswi SMAN-1 setelah penerimaan murid baru tahun ini, sebagian besar siswa-siswi berasal dari SMPN-1 Bireuen. “Sebelumnya puluhan siswi SMPN-1 Bireuen mengalami gangguan kesurupan, diduga induk kesurupan roh jahat berasal dari siswi SMPN-1 yang masuk menjadi siswi SMAN-1,” ujarnya.

Dikatakan, pihaknya bersama dewan guru akan terus berupaya menangkal gangguan kesur upan dengan membaca Yasin bersama seluruh siswa-siswi, dewan guru dan perlu meminta bantuan orang pintar untuk mengusir roh-roh jahat yang menganggu kegiatan nelajar mengajar para siswi SMAN-1 Bireuen. Pengamatan Waspada, beberapa kalangan orang tua siswa antara lain Abdullah pegawai PLN dan beberapa orang lainnya datang ke sekolah menjemput anaknya yang mengalami kesurupan dibawa pulang ke rumahnya masing-masing. Di Idi Peristiwa serupa juga terjadi secara bersamaan di Idi. Saat yasinan, puluhan siswi SMP Negeri 1 Kota Idi, sekira pukul 09:00 kemarin, kesurupan. Akibatnya, proses belajar mengajar (PBM) terganggu, bahkan seluruh pelajar diperintah pulang lebih cepat. Informasi yang diperoleh kemarin menyebutkan, awalnya sekira pukul 08:00, hampir 1.000 pelajar tingkat menengah di sana menggelar baca surat yasin, karena dalam beberapa hari terakhir, beberapa siswi mulai diserang kekuatan lain hingga mengalami kesurupan. Setengah jam berjalannya yasinan bersama di halaman SMP Negeri 1 Idi, tiba-tiba Winda, siswi kelas II/8 berteriak histeris. Di tengah suasana yasinan itu, puluhan siswi

yang mendengar bangun membantu Winda yang tibatiba diserang mahkluk halus. Beberapa menit setelah Winda dievakuasi ke ruang guru, yasinan yang dipimpin oleh guru Bidang Study PAI dibubarkan. Setelah seluruh siswi masuk ke ruangan, tibatiba terdengar teriakan histeris dari ruang II/8. Suasana belajar beubah menjadi kecemasan dan ketakutan terhadap pelajar lainnya di ruangan. Setelah didatangkan beberapa orang pintar, puluhan siswi yang kesurupan sembuh dan diantar ke rumahnya. Hingga menjelang ibadah shalat Jumat, siswi yang kesurupan dapat disembuhkan, kecuali tiga siswi yang mengalami gangguan mahkluk halus tergolong parah, yakni Nurbahagia, Marza dan Muzibaturrahmi. “Kami ketakutan saat ada gangguan semacam itu, sehingga tadi kami langsung diperbolehkan pulang, padahal jadwal pulang Jumat, pukul 11:00,” kata Yanti, siswi lain yang ditemui Waspada di pintu pekarangan sekolah seraya mengaku, kondisi itu mempengaruhi PBM di sekolahnya. Mardiana, S.Pd, guru SMP Negeri 1 Idi mengaku, kondisi itu terjadi dalam beberapa hari terakhir. “Mudah-mudahan gangguan seperti ini tidak lagi terjadi, sehingga PBM berjalan lancar,” katanya singkat. (b16/amh/cmad)

LSM Tak Terdaftar Dianggap Liar

Ibu Dan Anak ....

“Mumpung Masih ....

uang sedikit demi sedikit. Tadinya belum terpikir untuk berangkat haji, tapi ketika melihat kegiatan orang tua mengikuti manasik haji, saya jadi tertarik dan mengatakan bahwa saya juga ingin melaksanakan ibadah haji. Jelas saja orang tua saya senang, lalu menyertakan saya untuk ikut mendaftar sebagai calon jamaah haji. Kebetulan orang tua saya mempunyai rezeki untuk biaya keberangkatan ini. Saya mau orang tua mendukung dengan menambah tabungan yang saya miliki,” kata Azli Rizki. Penduduk Jalan Karya Karang Berombak ini menam-

bahkan, hal yang paling menguatkannya berangkat ke tanah suci tak lain ingin lebih menguatkan dan memantapkan iman kepada Allah. Di samping itu, menjadi seorang yang bersyukur atas rezeki yang diberikan Allah dan memanfaatkan dengan menunaikan ibadah haji. “Mumpung masih muda, karena pelaksanaan ibadah haji itu memerlukan kesiapan fisik. Insyaallah saya bisa melaksanakan rangkaian ibadah dengan baik. Mudah-mudahan Allah memberikan kemudahan bagi saya dan orang tua saya menjalankan rukun Islam kelima ini. Dan saya bermohon kepada Allah dengan

Presiden Pastikan ....

rakat bisa menempati hunian sementara itu, sambil menunggu pembangunan kembali Wasior selesai dilakukan. Presiden juga telah menyampaikan rencana pembangunan hunian sementara itu ketika berdialog dengan para pengungsi korban banjir bandang di Wasior yang kini mengungsi di Manokwari, Papua Barat. Badan Nasional Penanggulangan Bencana menampung sedikitnya 4.771 pengungsi korban banjir bandang Wasior di Manokwari, Papua Barat. Ribuan pengungsi itu tersebar di beberapa lokasi pengungsian di Manokwari. Jumlah pengungsi terbanyak ada di komplek Balai Latihan Kerja Manokwari, yaitu sebanyak 1.245 orang. Kemudian di Lapangan Kodim

Manokwari sebanyak 972 orang. Ratusan pengungsi di Lapangan Kodim Manokwari ditampung di sejumlah tenda berukuran besar. Para pengungsi itu berkumpul dalam kelompok-kelompok tertentu. Sementara itu, BNPB mencatat 2.554 orang pengungsi melakukan pengungsian mandiri, atau kembali ke keluarga masing-masing di kawasan Manokwari. Selain di Manokwar i, BNPB juga mendata 2.652 pengungsi masih bertahan di Wasior, tempat bencana banjir bandang terjadi beberapa waktu lalu. Mereka tersebar di enam lokasi penampungan pengungsi. BNPB juga mencatat 355 pengungsi ditampung di Nabire.

Mendiknas: ....

nyimpangan. “Kami mengharapkan agar periode kedua nanti hal ini tak terulang lagi. Kami mengharapkan adanya laboratorium, alat pratikum yang lengkap seperti mahasiswa fakultas lain,” sambung seorang peserta aksi yang lain. Sementara itu, Mendiknas Muhammad Nuh, dalam sambutan pada pelantikan kedua rektor itu mengatakan, setiap universitas ke depan, harus mengalokasikan kuota 20 persen untuk calon mahasiswa dari kalangan kurang mampu, tetapi berprestasi. Dia menganjurkan universitas untuk mencari keberadaan mahasiswa itu untuk menempuh pendidikan secara

gratis. “Tidak ada lagi alasan masyarakat miskin tak memperoleh kesempatan belajar. Universitas harus menjemput mereka,” tukasnya. Menurut mantan Menkominfo ini, secara nasional, paket beasiswa bidik misi atau beasiswa untuk mahasiswa kurang mampu tapi berprestasi diberikan untuk 200 ribu orang. Khusus untuk Unsyiah, 400 mahasiswa baru dinilai juga mendapatkan beasiswa ini. “Mahasiswa inilah yang akan mengambil peran strategi di Aceh kelak. Namun yang penting semuanya harus dengan semangat tinggi,” ungkap mantan Rektor Institut Teknologi Sepuluh November (ITS) Surabaya itu. (b05)

Puluhan Siswi ....

aparat kepolisian berhasil menangkap pelaku. “Kita masih melakukan oleh TKP untuk mengumpulkan sejumlah bukti mencari tahu dari mana pelaku pertaman memasuki rumah itu,” terang Kasat Reskrim Polresta Pekanbaru, AKP Sapta Maulana Marpaung, Jumat (15/10). Aksi perampokan di rumah Ema yang merupakan seorang janda ini baru diketahui ketika kedua anaknya yang lain yakni Rikzi,11, dan si bungsu Rima, 8 , saat keduanya akan berangkat ke sekolah. (okz)

Pembangunan tempat tinggal sementara itu akan melibatkan unsur Polri dan TNI, dan warga setempat. “Sehingga ada penghasilan secukupnya bagi masyarakat setempat,” kata Presiden. Presiden mengatakan, tempat tinggal sementara itu harus memenuhi standar minimal. Hunian itu harus memiliki sanitasi yang baik dan mendapatkan air bersih yang cukup. Pemerintah akan membangun tempat tinggal sementara itu selama status tanggap darurat diberlakukan di Wasior dan lokasi di sekitarnya yang diterpa bencana banjir bandang. Masa tanggap darurat itu akan berakhir pada 31 Oktober 2010. Dengan demikian, masya-

agar rektor baru Unsyiah lebih transparan dalam mengelola keuangan kampus dimasa mendatang. Kecuali itu, mereka juga mendesak Darni M. Daud segera memperbaiki fasilitas belajar mahasiswa FKIP yang dinilai masih memprihatinkan. Demonstran itu sendiri berasal dari Fakultas Keguruan dan Ilmu Pendidikan (FKIP), yang tak lain almamater Darni M Daud sendiri. Dia menyebutkan, selama kepemimpinan Darni pada periode sebelumnya, banyak masalah kampus yang terkesan ditutupi. Dia memberi contoh, pengelolaan dana mahasiswa yang dianggap tidak transparan dan rawan pe-

TARUTUNG (Waspada): Beberapa tahun terakhir berbagai organisasi kemasyarakat seperti LSM (Lembaga Swadaya Masyarakat), fungsional pemuda, ormas keagamaan, profesi dan organisasi marga lainya menjamur di Kabupaten Taput. Kehadiran organisasi tersebut tidak sedikit menjadikan kegelisahan di kalangan masyarakat, pemerintah dan dunia usaha. Sebab fungsi dan tugasnya

jauh dari yang diatur dalam UU. Demikian komentar yang muncul di kalangan masyarakat Taput, baru baru ini. Kepala Badan Kesbang Taput Posma Sitompul, melalui Kabid Pembinaan Antar Lembaga B Purba, Jumat (15/ 10) di Tarutung mengungkapkan, LSM dan organisasi kemasyarakatan lain yang tidak ada terdaftar di Kesbang Taput adalah liar seperti yang tertera dalamUU No: 8/2005

tentang organisasi kemasyarakatan. Menurutnya, untuk tahun 2010 organisasi kemasyarakatan yang terdaftar di Taput antara lain: LSM sebanyak 34, organisasi fungsional pemuda ada 4, ormas keagamaan sebanyak 4, profesi sebanyak 5 dan organisasi marga hanya ada 2. Untuk LSM, kata Purba, tidak ada ditampung dalam APBD untuk pembinaan. (c12)

“Namun, Presiden juga harus mendengar suara rakyat yang tidak puas,” ujarnya. Slamet menambahkan, Presiden harus berani menerima kritik dari masyarakat. “Apabila Presiden tidak melakukan tindakan melanggar hukum, kami tidak setuju dengan gerakan-gerakan penjatuhan sepeti itu,” kata Slamet menegaskan. Menur ut Slamet, jika penggulingan dipaksakan, maka hanya ada dua cara, yakni revolusi dan kudeta. “Namun, kedua cara itu hanya akan merugikan rakyat banyak. Elit tidak terlalu merasakan,” tuturnya. PDIP Tidak Ikut-Ikutan PDI Perjuangan tidak ingin masuk dalam isu penggulingan pemerintahan Presiden Susilo Bambang Yudhoyono (SBY) dan Wakil Presiden Boe-

PBNU Tegaskan ....

diono. PDI Perjuangan menyarankan agar pemerintah sebaiknya menganggap wacana penggulingan itu sebagai kritik kinerja. “Kami tidak ikut-ikut da-lam hal itu. Karena bukan fokus kami di situ (isu penggulingan),” kata Puan Maharani, salah satu Ketua Dewan Pimpinan Pusat PDI Perjuangan di Kantor Pusat PDI Perjuangan, Jakarta Selatan, Jumat (15/10). Menurut Puan, PDI Perjuangan tidak akan mengomentari soal isu penggulingan yang digelontorkan sejumlah pihak. PDI Perjuangan menyarankan agar wacana itu sebaiknya tidak perlu dilanjutkan. “Dan kalaupun ada wacana seperti itu, lebih baik dihindari,” kata Puan yang didampingi Ketua Umum PDI Perjuangan Megawati Soe-karnoputri. Menurut Puan, peme-

rintah sebaiknya menganggap isu penggulingan pemerintahan itu sebagai kritik kinerja. Maka itu, kritikan terhadap kinerja pemerintah di dalam isu penggulingan itu sebaiknya dilakukan. “Itu dianggap kritik saja. Sehingga pemerintah tidak mengulangi hal itu dalam 2014,” jelas Puan. Isu penggulingan itu bersamaan dengan satu tahun pemerintahan SBY-Boediono. Aktivis dari Petisi 28 yang dipimpin Haris Rusly, pernah menyampaikan apa yang mereka sebut sebagai 28 poin kegagalan pemerintahan SBYBoediono. “Dari segi keamanan, Presiden juga gagal menciptakan rasa aman masyarakat dengan meluasnya berbagai konflik horizontal maupun vertikal,” kata Haris, Rabu 13 Oktober lalu. (VIVAnews)

segenap kerendahan hati setelah kembali nanti, lebih meningkatlah amalan-amalan yang saya lakukan, apalagi saya ini kuliah di fakultas kedokteran. Insyaallah menjadi dokter yang mengabdikan ilmu secara baik dan memenuhi harapan masyarakat terkait profesi saya kelak,” kata Azmi Rizki. (m36)

Komisi III DPR RI telah menyetujui usulan pemerintah yang mencalonkan Komjen Pol Timur Pradopo sebagai Kapolri, menggantikan Jenderal Pol Bambang Hendarso Danuri yang memasuki usia pensiun. Beberapa anggota Komisi III setuju, namun mengajukan sejumlah syarat, antara lain

Kapolri Harapkan ....

Timur harus berkomitmen menyelesaikan kasus Bank Century. Selanjutnya, Komisi III akan melaporkan hasil persetujan itu ke Badan Musyawarah atau Rapat Pengganti Bamus untuk disetujui. Jika disetujui, maka hasil persetujuan Komisi III itu akan dibawa ke Rapat Paripurna DPR pekan depan.

ni Golkar, Hanura, PKBB, PPRN, Gerindra, PIS, PDP, PDS, PDIP, Patriot, Demokrat, Buruh, Barnas, PIB dan partai Merdeka. Perhitungan pemberian dana bantuan parpol dimaksud diatur dalam PP No.5/2009, tentang bantuan keuangan kepada Parpol yakni Rp 557 juta per suara yang untuk parpol yang wakilnya ada duduk di legislatif. Dana itu akan direalisasikan dengan

sistem semester. Menurut data di Kesbang Taput, Parpol yang lebih banyak menerima dana pembinaan partai berdasarkan jumlah perolehan suara pada Pileg 2009 adalah Golkar, PDIP dan Demokrat. “Berbeda dengan pilleg tahun 2004, kata Purba, dana pembinaan parpol diberikan berdasarkan jumlah kursi di DPRD yakni Rp19 juta per kursi. (c12)

Rp500 Juta ....

Kepala Badan Kesatuan Bangsa (Kesbang) Pemkab Taput Posma Sitompul melalui Kabid Hubungan Antar Lembaga Kesbang Taput B Purba M, Jumat (15/10) di Tarutung. Kata Purba, saat ini ada 35 anggota DPRD dari 18 Parpol yang mempunyai wakilnya di legislatif yang berhak menerima dana pembinaan itu. Ke-18 Parpol tersebut yak-

Berita Utama

A2

TNI-Polri Masih Sisir Dolok Masihul Waspada/Abdullah Dadeh

USIA LANJUT: Saleha binti Abd.Gani, 72, jamaah berusia lanjut asal Langkat dibopong dua petugas Garuda Indonesia saat akan naik ke pesawat haji Corsair asal Perancis karena penyakit uzur.

Bupati Langkat ... rukun Islam kelima ini,” katanya seraya berharap bisa bertemu Calhaj asal Langkat di tanah suci karena ia juga akan berangkat menunaikan ibadah haji. Gagal Berangkat Ketua PPIH Embarkasi Medan Drs H Syariful Mahya Bandar MAP bersama Sekretaris Drs H Abd Rahman MA dan Humas Drs H Sazli mengatakan, seorang dari jamaah kloter 5 gagal berangkat karena sakit dan harus dirujuk ke rumah sakit. Yakni Ramli Lubis Bin Abu Bakar, 79. “Kelak setelah dia sembuh dan diyakini bisa berangkat, maka akan bergabung dengan rombongan lainnya. Dengan begitu, jumlah Calhaj yang berangkat hanya 454 orang,” kata Sazli. Perlu Waspada Sebelumnya Ketua PPIH Embarkasi Medan Drs H Syari-

Mumpung Masih ... kita miliki untuk kegiatan keagamaan. Kebetulan saya suka menabung dan mengumpulkan uang sedikit demi sedikit. Tadinya belum terpikir untuk berangkat haji, tapi ketika melihat kegiatan orang tua mengikuti manasik haji, saya jadi tertarik dan mengatakan bahwa saya juga ingin melaksanakan ibadah haji. Jelas saja orang tua saya senang, lalu menyertakan saya untuk ikut mendaftar sebagai calon jamaah haji. Kebetulan orang tua saya mempunyai rezeki untuk biaya keberangkatan ini. Saya mau orang tua mendukung dengan menambah tabungan yang saya miliki,” kata Azli Rizki. Penduduk Jalan Karya Karang Berombak ini menambahkan, hal yang paling menguatkannya berangkat ke tanah suci tak lain ingin lebih menguatkan dan memantapkan iman kepada Allah. Di samping itu, menjadi

Warga Aceh ... Mohammad Mustafa menyatakan menerima putusan hakim. Tetapi pengacara Fahrurazi mengajukan banding atas vonis tersebut. Dalam putusannya, hakim tunggal Badariah Sahhamid menyatakan, Jaksa Penuntut Umum mampu meyakinkan hakim bahwa terdakwa betulbetul melakukan perbuatannya dalam keadaan sadar. Karenanya, Badariah mengabulkan tuntutan JPU dengan menjatuhkan vonis maksimal. Fakhrurazi Hasan ditangkap

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

1. 2. 3. 4.

......, b3. h4, Baxa4. Gxb3, Bec4+. Gc2, Ba1+mat. (Jika 1. ......., Bxa4. 2. GxB, b3. 3. Bc4, BxBc4+. 4. Bc2, BxG. 5. Rc1, Ba1+mat)

Jawaban TTS: A I D A R N M O L A S K D R A R I S D A F G A A Y N A S I N T R I

Musik & Filem

S A S K H U A Y A N R T A R I I L E L A I N S P A N K P I E M A T N D H O

I A P K A G S A R I I I O S C A G N G K L U N A U E R T A C U S O U M T A N G O S Y N O G R A F I N C G A M E L A

G I T A R G

N

Jawaban Sudoku: 9 1 5 8 4 0 7 2 6 3

4 6 1 3 9 2 8 5 7 0

7 0 4 2 6 1 9 3 8 5

2 3 7 0 8 5 1 6 4 9

5 8 9 6 3 7 0 4 1 2

8 4 0 5 7 9 2 1 3 6

3 9 8 1 5 4 6 0 2 7

0 5 3 7 2 6 4 8 9 1

6 7 2 4 1 3 5 9 0 8

seorang yang bersykur atas rezeki yang diberikan Allah dan memanfaatkan dengan menunaikan ibadah haji. “Mumpung masih muda, karena pelaksanaan ibadah haji itu memerlukan kesiapan fisik. Insyaallah saya bisa melaksanakan rangkaian ibadah dengan baik. Mudah-mudahan Allah memberikan kemudahan bagi saya dan orang tua saya menjalankan rukun Islam kelima ini. Dan saya bermohon kepada Allah dengan segenap kerendahan hati setelah kembali nanti, lebih meningkatlah amalan-amalan yang saya lakukan, apalagi saya ini kuliah di fakultas kedokteran. Insyaallah menjadi dokter yang mengabdikan ilmu secara baik dan memenuhi harapan masyarakat terkait profesi saya kelak. Terimakasih ya Allah atas kesempatan ini dan terimakasih pada dua orang tua saya yang memberikan finanansial untuk perjalanan ibadah ini,”kata Azmi Rizki. (m36) polisi pada 7 Maret 2005 pukul 9 malam di Jalan Bandar Rawang Gombak.Terdakwa yang pada waktu itu sedang berjalan menuju ke arah restoran cepat saji dengan membawa bungkusan, berusaha membuang bungkusan yang dibawanya setelah mengetahui dirinya diikuti polisi. Setelah ditangkap, polisi mendapati bungkusan yang dibuang Fakhrurazi Hasan berisi ganja seberat 2, 681 Kg dibungkus dalam 3 kemasan terpisah. Atas perbuatannya, Jaksa Penuntut Umum menjerat Fakhrurazi dengan pasal 39 B Undang-Undang Anti Narkotika 1952 dengan hukuman gantung sampai mati. (TI)

Warung Depan ...

Jawaban Problem Catur:

TTS Topik

ful Mahya Bandar MAP dan Sekretaris Drs H Abd Rahman Harahap MA serta Humas Drs H Sazli, menghimbau para Calhaj untuk waspada dan mawas diri saat berada di tanah suci. Hal ini untuk mengantisipasi terulangnya kasus penipuan yang terjadi pada seorang Calhaj Kloter 1 asal Labuhanbatu bernama Dolla Tanjung. “Kami menghimbau para Calhaj untuk waspada dan mawas diri terhadap orang-orang yang kelihatannya ingin berbuat baik tetapi punya niat buruk. Karenanya, ketika seseorang bertanya tentang paspor Calhaj, pastilah orang itu patut dicurigai, karena paspor tidaklah dipegang oleh jamaah tetapi berada pada pemilik maktab. Hal yang tak kalah penting selalu berkordinasi dengan petugas, jika ada yang kurang dipahami langsung minta bantuan petugas,” kata Abd Rahman. (m36/h10)

1 2 6 9 0 8 3 7 5 4

yang dijual pengelola pasar kepada pedagang. Mendengar hal itu, rekan pedagang pasar lainnya juga menemui sang kepala daerah dan memberanikan diri mengajak Eldin kembali meninjau ke dalam pasar, karena banyak permasalahan yang tidak diketahuinya. “Ayola, Pak. Kita lihat lantai II. Kita lihat lagi pedagang di lantai I. Biar bapak tahu, masalah para pedagang di lantai II. Di lantai I seharusnya hanya boleh berjualan kebutuhan pokok, tapi banyak pedagang lain yang tidak menjual kebutuhan pokok malah berdagang disana,” cetusnya sembari memegang tangan Eldin untuk kembali meninjau ke dalam. Eldin pun kembali ke dalam pasar meninjau para pedagang bersama Tim Adipura, yang seharusnya memantau persiapan kebersihan pasar. Eldin sempat berang dan marah melihat seorang pedagang elektronik yang menggelar dagangannya di lantai I hingga memakan tiga toko yang dibelinya seharga Rp90 juta. “Kalian ada buka di lantai atas lagi ya. Kenapa kalian berjualan di bawah ini,” ujar Eldin kepada pedagang tersebut. Keluhan para pedagang yang sebagian besar kaum ibu tersebut hanya direspon Eldin dengan mengatakan akan segera menyelesaikan permasalahan dengan penataan pasar. “ Masalah ini akan kita bahas bersama PakWalikota nanti, kita mengerti tuntutan ibu-ibu yang ingin peraturan pengelolaan pasar ditegakkan,” jawabnya. Pantauan Waspada, para pedagang mengeluhkan tidak teraturnya pengelolaan pasar selama ini hingga menimbulkan

MEDAN (Waspada): Tim gabungan TNI dan Polri masih melakukan penyisiran terhadap sisa dari kelompok bersenjata api yang diduga masih bersembunyi di tempat pelarian mereka. “Sisa dari kelompok bersenjata tersebut masih didaerah sekitar Kabupaten Dolok Masihul, kalau sudah keluar dari batas-batas provinsi menjadi prioritas ke II,” ujar Kabid Humas Polda Sumut Kombes Pol Baharuddin Djafar kepada wartawan, Jum’at (15/10). Menurut juru bicara Poldasu ini, dalam mengantisipasi bila sudah keluar sampai ke batas-

batas propinsi Tim Gabungan akan melaksanakan razia di setiap perbatasan provinsi. Sementara tersangka yang ditangkap di Labuhan murni tidak ada yang menguasai senjata api yang ditemukan di rumah kosong milik warga. “Untuk mengantisipasinya tim gabungan akan melakukan razia disetiap perbatasan provinsi, “ beber Baharuddin. Satu tersangka yang masih dilakukan pengejaran berinisial S kemungkinan masih berkeliaran dengan memegang senjata api laras panjang. Menurut pengakuan dari tersangka yang masih menjalani pemerik-

saan intensif penyidik Dit Reskrim Polda Sumut, senjata diperoleh dari kelompok yang melakukan pelatihan ala militer di Jantoh, Aceh. “Satu tersangka berinisial S masih memegang senjata laras panjang dari pengakuan tersangka yang masih menjalani pemeriksaan, “ jelasnya. Tim Densus 88 Anti Teror, lanjut Baharuddin, dalam melakukan pengembangan terhadap kelompok bersenjata api dari target operasi dan jaringan yang telah melakukan penggerebekan terhadap pelatihan kelompok bersenjata di Jantoh Aceh. (m39)

Penjambret Nyaris Dibakar Massa KISARAN (Waspada): Seorang pria diduga penjambret nyaris dibakar masa.Beruntung, aparat Polres Asahan berhasil mengamankannya, Jumat (15/ 10) sekitar pukul 18.00. Informasi dihimpun Waspada, korban Lina Wati,28, warga Dusun VII, Desa Pondok Bungur, Kecamatan Rawang Panca Arga, Kabupaten Asahan, saat itu baru pulang kerja

dari Kota Kisaran dengan membawa anak-nya berumur tiga tahun dengan mengendarai sepedamotor. Di tengah perjalanan tepatnya di wilayah jalan raya Kelurahan Gambir Baru, satu sepedamotor tanpa plat polisi dikendarai WA,28, warga Jaln SM Raja Kisaran, menyelip dari sebelah kanan dan merampas tas yang dibawa Lina dan kabur.

Korban berusaha mengejar dan meminta tolong warga sekitar, sehingga masa beramairamai menghentikan WA. Akibat gugup,WA terjatuh dari kendaraannya. Saat itulah massa menghajarnya dan nyaris diba-kar. Personil Polres Asahan yang mendapat informasi segera meluncur ke TKP dan mengamankan tersangka. (csap/a10)

Dosen USU ...

melihat rumah pamannya itu, karena hingga menjelang malam tak satu pun lampu menyala. Rusdiansyah yang tinggal tak jauh dari rumah pamannya itu membuka pintu rumah dengan kunci rumah yang ada pada dirinya. Betapa terkejutnya Rusdiansyah saat hendak masuk ke kamar tidur dan menyalakan lampu, ia melihat pamannya sudah tewas dengan tali gantungan yang terjuntai dari bekas ayunan anaknya.Di bawah kakinya ditemukan kursi kayu Banyak praduga yang timbul dibalik kematian sang dosen yang dikenal baik di mata para mahasiswanya di Fakultas PertanianUSUMedanini.Dilihatdari kondisi kamar, di mana seluruh pakaian dari dalam lemari ter-

bongkar dan berserak di atas lantai dan di atas tempat tidur. Praduga yang timbul, terkesan korban mencari sesuatu barang yang berharga, sehingga berupaya mencari sampai dapat. Dan, ini masih menjadi penyelidikan pihak kepolisian, apa kaitan antara baju yang berserakan dengan kematian korban. Namun penyelidikan pihak kepolsian sebatas olah TKP, karena pihak keluarga tidak mengizinkan untuk dilakukan visum, sehingga saat ini korban ditetapkan murni membunuh dirinya dengan seutas tali nilon. Usai shalat Jumat, mayat sang dosen diantarkan ke persemayaman terakhirnya di TPU Desa Tumpatan, Lubukpakam.(a06)

“Saya terpaksa tinggal di sini, di bawah jembatan ini, karena saya tidak dapat pekerjaan. Satu-satunya yang saya miliki adalah sertifikat sekolah dasar,” katanya, sambil menambahkan bahwa dia lebih suka hidup dan bekerja seperti ini daripada menganggur tanpa kegiatan dan dia tidak peduli bagaimana orang memandangnya. “Hidup di bawah jembatan sangat sulit. Saya tidak punya

penghasilan banyak dan jarang sekali memperoleh 100 riyal satu hari. Saya kadang-kadang malu melakukan ini namun ini lebih baik daripada mencuri. Saya lihat telah banyak orang Saudi seperti saya. Kami tinggal bersama di bawah jembatan pada malam hari dan masing-masing mencari nafkah pada siang hari,” katanya. Muhammad Al-Araaj, 49, telahberumahtanggadanmemiliki tiga anak. Dia tinggal di satu rumah tua dan harus membayar sewa 1.200 riyal sebulannya. “Saya tidak dapat mencari satu pekerjaan yang cocok dan jadi saya memutuskan untuk membeli satu kursi roda dan darinya memperoleh penghasilan seperti sekarang ini,” kata Al-Araaj. “Saya telah membantu banyak jamaah dan pengunjung jompo. Sejak saya tidak dapat berbuat banyak dan penghasilan pun tidak mapan, makanya saya bekerja siang malam untuk menjamin saya memperoleh uang cukup untuk mendukung keluarga dan membayar sewa,” katanya. (an/m07)

sumber, akhir-akhir ini sang dosen sering bertengkar dengan istri pertamanya.Ini tak lain karena orang ketiga yang disebut-sebut telah menjadi istri sang dosen diketahui sang istri. Peristiwa ini terjadi sebelum bulan puasa lalu. Sang dosen telah menikah lagi, kabar itu yang menyebar. Karena ketahuan menikah lagi, istri pertama bersama 5 anaknya kembali ke rumah orang tuanya di Kota Medan. Sang dosen pun tinggal sendirian di rumahnya, Desa Bakaran Batu, Lubukpakam. Pada Kamis sore menjelang Maghrib, ponakan sang dosen, Rusdiansyah, 31, merasa aneh

Jembatan Misfala, ... Haram. Dengan menggunakan perabotan usang mereka tidur di bawah jembatan itu dan di sanalah mereka bertukar pakaian, minum air dari dispenser di jalanan dan menggunakan kamar mandi Masjidil Haram untuk bersih-bersih. “Saya telah tinggal di bawah jembatan selama tiga tahun,” kata Saad Hussein, seorang pria Saudi 38 tahun.

Dengan demikian, Medan menjadi kota percontohan dalam aplikasi UU No 23/2006 tentang administrasi kependudukan dengan KTP ber-chip. Turut hadir dalam pertemuan di Balai Kota tersebut Wakil Walikota Dzulmi Eldin, Sekda HM Fitriyus, Wakil Ketua DPRD Medan Sabar Samsurya Sitepu dan para lurah. Kapoldasu mengigatkan agar Pemko segera menerapkan KTP ber-chip. “Chip KTP bisa lebih me-

mudahkan kita mendeteksi seseorang dan sangat membantu mengidentifikasi seseorang dalam hal keperluan penyidikan di institusi Polri,” katanya. Kapoldasu meyakini tidak ada masalah penerapannya. “Tinggal kordinasi saja dengan pimpinan (Polri-red) dan instansi Pemko.” SementaraWakilKetuaDPRD Medan Sabar Samsurya Sitepu juga menyatakan dukungannya sebagai perwakilan pimpinan dewan untuk secepatnya mengesahkan anggarannya, jika sudah diajukan Pemko. (h10)

kerugian di masing-masing pedagang. Sebagian besar hanya menuntut tegaknya peraturan pengelolaan pasar. Tim Adipura yang seyogianya memantau persiapan kebersihan, malah tidak memantau kebersihan Pasar Ikan Lama dan Stasiun Kereta Api Medan sesuai jadwal peninjauan lokasi Adipura Medan. Tim Adipura yang turut serta mendampingi bersama jajaran SKPD Kota Medan ini hanya memantau Pusat Pasar Medan, RSU Dr Pirngadi Medan (RSUPM), Parit Busuk (Parbus) Jln Prof. HM Yamin, Pasar Jln. Sentosa Baru/Jln Gurila Medan, MAN I Medan dan lokasi terakhir Pasar Aksara Medan. Warung Liar Sedangkan, warung-warung liar yang berdiri di sepanjang Jalan Panglima Denai, Kelurahan Timbangdeli, Kecamatan Medan Amplas, yang telah dirobohkan oleh petugas Satpol PP Kota Medan, pada Kamis (14/10) sekira 02:00, namun, Ju-

mat (15/10), para pemilik warung kembali membuka usahanya. Mereka mendirikan kembali lapak-lapak di pinggir jalan umum tersebut. Umumnya, warung-warung liar tersebut digunakan sebagai tempat usaha menjual makanan dan minuman ringan. Namun, banyak juga yang memanfaatkannya sebagai tempat menjual tuak. Ditinjau dari lokasi, lapolapo tuak itu letaknya memang sangat strategis. Persis di depan pintu keluar masuk Terminal Terpadu Amplas dan pinggir jalan raya. Namun, posisi lapolapo tuak tersebut berada di atas parit/drainase alias jalur hijau sehingga acap digusur oleh petugas Satpol PP. Salah seorang pemilik warung mengatakan, mereka terpaksa membuka kembali usaha tersebut karena tidak ada pilihan lain. “Di sinilah kami mencari nafkah untuk menghidupkan istri dan anak-anakku,” sebut

KTP Orang ...

Waspada/Andi Aria Tirtayasa

Beberapa warung liar yang juga sebagai tempat menjual minuman Tuak, kembali berdiri setelah sehari sebelumnya dirobohkan oleh petugas Satpol PP Kota Medan. Selain semrawut dan kumuh, warga juga sering melihat adegan mesum di warung-warung tersebut.

seorang pemilik lapo tuak kepada Waspada, Jumat. Pedagang kakilima lainnya yang berada di seberang lokasi lapo-lapo tuak itu juga menyesali menjamurnya lapo-lapo tuak di sekitar Jalan Panglima Denai, persis di depan Terminal Terpadu Amplas. “Keberadaan lapo tuak itu membuat lokasi di sini semakin semrawut sehingga kami jadi khawatir ikut terkena imbasnya saat penggusuran lagi,” keluh seorang pedagang yang takut namanya disebutkan. Selain itu, tambah pedagang itu, mereka juga sering melihat orang saling ciuman di lapo tuak sehingga adegan mesum itu terlihat orang yang lalulalang. “Gara-gara kehadiran lapo tuak itu itu kami jadi khawatir akan ikut tergusur, apalagi dijadikan lokasi mesum,” imbuhnya lagi. Camat Medan Amplas Drs Aidil Fitra mengaku kesal mengetahui keberadaan lapo-lapo tuak tersebut, apalagi selain berdiri di atas jalur hijau, keberadaannya terkesan semrawut dan kumuh. “Keberadaan warungwarung tersebut adalah liar dan terkesan kumuh,” jelasnya. Menurut Aidil Fitra, berdasarkan laporan dari sejumlah warga, keberadaan warung-warung tersebut juga disempatkan sebagai lokasi berbuat mesum oleh pengunjung warung. “Banyak laporan warga yang menyebutkan sering melihat adegan mesum di warung liar tersebut,” keluhnya. Keberadaan warung liar tersebut, tambah Aidil Fitra, memang sangat meresahkan warga. “Sudah hampir tiga tahun saya menjabat Camat Medan Amplas, entah sudah berapa kali saya tertibkan. Namun, mereka tetap juga membandal,” sesalnya. (h10/cat)

Tiga KPUD ... Sebab, sesuai UU Nomor 32 Tahun 2004 tentang Pemerintahan Daerah, tanggung jawab pendanaan Pilkada ulang di daerah berada di tangan pemerintah kabupaten/kota. “Masalah ini harus segera diselesaikan. Karena Menteri Dalam Negeri sudah menegaskan, tanggungjawab dana Pilkada ulang ada di tangan Pemda. Tapi kalau seperti ini kondisinya, kita harapkan Gubsu bisa menjembataninya sehingga pelaksanaan demokrasi di tiga daerah tersebut bisa berlangsung aman, tertib dan lancar,” ucap Harahap. Gubsu mengaku, kendala dana Pilkada ulang di tiga daerah itu akibat kemampuan keuangan daerah yang terbatas. Begitu pun Gubsu memastikan pemecahan masalahnya akan dibicarakan dengan Mendagri. “Melalui Mendagri, kita akan minta agar daerah perlu diingatkan untuk mencadangkan dua kali dana Pilkada. Se-

SMS Tidak ... Tetapi pada pukul 22:30, ketika Karmiati kembali menghubungi suaminya melalui pesan pendek SMS,’’ bang sudah sampai dimana’, tidak ada jawaban. Dalam hati Karmiati timbul rasa curiga dan cemas dengan keselamatan suaminya. Minggu (10/10) subuh sekira pukul 04:30, ketika Karmiati hendak melasanakan shalat shubuh, dia mengambil telefon genggam miliknya dan berharap ada balasan SMS dari suaminya. Dari layar HP-nya yang masuk pukul 02:00 berisi pesan ‘page tmpt orng ne tdr disni ya’. “Bahasa yang tertera di SMS tersebut bukan bahasa suami saya. Saya langsung menghubungi handphone suami, tapi tidak dijawab,” ujar Karmiati. Sekira pukul 09:00, Karmiati mengirim SMS, tidak ada balasan. Bahkan HP sang suami sudah tidak bisa dihubungi lagi. “Sejak itu perasaan saya tidak enak dan khawatir ada sesuatu terjadi dengan diri suami saya,” ungkapnya. Setelah itu, Karmiati mendatangi Mapolresta Medan, diterima Wakasat Reskrim. Selanjutnya,Wakasat Reskrim Polresta Medan menghubungi Polsek Bayu, Aceh Utara dan mendapat jawaban ada penemuan mayat pria tanpa identitas mengenakan baju coklat dengan postur tubuh gemuk di kawasan semak-semak line pipa di Gampong Blang Seureukuy, Syamtalira Bayu. Mayat tersebut telah dievakuasi ke instalasi jenazah rumah

WASPADA Sabtu 16 Oktober 2010 hingga saat terjadi Pilkada ulang, dananya sudah tersedia. Dan bila tidak, maka bisa dikembalikan ke kas daerah,” jelas Gubsu. Pola pendanaan seperti ini diharapkan Gubsu bisa diakomodir Kab. Karo yang segera menggelar Pilkada pada 27 Oktober 2010 dan Kab. Nias Sela-tan pada 2 Desember 2010. Sebelumnya, Ketua KPU Sumut, Irham Buana Nasution menjelaskan, anggota KPUD di tiga daerah tersebut mengaku resah menghadapi respon eksekutif di wilayah masing-masing yang kurang tanggap mengalokasikan dana Pilkada ulang. Padahal, setiap muncul kendala atau masalah dalam pelaksanaan Pilkada, justru KPUD yang disalahkan, bukan eksekutif. Irham mengungkapkan, dari tiga daerah itu baru Pemkab Madina dan PemkoTebingTinggi saja yang sudah menyatakan kesiapan menampung dana Pilkada ulang pada APBD. “Kedua daerah itu menyatakan kesanggupan menampung dananya pada APBD. Tapi masih

belum jelas apakah pada APBD murni atau pada P-APBD 2011. Yang pasti, Pilkada ulang di dua daerah ini akan digelar tahun depan,” beber mantan Direktur LBH Medan ini. Kebutuhan dana Pilkada ulang di Kabupaten Madina dan Kota Tebing Tinggi antara Rp4,5 miliar sampai Rp5 miliar. Sementara Pilkada ulang Kota Tanjung Balai yang membutuhkan dana sekitar Rp1,57 miliar, sampai kini belum ada kejelasan. Padahal, putusan sela MK yang diterbitkan 28 September 2010, sudah memerintahkan KPUD KotaTanjung Balai menggelar Pilkada ulang di 17 kelurahandan217TempatPemungutan Suara (TPS) paling lama 60 hari setelah putusan dikeluarkan atau 13 November 2010. “Faktanya, walau Walikota Tanjung Balai sudah merespon, namunalokasidananyabelumjelas. Karenanya, kami bersama KPUD Tanjung Balai berharap Walikota diberikan izin prinsip mengeluarkandanasebesarRp1,57 miliartersebut,”ucapIrham.(m19)

sakit Bayu. Guna mengidentifikasi mayat tersebut, pihak Polsek Bayu mengirim foto korban melalui HP. Setelah melihat ciri-ciri mayat tersebut, pihak keluarga meyakini, korban ada Syahrun. Menurut Karmiati, di tubuh korban ada luka di bagian leher, pinggang kanan dan tembus pinggang kiri, mulut dan kuping mengeluarkan darah. “ Luka itu seperti bekas tembakan,’’ kata pengurus Aisyiyah Kota Medan ini. Tetapi, Karmiati merelakan kepergian suaminya.Hanya saja, dia minta pihak kepolisian dapat menangkap pelakunya secepat mungkin. Menurut informasi, sepanjang tahun 2010 tercatat tiga mayat ditemukan di kawasan itu yakni, mayat Syahrun Effendy, 59, penduduk Jln Cemara, Gang Cemara, Lingkungan XIV,

Kelurahan Kotamatsum II, Kecamatan Medan Area ditemukan pada Minggu (10/10). Pada 14 Juni 2010, aparat menemukan mayat Supardi warga Sawit Seberang, Langkat. Mayat korban ditemukan dalam kondisi kedua tangan terikat di kawasan Gampong Asan Kareng, Muara Dua, Pemko Lhokseumawe. Lehernya dipenuhi bekas jeratan dan muka berlumuran darah. Selain itu, beberapa bekas luka penganiayaan di sekujur tubuh korban. Awal September 2010, di kawasan yang sama, warga menemukan jasad Razali Abdullah, 40, tukang ojek asal Desa Dayah Tuha, Kec. Syamtalira Bayu, Aceh Utara. Korban dibunuh di kawasan Dusun Lhok Drien Gampong Asan Kareung, Kec. Blang Mangat, Pemko Lhokseumawe. Ismanto Ismail

Waspada/Ismanto Ismail

Foto korban Syarun Effendy Batubara bersama istri Karmiati dan anaknya.

Ronaldinho Pede ... Bintang Brazil kelahiran Porto Alegre pada 21 Maret 1980 itu bahkan sangat pede akan bertahan di Milan sampai pensiun, padahal masa kontraknya akan berakhir tahun 2014 mendatang. Keberadaan Ronaldinho pun terusik pasca kedatangan bomber anyar Rossoneri asal Swedia Zlatan Ibrahimovic dan kompatriotnya Robson de Souza alias Robinho. “Silvio Berlusconi (Presiden Milan) mengatakan bahwa saya bisa bertahan di sini selama yang saya inginkan,” tambah mantan bintang Barcelona dan Paris SG tersebut. Robinho ternyata ikut menguatkan tekad bintang berusia 30 tahun itu. “Semua harus berhenti mengatakan Ronaldinho akan meninggalkan Milan untuk bergabung ke klub Amerika Serikat,” pinta Robinho kepada La Gazzetta dello Sport. Menurut Robinho, seniornya bernama lengkap Ronaldo de Assis Moreira itu tak bakalan menyusuli langkah David Beckham, pindah ke Los Angeles Galaxy. “Dinho akan tetap bertahan dengan saya di sini (Milan). Kalau perlu, saya akan ikat dia di ruang ganti, dia sahabat sejati,” tegas Robinho. “Anda bisa percaya kepadanya. Dia orang

yang tidak akan pernah mengkhianati Anda,” katanya menambahkan. Langganan starter Kuatnya hubungan emosional RonaldinhoRobinho tersebut, membuat keduanya pada awal musim ini menjadi langganan starter di garis serang skuad Massimiliano Allegri. Akibatnya, Alexandre Pato yang mulai tergeser sekaligus bersaing sengit dengan Ibrahimovic untuk menjadi penyerang tengah Il Diavolo. Sejauh ini penampilan Ibra memuaskan Milanisti, tapi Pato tak mau berada di bawah bayangbayang striker Swedia itu. Pato pun meminta Allgeri mengistirahatkan Ibra saat Milan menjamu Chievo Verona dinihari WIB nanti di Liga Seri A, supaya dia bisa membentuk trisula Samba bersama Ronaldinho-Robinho. “Saya makin percaya diri. Saya yakin bisa terus menunjukkan kemampuan maksimal di Milan,” janji Pato. Rujukan attacante berusia 21 tahun itu adalah gol-gonya saat memenangkan Brazil atas Iran dan Ukraina pada laga eksibisi sepanjang pekan lalu. “Itu momen terbaik dalam karir saya. Saya bahagia kembali masuk tim nasional dan itu akan saya tularkan saat membela Milan,” katanya menambahkan. (h01/vvn/goal/tf)

WASPADA Sabtu 16 Oktober 2010

Medan Metropolitan Polmas Tangkal Teroris

Melihat Kehidupan Di Penjara Mapolresta SIANG menjelang sore itu cuaca terlihat cukup panas menyengat. Beberapa pengunjung baik perempuan maupun laki-laki membawa nasi bungkus, makanan ringan maupun rokok bergegas menuju ke ruang tahanan Polresta Medan yang berada di ujung bangunan Sat Reskrim. Di sudut bangunan itu terlihat jelas plang berwarna putih dan bertuliskan warna hitam Rumah Tahanan Negara Polresta Medan. Di ruangan inilah setiap tamu/keluarga para tahanan harus melapor ketika akan membesuk keluarganya yang ditahan di sel Mapolresta Medan karena terlibat berbagai kasus tindak pidana. Dari pantauan Waspada di Polresta Medan, Jumat (15/ 10), terlihat seorang ibu rumah tangga mengenakan kemeja putih dan celana jeans biru bersama dua anaknya berjalan menuju ruang tahanan. Tangannya terlihat memegang bungkusan plastik berisi makanan. Mungkin makanan itu akan diberi kepada suaminya yang menjalani masa tahanan di Rutan Polresta Medan. Setelah berada di depan bangunan Rutan yang dibatasi pintu besi, ibu rumah tangga tersebut dipersilahkan masuk oleh petugas polisi yang sedang berjaga. Di dalam tahanan itu terdapat ratusan orang dengan tingkat kejahatan berbeda-beda. Di sini penjaga akan mencatat identitas pembesuk dan siapa yang dibesuk. Setelah itu, penjaga tahanan memanggilkan tahanan yang kemudian keluar dari sel untuk bertemu dengan si pembesuk. Di ruangan yang terbuka itu pembesuk bisa bertemu dengan suami, anak atau saudara yang menjalani masa tahanan. Terkadang antara pembesuk dan yang dibesuk, bertangis-tangisan melepas rindu. Begitulah kehidupan di tahanan. Walau sudah ditahan polisi tetapi masih juga membuat repot keluarga terutama istri dan anak. Seorang mantan tahanan Polresta Medan yang sempat ditemui Waspada, pernah bercerita saat menjalani masa tahanan di Polresta Medan.“Sudah kita yang bersalah, masih juga merepotkan keluarga terutama isteri dan anak-anak. Akibat kesalahan kita, mereka juga harus menanggung akibatnya,” jelas Sembiring. Bahkan lanjutnya, saat berada di penjara, kita juga harus pandai-pandai bergaul dengan tahanan yang satu sel. Kalau tidak, ada saja yang mereka suruh. “Cukup sedih lah kehidupan di dalam penjara itu, apalagi selama berada di Rutan Polresta, kita tidak terkena matahari. Batin ini cukup tersiksa kalau mengingat waktu itu,” jelasnya. Sementara itu, tahanan di Polsekta Medan Kota yang berkisar 30-an orang itu setiap tiga bulan sekali mendapat perawatan kesehatan dari tim dokter Polresta Medan. “Tiga bulan sekali tim dokter Polresta Medan datang ke tahanan mengecek kesehatan setiap pelaku tindak pidana,” jelas Kanit Reskrim Polsekta Medan Kota Iptu Sangkot Simaremare ketika ditemui di ruangannya. Menurut Mare-mare, tahanan Polsekta Medan Kota mendapat jatah makan dua kali sehari. “Siang dan malam, para tahanan mendapat jatah makan. Kalau ada yang sakit, pihaknya akan membawa ke RS Bhayangkara Medan dengan biaya perobatan kita yang tanggung,” jelasnya. * Rudi Arman

TNI AU Rekrut CPNS MEDAN (Waspada): Markas Besar Tentara Nasional Indonesia Angkatan Udara membuka penerimaan CPNS TNI-AU. Demikian dikatakan Kaptentak Lanud Medan Kapten Sus Sudjarwoto, Kamis (14/10). Menurutnya, persyaratan menjadi calon PNS TNI-AU yang harus dipenuhi yakni, WN Indonesia, pria dan wanita, beragama, usia maksimum 35 tahun pada 1 Desember 2010. Berkelakukan baik dan tidak pernah dihukum penjara, tidak pernah diberhentikan dengan hormat tidak atas permintaan sendiri atau tidak dengan hormat sebagai PNS/anggota TNI/anggota Polri maupun pegawai swasta dengan surat pernyataan. Kata Sudjarwoto, tidak berkedudukan sebagai calon PNS dan tidak sedang terikat perjanjian/kontrak kerja dengan instansi lain serta tidak sedang mendaftar sebagai CPNS dengan surat pernyataan. Mempunyai pendidikan kecakapan, keahlian dan ketrampilan yang diperlukan. Dia menambahkan, berkelakuan baik yang dibuktikan dengan surat keterangan cacatan kepolisian RI terbaru. Tidak bersuami/beristrikan seorang yang berkewarganegaraan asing atau tanpa kewarganegaraan dengan mencantumkan surat keterangan dari kelurahan/kepala desa. Selanjutnya, keadaan jasmani dan rohani pelamar; tinggi badan minimal pria 160 cm, wanita 155 cm. Berat badan mendekati ideal (tidak overweight dan underweight). Pendaftaran di buka mulai tanggal 18 sampai 21 Oktober 2010 di Dinas Personel Pangkalan TNI AU Jalan Imam Bonjol No.43 Medan. (rel/m31)

Supri Harahap Kepala SMPN 14 MEDAN (Waspada): Pemerintah Kota Medan melalui Dinas Pendidikan Medan memberikan apresiasi kepada peringkat I Guru Berprestasi SMA Tingkat Nasional 2009 Supri Harahap,47, (foto) berupa peningka-tan karier menjadi kepala sekolah. Supri Harahap dilantik menjadi kepala SMP Negeri 14 Medan bersama 37 kepala SMP yang lain oleh Wakil Walikota Medan T Dzulmi Eldin di Balai Kota, Senin (11/10). Pelantikan tersebut sesuai dengan Surat Keputusan Walikota No.821.2/1367.K tentang Pemberhentian dan Pengangkatan Kepala Sekolah dan Pengawas Sekolah. “Saya sedang asyik mengajar ketika mendapat telepon agar segera bersiap ke kantor walikota,” kata guru SMA Negeri 4 Medan kepada Waspada, Rabu (13/10). Unggul. “Alhamdulillah. Ini benarbenar surprise apresiasi buat saya. Saya hanya bisa berterimakasih atas kepercayaan dan amanah yang diberikan, terima kasih buat Pemko Medan, khususnya kepada Bapak Kepala Dinas Pendidikan Medan,” ujarnya haru. Ia mengatakan dalam setiap kesempatan dan pertemuan dengan guru, Kepala Dinas Pendidikan Medan selalu memotivasi agar guru visioner, terus meningkatkan kreasi, prestasi, dan inovasi. “Bapak Kepala Dinas konsen dengan guru berprestasi,” kata Supri.(m25)

A3

Waspada/Hamdani

RUSAK PARAH : Seorang sopir angkutan umum melintasi jalan Pasar V, Kecamatan Medan Denai yang mengalami kerusakan cukup parah, Rabu (13/10). Tersumbatnya aliran parit yang menyebabkan jalan tergenang dan bebasnya mobil bertonase tinggi melintas di sana, merupakan faktor utama kerusakan jalan. Masyarakat mengharapkan Pemko lebih serius menangani persoalan ini.

Harus Siap Operasional Arhanudse 11/BS Peringati HUT Ke-44 MEDAN (Waspada): Panglima Daerah Militer (Pangdam) I Bukit Barisan (I/BB) Mayjen TNI Leo Siegers menegaskan, Batalyon Arhanudse 11/BS dituntut kesiapsiagaannya agar senantiasa dalam kondisi siap operasional. Demikian amanat Pangdam I/BB yang dibacakan Komandan Batalyon Arhanudse 11/BS Letkol Arh R Edi Setiawan pada upacara peringatan Hari Ulang Tahun (HUT ) ke-44 Batalyon Arhanudse 11/BS di lapangan batalyon tersebut, Jumat (15/10). Hadir dalam acara yang berlangsung khidmat tersebut Walikota Binjai M Idaham, para pimpinan batalyon, TNI AD, AU,

AL dan Polri, purnawirawan serta para tokoh masyarakat dan pemuda bersama unsur Muspida setempat. Pangdam I/BB mengingatkan tentang dinamika dan tantangan tugas saat ini yang dihadapkan dengan luasnya wilayah mencakup empat provinsi dan berbatasan dengan negara tetangga Malaysia, Singapura, Thailand dan Vietnam serta pesatnya kemajuan limu pengetahuan dan teknologi. Batalyon Arhanudse 11/BS dituntut kesiapsiagaan satuan agar senantiasa dalam kondisi siap operasional yang mencakup kesiapan personil, peralatan dan persenjataan yang dimilikinya dalam upaya melaksa-

nakan pertahanan udara aktif dengan menghancurkan serangan udara musuh. Serangan udara musuh tersebut harus dihalau, baik yang datang melalui pesawat udara, peluru balistik dan peluru kendali sesuai dengan tatanan pertahanan udara. Dalam amanat itu, Pangdam I/BB Mayjen TNI Leo Siegers mengucapkan selamat HUT ke 44 kepada para parjurit Batalyon Arhanudse 11/BS, semoga tetap dapat mempersembahkan prestasi terbaik dalam berbagai penugasan. Dalam acara tersebut para undangan juga disuguhkan hiburan pertunjukan dan atraksi ketangkasan musik prajurit Batalyon Arhanudse 11/BS. Danyon Arhanudse 11/BS Letkol Arh R Edi Setiawan yang bertindak sebagai inspektur upacara mengucapkan terima kasih dan penghargaan yang tulus kepada para pejabat pemerintah sipil, TNI dan Polri, sesepuh Arhanudse 11/BS serta tokoh agama dan undangan .(m40)

MEDAN (Waspada): Jajaran Kepolisian Daerah (Polda) Sumatera Utara sudah menyiapkan strategi antisipasi gerakan kelompok bersenjata yang diklaim sebagai teroris berkembang di wilayahnya. Antisipasi tersebut salah satunya membentuk kerja sama antara Polisi dengan Masyarakat Desa (Polmas). Demikian dikatakan Kepala Biro Bina Mitra Polda Sumut Kombes Pol Suwarno dalam acara dialog pembangunan Sumut bersama kelompok strategis untuk menggalang kekuatan partisipasi masyarakat dalam mempertahankan Kamtibmas yang kondusif di Sumut, Selasa (12/10). Menurut Suwarno dalam acara yang menghadirkan Sekreteris Majelis Ulama Indonesia (MUI) Sumut, Hasan Basri, membentuk Polmas adalah arah kebijaksanaan Polri pada tahun 2010-2014. “Membentuk Polmas salah satunya untuk meningkatkan kepercayaan masyarakat kepada Polri dan sebagai upaya percepatan penyelesaian masalah yang timbul di masyarakat lebih cepat,” jelasnya. Dikatakannya, selama ini ada kecenderungan masalah yang terjadi di desa tidak akan bisa diselesaikan di tingkat desa, sehingga harus ke kecamatan bahkan hingga kabupaten atau provinsi. Padahal, masalah atau gejolak sosial yang terjadi di masyarakat pedesaan akan lebih arif

penyelesaiannya dengan melibatkan aparat pemerintah di desa, bukan di kecamatan atau kabupaten bahkan provinsi. “Bukti efektifnya Polmas itu ada di Serdang Bedagai. Di mana berkat kerja sama Polri dengan masyarakat setempat, kita bisa membekuk pelaku teror. Ini terjadi karena warga mencurigai orang asing di wilayahnya lalu melaporkan kepada Kepling kemudian lapor ke kepala desa dan seterusnya hingga sampai ke Polsek,” beber Suwarno. Ditegaskan Suwarno, kesadaran masyarakat untuk ikut menciptakan situasi Kamtibmas yang kondusif sangat penting untuk terus dipertahankan saat ini hingga ke depan. “Setidaknya kita di Sumut tidak ingin kecolongan seperti di Jawa. Di mana Noordin M Top bisa menikah dengan warga di sana, padahal Noordin M Top itu adalah orang yang paling dicari di negara ini,” tukasnya. Sementara Hasan Basri mengatakan, pembentukan Polmas di 5017 desa di Sumut diharapkan bisa meredam gejolak konflik sosial yang terkadang dikaitkan dengan suasana nasional dan bahkan internasional. “Prinsipnya MUI Sumut mendukung penuh upaya Polda untuk memberikan rasa aman dan nyaman kepada warga khususnya menyangkut Hak Azasi Manusia,” katanya.(m19)

Medan Metropolitan

A4

WASPADA Sabtu 16 Oktober 2010

Halangi Pilkada Ulang, Pidana

Waspada/Hamdani

MACAT TOTAL : Ratusan kendaraan harus merayap melintasi Jalan Puteri Hijau Medan, Jumat (15/10), disebabkan kepadatan kendaraan yang terjadi hampir setiap hari, terutama pagi dan sore. Masyarakat mengharapkan Pemerintah Kota Medan dapat segera mengurai masalah kemacatan ini.

Warga Medan Terkurung Macet MEDAN (Waspada): Kondisi kemacatan kendaraan di Kota Medan semakin parah. Setiap hari, kemacatan lalu lintas sering terjadi di daerah pinggiran Kota Medan seperti Jln Jamin Ginting, Medan Tuntungan dan Jln Gatot Subroto, Kampung Lalang. Bahkan sejumlah ruas jalan di inti kota sudah menjadi langganan kemacatan.

Menurut Rahmad, 37, warga Simpang Limun yang berprofesi sebagai sopir KPUM trayek Amplas-Pinang Baris mengatakan kepada Waspada, Jumat (15/10), saat ini Kota Medan telah terkurung kemacatan. Adapun kemacatan terjadi mulai pada pagi hari sekira pukul 07:30 dan sore pada pukul 16:00. “Kalau pagi yang menjadi langganan macat di Jln Gatot Subroto, Jln Gajah Mada, Jln Sisingamangaraja dekat simpang

Jl. Alfalah dan dekat persimpangan Jln Tritura. Kemacatannya hampir mencapai satu kilo meter,” kata Rahmad. Menurut Rahmad, kemacatan ini bukan saja disebabkan kendaraan roda empat, namun akibat meningkatnya jumlah sepeda motor. Sementara perluasan jalan tidak ada, ditambah minimnya personil Dinas Perhubungan di lokasi rawan kemacatan. Hal senada diungkapkan Ari

Satgas - Polda Kejar Markus MEDAN (Waspada): Satuan Tugas (satgas) mafia hukum melakukan koordinasi dengan Poldasu untuk mencari adanya dugaan keterlibatan mafia kasus (Markus) dalam penanganan kasus di Poldasu. “Koordinasi yang berlangsung di aula Tribata lantai IV Mapoldasu ini, terutama membahas permasalahan internal seperti kasus-kasus yang ditangani Propam,” jelas Kabid Humas Polda Sumatera Utara Kombes Pol Baharuddin Jafar kepada wartawan di ruang kerjanya, Kamis (14/10). Juru bicara Poldasu ini mengatakan, kedatangan rombongan Satgas tersebut membahas hal-hal yang menyangkut pelanggaran yang dilakukan oleh kepolisian di Sumut. “Hanya malakukan pembahasan tentang pelanggaran anggota tetapi tidak ada data untuk itu,” ungkap Baharudin. Sekretaris Satgas Pemberantasan Mafia Hukum Denny Indrayana sebelumnya mengatakan, Sumatera Utara merupakan provinsi ketiga yang paling banyak dilaporkan terkait kasus mafia tanah. Di sela-sela dialog“Mempersatukan Energi Dalam Mencegah dan Memberantas Mafia Hukum” di Medan, Rabu(13/10), Denny Indrayana mengatakan, berdasarkan laporan yang disampaikan masyarakat, pihaknya mengetahui adanya 130 kasus dugaan mafia tanah di Sumut. Dari jumlah pengaduan dan laporan masyarakat itu, Sumut hanya “kalah” dari Jakarta dan Jawa Timur yang menempati peringkat pertama dan kedua. “Jakarta 365 pengaduan sedangkan Jawa Timur 181 pengaduan,” katanya. Denny menambahkan, dari pengaduan dan laporan yang disampaikan tersebut, ada sejumlah kasus yang telah ditindaklanjuti untuk membuktikan kebenarannya. Namun demi kepentingan proses penyelidikan yang dijalankan, pihaknya tidak dapat mengumumkan hasil yang telah didapatkan dari pemeriksaan pengaduan tersebut. Kebijakan itu dilakukan karena publikasi yang terlalu awal dalam proses pemeriksaan tersebut dikhawatirkan dapat mengganggu pencarian bukti pengaduan masyarakat itu. Meski demikian, Denny Indrayana tidak membantah jika ada dugaan keterlibatan oknum pemerintahan dan penegak hukum dalam praktik mafia tanah tersebut. Namun Dosen Fakultas Hukum Universitas Gajah Mada, Yogyakarta itu tidak menyebutkan kaitan dialog yang diikuti unsur penegak hukum di Sumut tersebut dengan pemberantasan mafia tanah yang dilaporkan ke Satgas Pemberantasan Mafia Hukum. (m39)

YP Nurhasanah GelarTri Lomba MEDAN (Waspada): Yayasan Pendidikan Nurhasanah Medan akan menggelar Tri Lomba yaitu baca pusisi, pidato dan tari tradisional daerah tingkat SD/MD, SMP/MTs, SMA/ MA dan SMK se-Kota Medan, berlangsung di halaman sekolah tersebut Jalan Garu I No. 28 Medan pada 28 s/d 31 Oktober 2010. Ketua Panitia pelaksana Marhot Harahap,SP.d didampingi sekretaris Juwita Hana Batubara dan Ketua YP Nurhasanah Tety Nurul Syafina serta Ardi menyampaikan hal itu ke redaksi Waspada, Rabu (13/10). Kegiatan tersebut dalam rangka meningkatkan rasa patriotisme dan kesetiakawanan antar pelajar sekaligus memperingati hari Sumpah Pemuda Ke-82 dan Bulan Bahasa Tahun 2010. Untuk tema pidato “Dengan semangat sumpah pemuda kita galang persatuan dan kesatuan antar pelajar’. Untuk baca puisi tingkat SD berjudul “Aku” karya Chairil Anwar, tingkat SMP/SMA sederajat judul “ “Kerawang Bekasi” karya Chairil Anwar. Sedangkan untuk tari tradisional daerah diperbolehkan menampilkan tari daerah Se Nusantara. “Kata Harahap, tri lomba diperkirakan akan diikuti sekitar 500-an peserta dan setiap pemenang masing-masing lomba disesuaikan dengan tingkatannya dan bagi juara 1,2,3 setiap perlombaan putra-putri akan mendapat hadiah berupa tropi tetap, piagam penghargaan dan uang pembinaan dari panitia. Total hadiah sekitar Rp6 jutaan. Pendaftaran dibuka mulai Selasa (13/10) dan ditutup Sabtu (23/10) sekaligus technical meeting. Tempat pendaftaran di YP Nurhasanah Jalan Garu I No. 28 Medan. (m25)

Sisworo salah seorang PNS Pemko Medan bermukim di kawasan Medan Amplas. Saat ini, katanya, kondisi kemacatan Kota Medan hampir sama dengan Jakarta. Bila pagi dan sore hampir semua jalan di inti kota ini mengalami kemacatan. Apalagi di kawasan Pasar Simpang Limon. “Kalau masih jam 07:30, kecamatan panjang terjadi di Simpang Limun. Karena para pedagang kaki lima (PKL) seenaknya saja menggelar lapak untuk berjualan. Sementara, petugas Dishub tampak belum disiagakan di tempat tersebut,” ucapnya. Ari mengaku berangkat dari rumah sekira pukul 06:45 dari Amplas, tapi tiba di Balai Kota pukul 08:00. “Jadi setiap hari harus berangkat sebelum pukul 07:00, itu pun terlambat. Kalau hari Senin ada upacara, be-

rangkat dari rumah harus pukul 06:30,” tambahnya. Sementara itu, pengamat perkotaan Abdul Rahim Siregar mengatakan, terjadinya kemacatan lalulintas di Kota Medan akibat tingginya tingkat pertumbuhan kendaraan setiap tahun, namun ruas jalan tidak bertambah. Selain itu, banyaknya PKL yang belum ditertibkan Pemko Medan juga memicu terjadinya kemacatan. Parkir berlapis yang menggunakan badan jalan dan belum adanya etika para sopir yang berhenti di sembarang tempat juga menyebabkan kemacatan. “Hal inilah yang membuat terjadinya kemacatan di Kota Medan. Kalau tidak dipikirkan solusinya dari sekarang, maka sebagian besar ruas jalan di inti Kota Medan akan mengalami macat total,” ucap Rahim.

Karena itu, lanjut Rahim, Pemko Medan harus punya strategi untuk mengatasi kemacatan tersebut. Jadi, Dinas Perhubungan harus mengetahui titik-titik yang sering terjadi kemacatan sehingga bisa dilakukan pemetaan. Setelah itu tempatkan petugas Dishub untuk mengatur lalulintas. Sementara itu, Walikota Medan Rahudman Harahap ketika dikonfirmasi mengatakan, pihaknya telah membuat kajian untuk mengatasi kemacatan di Kota Medan. Diharapkan pada bulan November akan dilaunching. “Kita telah membuat kajiankajian dan diharapkan pada November 2010 sudah ada hasilnya bagaimana cara mengatasi kemacatan di kota ini. Namun yang pasti kita akan mencoba untuk membuat angkutan massal,” pungkasnya. (h10)

Calhaj Kloter 4 Terbang MEDAN ( Waspada) : Pj Bupati Labuhanbatu Utara (Labura) Drs H Asren Naim bersama Ketua DPRD Labura Drs H Ali Tambunan secara resmi melepas jamaah calon haji (calhaj) asal Labuhanbatu Utara dan Labuhanbatu Selatan sebanyak 453 orang, Kamis (14/10). Turut hadir dalam acara pelepasan calhaj, Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan Drs H Syariful Mahya Bandar MAP dan Sekretaris Drs H Abd Rahman Harahap MA serta pejabat terkait lainnya. Dalam sambutannya Drs H Ali Tambunan mengingatkan para calhaj untuk tetap menjaga silaturrahim dan semangat persatuan dan kesatuan, sekalipun dalam rombongan ini beda daerah.Yakni dari Labuhanbatu Utara dan Labuhanbatu Selatan. Hal yang paling pokok, kata dia, setelah kembali dari tanah suci nanti, diharapkan menjadi haji yang mabrur. “Kepada petugas yang sengaja kami sertakan dari Labura, diharapkan bisa melakukan tugasnya dengan sebaik-baiknya. Apalagi dalam kloter ini banyak jamaah yang sudah tua atau uzur, jadi diharapkan bisa memberikan

perhatian kepada mereka. Jaga nama baik daerah dan bangsa Indonesia di tanah suci hingga kembali ketanah air,” kata Ali Tambunan. Perlu Waspada Sebelumnya Ketua PPIH Embarkasi Medan Drs H Syariful Mahya Bandar MAP dan Sekretaris Drs H Abd Rahman Harahap MA serta Humas Drs H Sazli, menghimbau para calhaj untuk waspada dan mawas diri saat berada di tanah suci. Hal ini untuk mengantisipasi terulangnya kasus penipuan yang terjadi pada seorang calhaj kloter 1 asal Labuhanbatu bernama Dolla Tanjung. “Kami menghimbau para calhaj untuk waspada dan mawas diri terhadap orang-orang yang kelihatannya ingin berbuat baik tetapi punya niat buruk. Karenanya, ketika seseorang bertanya tentang paspor calhaj, pastilah orang itu patut dicurigai, karena paspor tidaklah dipegang oleh jamaah tetapi berada pada pemilik maktab. Hal yang tak kalah penting selalu berkordinasi dengan petugas, jika ada yang kurang dipahami langsung minta bantuan petugas,” kata Abd Rahman. Menurutnya, calhaj kloter

4 ini sebanyak 453 orang, dengan calhaj termuda pria bernama Irwansyah Jirul Munthe, 22, wanita termuda Mana Hajjah Topael, 25. Sedangkan pria tertua bernama Abdul Somad Nauli Bn Baginda Nauli, 88, dan wanita tertua Sukinem Santrawi, 81. IPHI Bagi Formulir Ikatan Persaudaraan Haji Indonesia (IPHI) melalui Ketuanya Ahmad Husain SE mengatakan, bersamaan dengan keberangkatan calhaj tahun ini, pihaknya membuat gebrakan baru untuk langsung mendata para calhaj yang nantinya bisa menjadi anggota IPHI. Hal itu dikatakan Ahmad Husain di sela keberangkatan calhaj kloter 4 di Aula Asrama Haji. “Tahun ini kita buat gebrakan baru dalam rangka merekrut anggota baru IPHI. Sebelum berangkat, seluruh calhaj kita berikan formulir anggota. Ketika mereka kembali nanti, formulir itu langsung diserahkan kepada Sekretaris IPHI untuk didata dan setelah itu dikirim ke daerah yang secara langsung membuat keanggotaan mereka. Nanti, kartu keanggotaan IPHI bisa digunakan untuk berbagai keperluan,” kata Ahmad Husain. (m36/m32/h10)

Impian Anggota Dewan Didengar Tuhan KUMANDANG a z a n melepas kepergian Isma Padli Ardya Pulungan SAg SH (foto) dari kediamannya di Jalan Beringin I Medan, Rabu (13/ 10). Siang itu, anggota DPRD Sumut ini bertolak menuju Asrama Haji Medan. Isak tangis keluarga tak terbendung terutama sang isteri, Yeni Sri Wahyuni Rangkuti, SPd, MA dan kedua anaknya Rizqy Himmawan Ardya Pulungan dan Fadlan Zuhri Ardya Pulungan ketika memberangkatkan sang ayah yang akan menunaikan rukun Islam kelima. Saat itu anggota komisi C dari Fraksi Golkar ini didampingi penasehat spritualnya, Ustadz Drs. H. Darwansyah Simanjuntak dan Bahran Tanjung serta mantan Ketua HIMMAH Sumut Jumari DP Batubara, mantan Sekretaris GPA Sumut Rahman Rais, Gunarto Aziz. Isma merupakan jamaah haji manifest 320 yang tergabung di kloter 4, Labuhanbatu Utara. Kloter tersebut merupakan masyarakat tempat Daerah Pemilihannya pada Pemilu 2009 (Labuhanbatu) yang akan bertolak ke Jeddah, Kamis (14/10). “Agar lebih dekat bila berangkat bersama Tuan Guru, Khalifah dan

masyarakat yang tergabung dalam kloter 4,” kata mantan Ketua Himpunan Mahasiswa Al Washliyah (HIMMAH) ini. Berangkat ke tanah suci adalah impian pria berusia 39 tahun ini. Sejak duduk di kursi dewan tahun 2009 lalu dan selalu sibuk memperjuangkan aspirasi rakyat, dia tak lupa menanamkan niatnya dan berdoa agar diberi kesempatan menunaikan ibadah haji suatu hari nanti. Impian itu akhirnya terwujud karena Isma rajin menabung. “Semua ini berkat doa isteri, anak-anak dan keluarga serta masyarakat. Karena rukun Islam kelima ini dianjurkan agama bagi yang mampu,” tuturnya. Bahkan jika kelak diberi kesempatan usia yang panjang serta rezeki, Isma berniat akan kembali ke tanah suci Mekkah menghajikan kedua almarhum orangtuanya Ardi Ismail Pulungan dan Almarhumah Kamaliah Saragih. “Saya juga berdoa kepada Allah SWT agar masyarakat Sumatera Utara khususnya Labuhanbatu, Labuhanbatu Utara dan Labuhanbatu Selatan, aman dan sejahtera serta selalu dalam lindungan-Nya,” kata kader muda Partai Golkar Sumut ini. (m41)

MEDAN (Waspada): Ketua Komisi Pemilihan Umum (KPU) Sumut, Irham Buana Nasution menegaskan, siapapun yang menghalang-halangi pelaksanaan keputusan Mahkamah Konstitusi (MK) terkait pelaksanaan Pilkada ulang di Madina, Tebingtinggi dan Tanjungbalai dapat terancam sanksi pidana. “Itu jelas diatur dalam undang-undang. Artinya keputusan MK itu harus dilaksanakan,” katanya kepada wartawan usai rapat dengar pendapat (RDP) membahas soal persiapan Pilkada ulang Madina dan Tebingtinggi dengan Komisi A bidang pemerintahan DPRD Sumut, Pemko dan KPUTebingtinggi, Madina di gedung dewan, Rabu (13/10) sore. Irham menegaskan, kalau putusan MK sudah menjadi putusan hukum tetap yang mengikat dan harus dilaksanakan. Dikatakannya, jika 2011 mendatang belum juga mendapatkan kepastian anggaran, maka dapat dikenakan pelanggaran UU 22 tahun 2007 yaitu menghalang-halangi pelaksanaan pilkada. Secara kelembagaan baik DPRD maupun pemerintah daerah, menurutnya, dapat dikenakan sanksi jika komitmen anggaran tidak terealisasi pada 2011 mendatang. Karena pilkada ulang harus dilakukan sesegera mungkin. “Mereka bisa dipidana kalau 2011 ini tidak ada komitmen anggaran untuk memfasilitasi pilkada ulang. Karena telah menghalang-halangi pelaksanaan pilkada,” tandasnya. Sementara, dalam RDP tersebut baik pemerintah daerah maupun KPU menjelaskan, pelaksanaan Pilkada ulang terbentur persoalan tidak adanya anggaran. Sehingga satu-satunya jalan dengan memasukannya dalam APBD 2011. Sehingga untuk Pilkada ulang Madina, Plt Sekda Pemkab Madina Gozali Pulungan bahkan menargetkan pelaksanaan pada Maret 2009. Dengan perhitungan APBD 2011 kabupaten tersebut akan selesai dibahas pada akhir Desember ini. “Pemkab sendiri sebenarnya sudah memberikan dana hibah APBD 2010 sebesar Rp500 juta kepada KPU Madina untuk melakukan persiapan pelaksanaan Pilkada ulang,” kata Gozali. Sementara Pj Walikota Tebingtinggi Eddy Syofian juga menyatakan komitmennya akan

memfasilitasi anggaran pelaksanaan pilkada ulang pada APBD 2011. Namun di sisi lain dirinya belum bisa memastikan kapan dapat direalisasikan penggunaan anggarannya karena saat ini PAPBD 2010 sendiri masih belum selesai dibahas di DPRD Tebingtinggi. “Jadi kami masih belum tahu kapan RAPBD 2011 baru akan dibahas,” katanya. Seperti diketahui saat ini pembahasan PAPBD 2010 Tebingtinggi tersendat karena sebagian anggota dewan mempermasalahkan status hukum Ketua DPRD Tebingtinggi Syafri Chap. Ditanya soal kepastian komitmen pemko terhadap penganggaran pilkada ulang di APBD 2011 dijamin tidak akan terkendala di dewan, Eddy tak bisa memastikannya. Karena semua rancangan APBD 2011 harus dikonsultasikan lagi ke DPRD. “Yang jelas good will (keinginan baik) sudah ada untuk memasukkannya dalam APBD 2011. Nanti akan dikonsultasikan lagi ke dewan,” ujarnya. Eddy mengatakan anggaran akan disesuaikan dengan kebutuhan. Pihaknya siap mengalokasikan dana hibah Rp8 miliar untuk pelaksanaan pilkada ulang. Bahkan, katanya, bisa lebih mengingat ada salah satu pasangan calon yang harus digugurkan. Ketua KPUTebingtinggi Hatta Ridho mengaku siap melaksanakan pilkada ulang kapan pun digelar. Pihaknya hanya tinggal menunggu komitmen anggaran untuk menjalankannya.“Kami hanya pelaksana. Selama anggarannya sudah ada kami bisa menjalankannya,” ujar Ridho. Senada dengan itu Ketua KPU Madina Jefri Antoni mengaku siap menggelar pilkada ulang selama anggarannya telah tersedia. Meskipun awalnya sempat keberatan dilaksanakan pada Maret 2011. Karena ragu bisa tepat waktu dalam pencairan. Selain itu dia juga menegaskan dalam pilkada Madina tidak ada pasangan calon yang dicoret pencalonannya. SementaraWakil Ketua Komisi A Enda Mora Lubis yang memimpin RDP tersebut berharap kalau Pilkada ulang dapat digelar pada Maret 2011. Semua pihak diharapkan membangun komitmen bersama untuk menyukseskan pilkada ulang dan tidak mengulang kembali kesalahan yang sama. (h11)

DRDSU Berpeluang Jadi Percontohan Nasional MEDAN (Waspada): Dewan Riset Daerah Sumatera Utara (DRDSU) berpeluang menjadi salah satu DRD percontohan nasional dan akan menjadi rujukan bagi DRD provinsi lain di Indonesia. Hal tersebut dikatakanWakil Ketua DRDSU Ir Hervian Taher dan Sekretaris Azizul Kholis, SE, MSi kepada wartawan setibanya di Medan, Selasa (12/10), usai menghadiri Rapat Konsultasi ke Dewan Riset Nasional (DRN) Jakarta. Hervian mengatakan, DRDSU dipercaya oleh DRN sebagai penyaji utama dengan materi “Sharing Tupoksi dan Aktivitas DRDSU” yang mewakili DRD seluruh Indonesia dalam sidang Paripurna II DRN tahun 2010 di hadapan Kementrian Ristek RI dan DRN, yang juga dihadiri unsur Lembaga Pemerintah Non Kementrian antara lain LIPI, LAPAN, BATAN, serta DRD Provinsi, DRD kabupaten/kota se-Indonesia pada Desember 2010 mendatang di Pusat Penelitian dan Pengembangan Ilmu Pengetahuan (Puspiptek) Serpong Tangerang, Banten. “Kesiapan Sumut sebagai DRD percontohan telah dipaparkan Sekretaris DRDSU Azizul Kholis kepada Sekretaris DRN Pusat Dr Ir Tusi Adibroto, MSi di gedung BPPT, Jakarta pusat, Senin (11/10),” sebut Hervian. Hervian menjelaskan, di samping membahas kesiapan Sumut sebagai DRD Percontohan Nasional, pada rapat konsultasi tersebut juga dibahas beberapa rencana kegiatan DRDSU tahun 2010, antara lain pemaparan pokok-pokok pikiran Aktual DRDSU kepada Gubsu Syamsul Arifin, SE di Ruang Rapat I Kantor Gubernur, Rabu (13/10), yang memba-

has bidang Pertanian, Kehutanan, Tata ruang wilayah, Infrastruktur dan Manajemen transportasi khususnya untuk mengatasi kemacetan lalulintas di Kota Medan. Kemudian persiapan acara Workshop DRDSU dengan topik “Tugas pokok dan fungsi DRDSU” yang dirangkai dengan diskusi Publik dengan topik “Pengembangan Smart Office pada Instansi Pemerintah Daerah berbasis digital kerjasama PT IBM Indonesia, Balitbangsu dan DRDSU yang akan dilaksanakan 2 November 2010 di Hotel Garuda Plaza Medan. Selanjutnya pada sesi akhir diskusi Rapat Konsultasi dijelaskan secara detil tentang rencana Visi, Misi dan Program kerja DRDSU tahun 2010-2014 dan kegiatan tahun 2011 yang menyangkut penyusunan kebijakan strategis pembangunan daerah (Jakstrada) bidang iptek tahun 2010-2014. Penyusunan agenda riset daerah tahun 2011- 2015, sinergi program kerja DRDSU dan Balitbangsu, pembentukan DRD Kabupaten/ Kota se-Sumut serta penyelarasan program kerja DRDSU dengan DRN yang menyangkut proposal intensif riset dari kementrian Ristek RI tahun 2011. Dengan demikian, Hervian berharap DRD Sumut dapat menjadi percontohan skala nasional baik dalam penguatan kapasitas kelembagaan, capaian target kinerja maupun dalam hal inovasi dan akselerasi program kerja sebagai perumus kebijakan strategis pembangunan daerah yang dapat memberikan berbagai bahan kebijakan untuk Gubernur Sumatera Utara. (m41)

Waspada/ist

Sebagian keturunan H Kasyim alias Undana foto bersama dalam acara temu kangen keluarga.

Keturunan H Kasyim Temu Kangen MEDAN ( Waspada): Untuk menjalin silaturahmi dan mengenalkan warisan leluhur serta menumbuhkan semangat kebersamaan, keluarga besar banten keturunan (trah) H Kasyim alias Undana dengan Jamirah yang berada di Aceh, Sumatera Utara dan Riau mengadakan Temu Kangen Keluarga di Indrapura, Batubara, Minggu (10/10). Drs Zulkarnain, fasilitator pertemuan menyebutkan sejarah singkat keberadaan keturunan H Kasyim alias Undana dan Jamirah di Sumatera (Deli). Bermula dari kedatangan orang-orang banten yang dibawa Belanda untuk bekerja di perkebunan. Setelah habis masa kerja atau kontrak, sebagian kembali ke Banten dan sebagian lagi tetap berada di tanah Deli, yang kemudian berumah tangga dan memiliki keturunan hingga tersebar ke Aceh dan Riau. “Ribuan keturunan H Kasyim alias Undana kini tersebar di wilayah Sumatera dengan beragam profesi. Untuk itu kami berinisiatif mempertemukan para anggota keluarga agar saling kenal dan meningkatkan tali silaturahmi,” ujar mantan Sekretaris Camat Pagurawan itu.

Dikatakannya, temu kangen keluarga dapat menjadi ajang perkenalan antar anggota keluarga yang selama ini belum pernah bertemu atau tidak kenal sebelumnya. Sementara bagi anggota keluarga yang telah lama tidak bertemu, akan membangkitkan kenangan manis masa lalu yang akan terus diingat seumur hidup. Sementara salah seorang keturunan H Kasyim alias Undana yang menetap di Aceh, Zulkarnain, SKM MKes atau lebih akrab dipanggil Cecep, menyatakan, dengan dilaksanakannya temu kangen ini diharapkan tercipta persaudaraan yang lebih erat, sehingga pada akhirnya akan melahirkan sikap solider, empati, kasih sayang, dan sikap-sikap baik lainnya. “Bagaimana pun temu kangen ini akan membantu kita menguatkan hubungan silaturahmi dengan keluarga besar,” ujar Zulkarnain, yang menjabat sebagai Kadis Kesehatan Subussalam, Aceh. Acara temu kangen keturunan H Kasyim alias Undana ini dimulai dengan pembacaan ayat suci Al-Qur’an, tausiyah oleh Al Ustadz H Sofyan Han, do’a dan dilanjutkan dengan makan bersama.(cat)

WASPADA Sabtu 16 Oktober 2010

Orang Muda Diplot Pimpin PD Sumut MEDAN (Waspada): Ketua Partai Demokrat Sumut periode ke depan sebaiknya berasal dari kader muda. Karena komposisi kepemimpinan orang muda sudah menjadi ciri khas partai pemenang pemilu tersebut dalam kepengurusan Ketua DPP Anas Urbaningrum. “Kalau dilihat dalam komposisi DPP, Ketua, Sekjen dan Bendahara DPP Partai Demokrat orang muda. Maka sebaiknya di Sumut juga seperti itu,” kata Ketua DPD Partai Demokrat Sumut Palar Nainggolan, Rabu (13/10). Palar mengatakan, regenerasi kepada kader muda juga menjadi salah satu alasannya enggan mencalonkan diri kembali dalam Musda ke II Partai Demokrat Sumut dalam waktu dekat ini. “Sudahlah, usia saya kan sudah 62 tahun. Saya ingin regenerasi partai berjalan. Sekarang saatnya yang muda-muda lah,” kata Palar. Palar sendiri membantah isu adanya calon khusus yang akan diusungnya untuk meneruskan kepemimpinan Partai Demokrat Sumut. “Tidak benar itu ada calon saya. Saya pasti ada memilih karena punya hak suara. Tapi kalau ikut dukung mendukung saya kira tidak,” katanya. Terkait pelaksanaan Musda, Palar menjelaskan kepastian jadwal pelaksanaan Musda baru akan diketahui pasca perayaan HUT Partai Partai Demokrat di Jakarta pada 17 November mendatang. Kemungkinan akan dilaksanakan di Prapat sesuai permintaan DPP Partai Demokrat. Palar menambahkan, peserta Musda yang akan memiliki hak suara adalah 33 DPC Partai Demokrat di Sumut, satu suara Ketua DPD dan satu suara dari DPP. Sementara itu, Ketua Panitia Musda T. Dirkhyansah membenarkan memang belum ada kepastian dari DPP Partai Demokrat tentang tanggal dan tempat pelaksanaan Musda Sumut. Seperti diketahui ada lima nama yang disebut-sebut akan mencalon diri sebagai Ketua Partai Demokrat. Seperti Ketua DPRD Sumut Saleh Bangun, Sekjen DPD Partai Demokrat Rahmad Hasibuan, Anggota DPRD Sumut Arifin Nainggolan, serta dua kepala daerah yang dicalonkan partai, Walikota Medan Rahudman Harahap dan Bupati Deli Serdang AmriTambunan.(h11)

Pencuri Ranmor Ditangkap MEDAN (Waspada): Polsekta Medan Kota menangkap seorang pencuri kendaraan bermotor (Ranmor) setelah setahun melarikan diri ke berbagai daerah dalam penyergapan dari warung internet Kazam Jalan Halat, Medan, Rabu (13/10) sekira pukul 23.00 WIB. Tersangka TMH alias Habib, 20, warga Jalan Halat Gang Wakaf, kemudian diboyong ke Polsekta Medan Kota sedangkan rekannya yakni Thomas hingga kini masih diburon. Menurut pengakuan tersangka Habib di Mapolsek Medan Kota, Kamis (14/10), pencurian itu dilakukan Thomas, di sebuah rumah kos Jalan Karya Bakti, Kelurahan Gedung Arca, Medan, pada Maret 2009 lalu. Saat itu dia mengambil sepeda motor Yamaha Vixion BK 4283 GF menggunakan kunci T. “Setelah itu dia membawanya ke tempat kami berkumpul di Jalan Gedung Arca. Beberapa hari kemudian, kami berhasil menjual sepeda motor itu seharga Rp1 juta kepada Donny, warga Jalan Yos Sudarso, Medan,” terang Habib. Uang hasil penjualan sepeda motor curian tersebut, katanya, dibagi dan setelah itu mereka berpisah. Habib mengaku dirinya langsung menuju Sibolga dan Tebingtinggi, menghindari kejaran polisi. Setahun berpindah-pindah dari dua kota itu, tersangka tak memiliki pekerjaan tetap. Menjelang lebaran, Habib kembali ke Medan namun tetap berusaha bersembunyi. Pelarian Habib berakhir saat hendak main game di warnet. Dia diringkus tanpa perlawanan. “Tersangka kini diproses dan rekannya yang mengambil sepeda motor tersebut, sedang dikejar,” kata Kapolsek Medan Kota AKP Sandy Sinurta, SiK melalui Kanit Reskrim Iptu S Simaremare. (m39)

Mengadu Soal Tanah Ke Walikota MEDAN (Waspada): Pasangan suami istri Johanes Ong, 50 dan Emilia Saera, 48, warga Jalan Sei Sikambing, Kelurahan Sekip, mengadukan warga Selam III dengan melayangkan surat ke Walikota Medan Drs Rahudman Harahap. Johanes mengadukan Tan Kim Tjhoa, warga Jalan Selam III No. 25 Medan, yang ditudingnya telah melakukan penyerobotan tanah. Saat ini Tan Kim Tjhoa sedang melaksanakan pembangunan rumah tempat tinggal (RTT) persis di samping rumahnya. Menurut Johanes, pembangunan rumah tersebut berdasarkan Izin mendirikan Bangunan (IMB) No./0105/648/2229/1503/ 09 tanggal 19 Januari 2010 yang dikelurakan Pemko Medan. Tapi dalam kenyataannya, Tan Kim Tjhoa telah melanggar izin dengan memperluas bangunan diluar izin. “Luas Bangunan rumah Tan Kim Tjhoa yang tertera di surat izin pemerintah Kota Medan melalui Dinas Tata Ruang Dan Tata Bangunan, seluas 208 meter persegi. Tapi kenyataannya luas bangunan itu melebihi. Bahkan dinding rumah saya juga diserobotnya,” ujar Johanes di dampingi istrinya Emilia Saera kepada wartawan, Rabu (13/10). Dengan adanya penyerobotan tanah tersebut, Johanes beserta keluarganya merasa terganggu akan keselamatan dan ketenangannya. Sebab, selama proses pembangunan tersebut bahan material bangunan berjatuhan ke atap rumah dan pekarangan rumah Johanes. Bahkan, bangunan belakang rumah tersebut menyerobot tanah mereka dan bangunan lantai duanya didirikan di atas rumah mereka. “Saya sudah sering memperingati, tapi Tan Kim Tjhoa sepertinya tidak peduli dan tetap melanjutkan pembangunan rumahnya,” ungkap Johanes. Dengan adanya dugaan pelanggaran izin IMB, Johanes pun melayangkan surat ke Pemko Medan untuk meninjau kembali izin pembangunan rumah Tan Kim Tjhoa tersebut. “Saya mohon kepada instansi terkait terutama Dinas TRTB turun ke lokasi untuk meninjau langsung pembangunan yang menyalahi izin itu. Bila permohonan saya ini tidak diterima, maka saya berencana akan melaporkan kasus ini ke DPRD Medan dan kalau perlu ke Presiden langsung,” tegasnya. (m39)

Polda Tidak Ada Persiapan Khusus MEDAN (Waspada): Kepolisian Daerah Sumatera Utara tidak melakukan persiapan secara khusus menyikapi isu akan adanya aksi besar-besaran yang bakal dilakukan berbagai elemen masyarakat di tanah air terkait setahun kepemimpinan Presiden Susilo Bambang Yudhoyono pada 20 Oktober mendatang. Hingga kemarin, pihak Direktorat Intelkam Polda Sumut belum menerima laporan dari elemen atau lembaga masyarakat yang akan melakukan aksi. Bahkan, pihak kepolisian juga belum memperoleh informasi bakal adanya pergerakan pada 20 Oktober mendatang. “Persiapan khusus belum ada, karena kita juga belum ada menerima laporan akan adanya aksi pada 20 Oktober,” kata Kapolda Sumut Irjen Pol. Oegroseno melalui Kasubbid Dok Liput AKBP MP Nainggolan kepada wartawan, Rabu (13/10). Sejauh ini, menurut Nainggolan, berdasarkan informasi dari intelijen, belum ada termonitor pergerakan-pergerakan di Sumut terkait dengan isu akan adanya aksi besar-besaran sehubungan dengan setahun masa kepemimpinan SBY-Budiono. Kendati demikian, Nainggolan menyebutkan, Polda selalu siap untuk melakukan pengamanan terhadap aksi massa yang diisukan akan dilakukan pada 20 Oktober mendatang. “Gerakan massa belum ada termonitor di Sumut,” tukas Nainggolan. Seperti diketahui, Polri telah mengeluarkan prosedur tetap (Protap) untuk pemberlakukan tindakan tegas tembak di tempat bagi pelaku aksi (demo-red) yang anarkis serta membahayakan masyarakat dan aparat. Protap Nomor 1/X/30120 pada 8 Oktober 2010 itu memuat mekanisme sikap anggota Polri di lapangan. Protap yang dikeluarkan Kapolri tersebut terikat dengan peraturan hukum, serta ada kriteria bagi polisi dalam mengambil tindakan tegas. Kriterianya, jika terjadi kemungkinan ancaman yang menyebabkan kematian atau luka berat. (m39)

Medan Metropolitan

A5

Limbah Ternak Babi Penuhi Parit MEDAN (Waspada): Limbah berupa kotoran ternak babi di Kecamatan Medan Denai masih memenuhi saluran parit. Bila hujan turun, maka limbah yang berpotensi menimbulkan penyakit tersebut melimpah ke halaman rumah warga. Namun, Pemerintah Kota Medan terkesan tutup mata tanpa memberi tindakan tegas kepada pemilik ternak. “Semua parit di tempat ini dipenuhi kotoran ternak babi. Bila hujan turun, limbah melimpah dan menggenangi halaman rumah warga. Bukan itu saja, aroma tidak sedap juga terasa sangat menyengat,” kata Kifli warga Lingkungan IX, Kelurahan Tegal Sari Mandala II, Kec. Medan Denai kepada Waspada, Jumat (15/10). Seharusnya, kata Kifli, Pemko Medan bertindak tegas terhadap para pemilik ternak yang seenaknya membuang kotoran ternak babi ke saluran parit. Sebab, limbah itu dapat menyebabkan berbagai penyakit bagi warga di Kec. Medan Denai. “Jadi warga disini bukan saja mencium aroma tidak sedap, namun bisa juga tertular penyakit. Karena itu, kita minta kepada Walikota Medan Rahudman Harahap agar segera menertibkan ternak babi yang ada di tempat ini,” ucap Kifli. Hal senada dikatakan Sulaiman warga setempat. Keresahan warga terhadap ternak babi di Kecamatan Medan Denai sudah lebih 30 tahun, namun sampai saat ini Pemko Medan tidak bisa menertibkannya. Padahal sudah ada Peraturan Walikota (Perwal) tentang larangan ternak kaki empat di Kota Medan. “Kita heran kenapa Pemko tak mampu menertibkan ternak tersebut. Padahal sudah jelasjelas ada Perwal tentang lara-

ngan ternak kaki empat di Kota Medan. Tapi, sampai saat ini belum juga ditertibkan. Sangat disayangkan kalau Pemko kalah dengan warganya,” ucapnya. Sulaiman menambahkan, sampai saat ini ternak babi yang ada di kecamatan Medan Denai belum ditertibkan secara maksimal. Padahal sudah lebih dua minggu ratusan peternak babi tersebut sudah menerima biaya transportasi dari Pemko Medan. “Janji walikota dulu pada saat sosialisasi bagi peternak yang telah menerima biaya transportasim, wajib memindahkan ternaknya setelah satu minggu. Tapi kenyataannya sampai saat ini belum ada yang memindahkan ternaknya dari tempat tersebut,” tuturnya. Hal ini menunjukkan bahwa Pemko Medan tidak punya wibawa lagi, karena masyarakat tidak peduli dengan kebijakan walikota. Sementara itu, Kepala Dinas Pertanian dan Kelautan Kota Medan IrWahid ketika dikonfirmasi mengatakan, penertiban ternak babi di Kec. Medan Denai sudah dimulai, namun belum dilakukan secara menyeluruh. Sampai saat ini yang sudah menerima biaya transportasi sebanyak 400 peternak.“Pemilik ternak meminta waktu sampai akhir tahun ini semua ternak disana sudah ditertibkan. Jadi, kita tunggu dulu,” ucap Wahid. Sementara itu, Wakil Ketua DPRD Medan Ikhrimah Hamidy ketika diminta tanggapannya mengatakan, apa yang dilakukan Pemko Medan dengan memberi biaya transportasi kepada pemilik ternak sudah tepat. Tapi harus segera ditindaklanjuti. “Diminta kepada Dinas Pertanian dan Kelautan agar secepatnya menyelesaikan persoalan itu sesuai arahanWalikota Medan.,” ujarnya. (h10)

SAMPAH BERSERAK: Seorang warga mencuci pakaian di tengah serakan sampah di pinggiran Sungai Deli Medan, Senin (12/ 10).Masyarakat pinggiran sungai itu terus menggunakan air sungai untuk kebutuhan sehari-hari tanpa menghiraukan dampak dari lingkungan yang tidak bersih tersebut.

Waspada/Hamdani

Perpanjangan Kontrak Inalum Ditolak MEDAN (Waspada): Mayoritas Fraksi di DPRD Sumut meminta pemerintah untuk tidak memperpanjang kontrak dengan pemerintah Jepang sebagai pengelolaan PT Inalum yang akan segera berakhir pada 2013 mendatang. Penolakan tersebut disampaikan dalam pandangan umum yang dibacakan masing-masing juru bicara fraksi dalam sidang paripurna membahas Rancangan Anggaran Pendapatan dan Belanja Daerah (RAPBD) 2011, Kamis (14/10), di gedung dewan Jalan Imam Bonjol Medan. Setidaknya ada enam fraksi, PPP, Demokrat, Golkar, Hanura, PDI Perjuangan dan PKS yang menyampaikan permintaan agar proses pengambilalihan Inalum melibatkan Pmprovsu dan DPRD Sumut. Fraksi PPP melalui juru juru bicaranya, Abul Hasan Maturidi

meminta Pemprovsu menyampaikan penegasan kepada pemerintah pusat agar proses pengambilalihan keputusan terhadap PT Inalum melibatkan DPRD Sumut bersama Pemprovsu, sehingga aspirasi daerah tidak dianggap sepi pemerintah pusat. “Inalum sebagai salah satu kebanggaan masyarakat Sumut juga memiliki effect social dan ekonomi. Untuk itu dalam rangka menyikapi masa akhir kerjasama Indonesia dengan Jepang terhadap operasional Inalum, maka untuk kesekian kalinya kami meminta agar Pemprovsu mengambil langkah tegas dan konkret agar Inalum kembali ke pangkuan ibu pertiwi,” katanya. Fraksi Demokrat dalam pandangan umumnya juga meminta agar Gubsu berperan aktif dalam upaya pengambilalihan PT Inalum oleh kementrian

BUMN. Untuk itu, pemerintah pusat harus melibatkan Pemprovsu dan DPRD. “Sehingga Sumut ke depan akan bebas dari krisis listrik atau dapat pula ber-peran sebagai daerah penghasil alumunium terbesar di tanah air,” kata juru bicara fraksi terbe-sar di DPRD Sumut itu. Permintaan untuk tidak lagi memperpanjang kontrak PT Inalum juga disampaikan Fraksi PDI Perjuangan. Mereka berpendapat, selama 27 tahun beroperasi, perusahaaan tersebut belum memberikan manfaat yang berarti bagi masyarakat Sumut, termasuk kabupaten/kota di sekitarnya Fraksi PDI Perjuangan berharap agar pemerintah tidak lagi memperpanjang kerjasama pengelolaan PT Inalum ini, tetapi dikelola langsung pemerintah. (h11)

Keterlibatan Oknum Aparat Dibungkam MEDAN (Waspada): Kapolresta Medan enggan menyebutkan keterlibatan oknum aparat dalam kasus penemuan ribuan amunisi di gudang pabrik peleburan timah CV HRC Diesel Industri di Jln Tanjung Balai, Srigunting Sunggal, kemarin. Kapolresta Medan Kombes Pol Tagam Sinaga melalui Kasubag Humas AKP Edward T kepada wartawan, Jumat (15/10) siang menjelaskannya, dalam kasus penemuan ribuan amunisi ini, pihak Polresta Medan masih melakukan penyelidikan. Disinggung tentang keterlibatan oknum aparat baik itu Polri maupun TNI, Edward enggan menyebutkan. “Belum bisa dibilang keterlibatan aparat.” Para tersangka yang telah ditetapkan masing-masing berinisial Es selaku perantara, Bt selaku kepala pabrik peleburan, R selaku penyortir, J selaku penyortir, A selaku penimbang dan A alias H selaku penimbang. (m39)

Rumitnya Orang Miskin Dapat Pengobatan BEGINILAH nasib orang miskin yang hendak mendapatkan pelayanan kesehatan. Mereka harus pasrah dengan tegak berjam-jam di sebuah tempat instalasi pengobatan. Mereka hanya bisa mengeluh dan mengeluh. Memang hanya itu yang bisa dilakukan. M. Yamin, 54, warga Belawan, salah satu pasien miskin yang saat itu mengantarkan anaknya berobat di RSUP H Adam Malik Medan, Jumat (15/10) pagi dengan bantuan kartu Jaminan Kesehatan Masyarakat (Jamkesma) harus menunggu sampai 45 menit di ruang pendaftaran pasien. Itu baru akan mendapatkan kartu berobat. Setelah mendapatkan kartu tersebut,di Ruang Poliklinik Penyakit Dalam pun,Yamin terpaksa ngantre karena banyaknya pasien di sana. “Saya datang jam setengah sepuluh lewat, karena pasien banyak ngantre, jadi sampai jam sepuluh lewat saya dapatkan kartu. Di Poli pun kami ngantre lagi karena banyaknya pasien, setelah anak saya dipanggil dan diperiksa, saya disuruh ke ruangan Radiologi untuk bawa anak rontgen, tapi saat

mendaftar di Radiologi, pendaftarannya sudah tutup, besok lagi kami ke sini,” ujarnya sembari menyebutkan anaknya menderita sesak nafas. Yamin mengaku kecewa karena dia dan anaknya harus balik lagi ke RSUP H. Adam Malik Medan untuk difoto. “Rumah saya jauh di Belawan sana, saya pikir sampai di sini diperiksa, penyakitnya langsung ketahuan dan langsung dikasih obat. Rupanya harus foto (ronsen-red) dulu,” katanya sembari berharap agar pendaftaran untuk pasien Radiologi ditutup lebih lama. Pejabat rumah sakit itu, Sairi M. Saragih, menyebutkan, keluhan itu dianggapnya wajar, apalagi kondisi si pasien sedang sakit. Setiap orang sakit pasti tidak mau berlama-lama, apalagi harus bolakbalik. Bukan tidak dilayani, tapi harus ikut prosedur. Semuanya harus ngantre itu sesuai prosedur. Menurutnya, setiap hari jumlah pasien Jamkesmas untuk rawat jalan, baik itu pengunjung baru dan pasien yang sudah dijadwalkan datang atau yang disebut dengan kunjungan, mencapai tiga ratus

Waspada/Ist

Kepala Dinas Kebudayaan dan Pariwisata Sumatera Utara Sudarno di dampingi Kepala Dinas Kebudayaan dan Pariwisata Simalungun (lima dari kanan), Drs Kharsell Sitanggang, Dra. Cut Tami selaku ketua panitia, Director Badan Promosi Pariwisata Daerah Sumut Didit Mahadi Kadar memukul gong sebagai tanda diresmikan festival Tari dan Musik Simalungun, Tor Tor Sombah dan Mar Ilah.

Wisatawan Apresiasi Festival Seni Simalungun MEDAN(Waspada): Pagelaran Festival Tor Tor Sombah dan Mar Ilah yang diselenggarakan Dinas Kebudayaan dan Pariwisata Sumatera Utara di Pujasera Siantar Hotel, Pematangsiantar, Kamis (14/10), mendapat apresiasi yang tinggi dari masyarakat luas dan wisatawan. Festival Tor Tor Sombah dan Mar Ilah dibuka Kepala Dinas Kebudayaan dan Pariwisata Sumatera Utara Sudarno didampingi Kepala Dinas Kebudayaan dan Pariwisata Simalungun Drs. Kharsell Sitanggang, Ketua Panitia Dra. Cut Tami, Director Badan Promosi Pariwisata Daerah Sumut Didit Mahadi Kadar ditandai dengan pemukulan gong. Dalam sambutannya Sudarno mengatakan, festival ini diselenggarakan atas dukungan penuh dari Kementerian Kebudayaan dan Pariwisata dalam rangka mengembangkan dan melestarikan kebudayaan

daerah Simalungun sehingga nilai-nilai luhur kebudayaan di Sumut tersebut dapat dipertahankan. ‘’Saya memberi apresiasi yang sangat tinggi kepada seluruh masyarakat dan generasi muda Simalungun karena telah berpartisipasi menyukseskan festival ini. Semoga apa yang menjadi harapan kita semua untuk mengembangkan potensi budaya lokal sekaligus melestarikan kebudayaan daerah ini dapat tercapai dengan baik,’’ kata Sudarno. Sementara itu, Didit Mahadi Kadar menambahkan festival Tor Tor Sombah dan Mar Ilah ini dimaksudkan untuk melestarikan seni tradisional serta meningkatkan apresiasi dan kepedulian masyarakat terhadap budaya seni. Penampilan para grup tari ini merupakan sa-lah satu cermin keanekaraga-man kultur budaya Sumatera Utara. ‘’Potensi budaya lokal ini menjadi daya tarik wisata dan

salah satu ikon pariwisata Provinsi Sumatera Utara guna meningkatkan kunjungan wisatawan nusantara maupun mancanegara sehingga memacu perekonomian daerah. Kemudian, meningkatkan gairah dan kreativitas masyarakat dalam menjaga dan melestarikan seni budaya,’’ujarnya, Festival Tari dan Musik Simalungun, Tor Tor Sombah dan Mar Ilah ini diikuti 80 peserta dari delapan sanggar tari di antaranya Sanggar Devi, Merry Junod, SMA Negeri I Siantar, Mutiara Kasih, Sanggar Aka, Horasi, Seni Kecamatan Siantar dan DKBM Cabang Horasi Serbelawan. Penampilan grup tari dinilai tiga dewan juri independen yakni Saman Purba, SPd, Amerta Purba, SPd dan Drs. Albert Lingga dengan kriteria penilaian wiraga, wirama, wirasa dan harmonisasi. Festival berakhir di Pujasera Hotel Siantar, Jumat (15/10). (m08)

lebih pasien. Sedangkan untuk rawat inap perharinya mencapai seratus lebih pasien. “Rata-rata pengunjung baru mencapai 144 pasien, sedangkan kunjungan bisa mencapai 176 persen. Belum lagi rawat inap yang mencapai seratus lebih. Dengan pasien sebanyak ini setiap harinya, pasti memakan waktu lama. Karena setiap pasien baru harus ditanya penyakitnya lagi untuk dibuat medical record-nya,” ungkapnya. Mengenai cepat tutupnya pendaftaran di Ruang Radiologi, pejabat itu mengatakan sudah sesuai prosedur pendaftaran untuk di rontgen hanya sampai jam 13.00 siang. Sedangkan pendaftaran pasien untuk rawat inap hari Senin sampai Kamis pukul 13.00 siang, sedangkan untuk hari Jumat dan Sabtu tutup lebih cepat yakni, 10.30 dan 11.30. Pejabat lain, M. Nur Rasyid Lubis, malah mengatakan jumlah alat rontgen terbatas karena berusakan. Tetapi ada yang sedang diperbaiki. * Mursal AI

200 Pengasuh Ponpes Dilatih Kelola Perpustakaan

Seminar Peranan Marga Kembangkan Pariwisata

MEDAN (Waspada): Sebanyak 200 orang pengasuh pondok pesantren (ponpes) di Sumatera Utara mendapatkan pelatihan pengelolaan perpustakaan oleh Badan Perpustakaan Arsip dan Dokumentasi (BPAD) Sumut. Kegiatan berlangsung, Rabu dan Kamis (13 s/d 14) di Aula Hotel Antares Medan Medan, Rabu (13/10). Acara itu dibuka Kepala BPAD Sumut Nurdin Pane diwakili Sekretaris Chandra Silalahi. Silalahi dalam sambutannya mengatakan, pelatihan pengelolaan perpustakaan kepada 200 ponpes ini merupakan bukti visi dan misi Gubsu agar rakyat tidak bodoh sudah masuk melalui pelatihan pengelolaan perpustakaan untuk ponpes. Untuk tahun depan, menurut Silalahi, sudah dianggarkan dalam APBD Provinsi Sumut untuk 10 ponpes berupa bantuan buku-buku dan mobiler. Nilainya ini mencapai Rp55 juta per ponpes. “Ini sudah bisa untuk sarana minimal sebuah perpustakaan di ponpes di luar p e m b a n g u n a n g e d u n g ,” katanya. Sementara itu, Ketua Badan

MEDAN (Waspada): Panitia Pesta Danau Toba Tahun 2010 bersama Forum Komunikasi Toga Simamora Sumatera Utara (FKTS-SU) menggelar seminar terbuka bertopik “Peranan Marga Melestarikan dan Mengembangkan Budaya Dunia Pariwisata di Sumatera Utara” bertempat di Balai Rama Hotel Tiara Jalan Cut Meutia Medan, Senin (18/10). Anggota DPD RI asal Sumatera Utara Parlindungan Purba, SH, MM, di dampingi unsur panitia Tohap P. Simamora dalam siaran persnya menjelaskan, kegiatan seminar peranan marga bertujuan memperkenalkan marga-marga yang ada di kalangan etnis Batak, sekaligus menjadikan margamarga sebagai salah satu ciri khas kepariwisataan Sumatera Utara. Peserta seminar yang diundang adalah tokoh-tokoh marga yang ada di Medan. Parlindungan, yang juga Ketua Umum Pesta Danau Toba mengungkapkan, hasil rumusan dari seminar yang pesertanya berasal dari Tokoh-tokoh Parsadaan Marga Batak akan didokumentasikan dalam buku sehingga dapat digunakan di sekolah-sekolah sebagai materi pelajaran kurikulum lokal. “Kita berharap, pemerintah dalam hal ini Menteri Pendidikan Nasional dapat mengapresiasi Rumpun Marga Batak menjadi bagian dari kurikulum lokal di sekolah-sekolah sehingga generasi muda lebih mengenal marga-marga sebagai sebuah identitas,” tambahnya. Seminar yang menghadirkan narasumber Rektor Universitas Darma Agung Medan Prof. Robert Sibarani ini merupakan rangkaian kegiatan Pesta Danau Toba yang akan digelar di Parapat pada 20 – 24 Oktober 2010.(rel/m08)

Silaturahim Ponpes Sumatera Utara Yulizar Parlagutan Lubis mengatakan, secara pribadi dan seluruh komunitas pesantren memberikan apresiasi yang tinggi, khususnya kepada BPAD Sumut dan secara khusus kepada gubernur yang menunjukkan atensi dan kepedulian mereka kepada keberadaan ponpes di Sumut. Sementara itu, Yulizar Parlagutan Lubis berharap dari komunitas pesantren menginginkan ada prestasi yang lebih dari BPAD Sumut, seperti mengadakan pojok kitab kuning. Adapun sejumlah ponpes yang mengikuti pelatihan antara lain, Arraudatulhasanah, TPI Darul Hikmah, Ta’di Asyakirin, Al Kausar Akbar, Darularafah Raya, Alimuklisin, Al Qomariah, Al Husnah, Saefullah, Nurul Hakim, Zakiyun Najah, Hidayatulah, Darul Muklisin, Qismul Aly Firdau, Kwala madu, Jabal Rahmah, Ibadurrahman, Ulumul Quran, Babussalam, Tajussalam, Az Zuhrah, As Shidiqiyah, AlYusriyah, Al Ikhlas, An Nadwa, Sabilul Mukminin, Darul Mursyid, Ponpes Muhammadiyah, KH Dahlan, Abu Bakar Siddik, Baharuddin Harahap dan sejumlah ponpes lainnya. (m36)

Waspada/Ist

Pelatihan pengelolaan perpustakaan dari BPAD Sumut di Hotel Antares Medan.

Opini

A6

WASPADA Sabtu 16 Oktober 2010

Pendidikan Kita Butuh Grand Design TAJUK RENCANA

Bangsa Ini Harus Bangkit Dari Keterpurukan

B

icara soal kondisi bangsa Indonesia saat ini boleh dikatakan sangat miris. Dahulu begitu perkasanya bangsa ini di kawasan Asia Tenggara, Asia bahkan dunia.Boleh dikatakan, batukpun bangsa Indonesia, maka negara tetangga sudah harus siap-siap untuk melihat apa yang sedang direncanakan bangsa ini. Namun kini semua seakan sirna. Tidak ada lagi sebuah bangunan kebanggaan dari negara ini. Hampir seluruh bangsa di dunia seakan tidak ada lagi memandang Indonesia sebagai sebuah kekuatan yang patut dikhawatirkan. Mulai dari masalah olahraga hingga pada akhirnya pertahanan keamanan. Hampir boleh dikatakan, tidak ada lagi mengganggap Indonesia sebagai sebuah ancaman yang harus ditakuti. Kita bukannya mau mengajak anak bangsa ini menjadi sebuah kelompok yang anarkhisme walau itu yang terjadi belakangan. Namun kita mau mengajak para anak bangsa ini bangkit dari keterpurukan dan sama-sama membangun diri, lingkungan sekitar hingga pada akhirnya bangsa ini menjadi sebuah bangsa yang besar dan bermartabat. Tentu kalau kita mau jujur dengan merunut ke belakang, tentunya banyak hal yang harus kita perbaiki sejak awal kembali. Saat ini bangsa Indonesia tidak memiliki yang namanya sebuah rancangan pembangunan yang jelas dan tegas serta berkesinambungan. Yang ada adalah rancangan pembangunan semu. Dikatakan semu karena jika ada pergantian pimpinan maka bergantilah rancangan pembangunan itu tadi. Jadinya pembangunan itu tidak ada nyambungnya dan boleh dikatakan tidak akan pernah selesai sebuah pembangunan jembatan karena tidak ada nyambungnya. Pemerintahan yang sebelumnya membangun jembatan dari sisi kanan, sementara pemerintahan yang baru membangun dari sisi kiri. Intisari Belum lagi bangsa ini harus menghadapi sebuah konflik komunal yang terMembangun bangsa ini jadi secara sporadis namun sebenarnya denganhatinuraniyangjujur berawal dari ketidaksamaan pendapatan tentu akan menjadikan yang diawali juga karena tidak adanya perencanaan pembangunan. Kebijakannegara ini lebih baik lagi. kebijakan pembangunan pemerintah dianggap mendasari munculnya fenomena kekerasan komunal ini. Kebijakan tersebut cenderung meminggirkan masyarakat asli, dan akhirnya menjadi penonton atas ”pembangunan” di daerah mereka. Hal ini diperparah dengan maraknya perusahaan-perusahaan besar yang berbondong-bondong datang mengeruk sumber daya alam, yang dengan susah payah dijaga oleh masyarakat asli sesuai nilai kultural mereka. Saat para warga asli daerah secara sistematis dimarginalkan, pada saat bersamaan mereka mengalami represi saat berusaha menyuarakan keprihatinan mereka kepada pihak penguasa, baik nasional maupun lokal. Akibatnya, warga pendatang yang dianggap turut serta menikmati hasil eksploitasi sumber daya itu akhirnya dianggap musuh yang jelas terlihat. Dapat ditebak, akhirnya ketidakpuasan itu meledak menjadi sebuah kekerasan yang ditujukan kepada warga pendatang. Hal ini juga didorong faktor lain, yaitu adanya anggapan masyarakat pendatang sering tidak menghormati nilai-nilai budaya lokal, dan terlalu menjunjung ekslusivisme kesukuan yang sempit. Lalu belum lagi sikap elit pemerintah dan politik yang selalu saja berusaha mencari keuntungan sendiri dengan mengabaikan hampir seluruh nilai. Inilah yang harusnya bisa kita hindari untuk kemudian kita sama-sama membangun bangsa ini lebih maju lagi. Sudah seharusnya para anak bangsa ini meninggalkan yang namanya kegiatan hanya untuk mencari keuntungan sendiri. Yang ada di depan mata kita sekarang ini adalah banyaknya sikap koruptif yang sungguhsungguh naïf dan memalukan. Bangsa ini adalah bangsa yang besar. Jangan ada lagi yang namanya dikotomi agama, suku, ras dan golongan. Ayolah sama-sama kita menurut hemat kami untuk membangun bersama. Jangan ada lagi anak bangsa ini yang kemudian terpuruk dan hanya bisa menahan diri dalam ketidaksejahteraan yang hanya kemudian menciptakan sebuah lubang besar dan pada akhirnya meledak menjadi sebuah pemberontakan. Sudah saatnya bangkit bersama dan jangan ada lagi yang tertinggal.****

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com

Salam Perspektif Baru, Kita akan bicara mengenai hal sangat mendasar yaitu pendidikan dalam dimensi yang lebih reflektif. Beberapa waktu lalu, saya datang ke Bali untuk suatu seminar yang diadakan oleh Konrad Adenaeur Stiftung (KAS). Saya sangat terkesan dari penyampaian pendapat DR. Mohammad Abduhzen, M.Hum, Direktur Eksekutif Institute for Education Reform di Universitas Paramadina. Dia juga menjabat Ketua Departemen Research and Development di Pengurus Besar Persatuan Guru Republik Indonesia (PGRI). Menurut Abduhzen, sampai hari ini pendidikan kita tidak dirancang sedemikian rupa sebagai bagian dari suatu strategi pembangunan ekonomi di satu sisi, dan strategi pembangunan kebudayaan di sisi yang lain. Dampaknya, pada perjalanannya yang panjang, efek dari pendidikan itu seakan-akan tidak mempunyai korelasi yang nyata di dalam dunia nyata kita. Misalnya, selama 65 tahun kita menyelenggarakan sistem pendidikan nasional,situasi perekonomian masyarakat kita tidak mengalami perbaikan yang signifikan. Abduhzen mengatakan pendidikan kita harus memiliki sebuah grand design yang besar yang seharusnya datang dari perundang-undangan. Kemudian ada grand design yang dirancang oleh para ahli berdasarkan studi dan pengalaman kita sendiri serta pengalaman bangsa-bangsa lain. Lalu kita sepakati sebagai sebuah grand design yang berlaku dalam jangka waktu panjang. Jadi ke sana pendidikan ini harus di arahkan, dan itu yang tidak kita miliki sampai sekarang. Berikut wawancara Wimar Witoelar (WW) dengan Mohammad Abduhzen (MA). Wawancara lengkap dan foto narasumber dapat pula dilihat pada situs http://www.perspektifbaru.com. Lewat situs tersebut Anda dapat memberikan komentar dan usulan.

WW: Apa yang salah dalam pendidikan kita karena biasanya pembicaraan di masyarakat selalu beralasan karena kurang budget,salah ini - salah itu,ganti menteri dan pemerintah? Tolong Anda memberikan framework untuk melihat di mana sebetulnya masalah pendidikan dan dimana orang harus melihat masalahnya secara tepat? MA: Kalau masalah pendidikan dikategorikan, maka saya menemukan lima kategori problem. Pertama adalah problem-problem yang sifatnya fundamental. Kedua, problem yang sifatnya struktural. Ketiga, problem yang sifatnya operasional. Keempat, problem terkait masalah finansial. Kelima, problem terkait persoalan kultural. WW:Mana yang harus bisa ditangani dahulu dari kelima problem tersebut? MA: Saya kira yang paling penting untuk saat ini, dan ini juga karena akan mempengaruhiberbagaibidangpendidikan secara keseluruhan, ada dua problem. Pertama, problem yang sifatnya fundamental. Kedua, problem yang sifatnya struktural. Problem struktural ini adalah problem-problem politik pendidikan. Problem yang sifatnya fundamental itu yang memberikan arah ke mana pendidikan kita harus diarahkan. Kemudian, mengapa sebuah sistem pembelajaran sekolah yang kita pilih adalah yang ini dan tidak yang itu. Ini penting. Di sini ada hal fundamental yang harus kita kemukakan bahwasampaihariinipendidikankitatidak dirancangsedemikianrupasebagaibagian darisuatustrategipembangunanekonomi di satu sisi, dan strategi pembangunan kebudayaan di sisi yang lain. Dampaknya, pada perjalanannya yang panjang, efek dari pendidikan itu seakan-akan tidak mempunyai korelasi yang nyata di dalam dunianyatakita.Misalnya,selama65tahun kitamenyelenggarakansistempendidikan nasional, situasi perekonomian masyarakat kita tidak mengalami perbaikan yang signifikan. Contoh yang paling gamblang untuk kita kemukakan adalah ekonomi pertanian. Kita sudah tahu Indonesia adalah negara agraris. Karena itu kita membuat sekolah bernama Sekolah Menengah Pertanian, kemudian kita juga membuka program studi pertanian. Bahkan ada Institut Pertanian Bogor (IPB) yang sangat terkenal.Namunsetelah65tahunmerdeka dan menjalankan sistem pendidikan ini, apakah hari ini pertanian menjadi soko guru perekonomian Indonesia? Saya kira tidak. WW: Apakah itu karena sistem pendidikan atau sistem politik? MA: Ini merupakan implikasi dari kebijakan atau politik pendidikan yang saya maksud tadi. Pendidikan kita pada level operasionalnya seperti tidak punya arah dan pondasi yang jelas mau dikemanakan. Ini saya baru bicara dari segi ekonomi, sehingga konon pada hari ini tujuh dari sembilan bahan pokok non beras Indonesia tergantung pada asing, yang sebetulnya bisa dihasilkan oleh bumi kita yang luas ini. Konon juga, delapan dari 10 lulusan IPB tidak bekerja pada bidang pertanian. Lalu dari sisi kebudayaan, kita dengan terang bisa menangkap bahwa sekarang Kementerian Pendidikan Nasional sudah tidak berhubungan lagi dengan kebuda-

yaan. Itu membuat operasionalisasi pendidikan “bergentayangan” antara langit dan bumi dan tidak tahu kemana tujuannya. WW:Kalaukebudayaantidakmasuk pendidikan,kemanamasuknya?Apakah masuk ke komersial? MA: Ya, sedangkan dimana-mana secara filosofi, pendidikan itu sebagai upaya untuk memberadabkan dan membangun sebuah peradaban, dalam hal ini artinya kebudayaan. WW: Apa penyebab terjadi penyimpangan ini, dan kapan kira-kira bisa dilakukan koreksi? MA: Kalau menurut penelitian Professor C.E. Beeby. [red: professor asal New Zealand yang kompeten di bidang pendidikan] yang dilakukan pada 1972-1973, dia tidak pernah menemukan pemikiran yang sungguh-sungguh dan sistematis untuk mempertanyakan sistem pendidikan dan persekolahan yang dilakukan di Indonesia sewaktu tahun 1945-1946. Apakah sesuai atau tidak dengan kebutuhanmasyarakatpendukungnyasebagai negara yang merdeka. Jadi analisis saya adalah sebetulnya pendidikan kita melanjutkan saja apa yang sudah menjadi frame dan dikonsepkan pemerintah kolonial Belanda pada waktu itu. WW: Apakah pemerintah kolonial Belanda sama juga tidak mendalami makna pendidikan,atau mereka punya konsep yang lain? MA: Kita tahu bahwa pendidikan di Indonesia yang diciptakan Belanda dalam rangka politik etis. Jadi ada untuk membantu tenaga kerja yang murah, untuk mendiamkan tenaga pegawai negri sipil pribumi, dan tentu saja pendidikan pada zaman Belanda itu bersifat diskriminatif. WW: Jadi bodoh sekali bahwa itu dilanjutkan 65 tahun, betulkah? MA:Ketidaktahuanbarangkali,karena kita menganggap kalau sudah mengajarkan pemberantasan buta huruf maka itu adalah pendidikan. WW: Anak didiknya sendiri juga. Sewaktu sekolah saya melihat sekolah itu hanya suatu proses yang harus dilalui untukmendapatkanijazahdannantinya dapat pekerjaan. Apakah dari segi itu efektifatautidaksuatupendidikantanpa konsepyanglengkap tapibisamemenuhi kebutuhan employment? MA: Saya kira untuk employment pun tidak memadai karena employment pun berkembang. Contoh, sekarang pemerintahsedangmembuatsebuahkebijakan dalam kaitan dengan ketenagakerjaan, yaitu akan membuat rasio antara Sekolah Menengah Atas (SMA) dengan Sekolah Menengah Kejuruan (SMK). Sekolah kejuruan tersebut untuk mengatasi pengangguran tamatan SMA. Jadi yang selama ini 70% adalah SMA dan 30% adalah SMK, maka itu akan dibalik. Paling tidak, dibuat 50-50. Menurut saya, kebijakan itu juga dibuat secara gampang saja, padahal tenaga kerja sekarang sudah tidak membutuhkan lagi lulusan-lulusan SMA. Jadi seharusnya yang ditingkatkan adalah sekolah politeknik, misalnya. Kalau kita kirim lulusan SMK ke luar negeri, maka dia jatuhnya sebagai tenaga kerja yang

uneducated,unskilleddanupahnyamurah. WW: WW: Sepintas lalu kelihatan struktur pemerintah Indonesia memberikan tekanan pada pendidikan.Di Amerika Serikat, Health Education Welfare merupakan satu departemen yang besar sekali. Sedangkan di sini paling tidak bidang pendidikan memiliki kementerian tersendiri.Apakah itu bukan indikasi bahwa tekad pemerintah sudah benar? Ini juga yang menganggu saya,pemerintah dalam sistem demokratis akan berganti setiap lima tahun, lalu apa yang terjadidengancontinuitastekadpemerintah di bidang pendidikan? MA: Sebetulnya bisa saja pemerintahan berganti, kalau pendidikan memiliki sebuah grand design yang besar. Grand design tersebut seharusnya datang dari perundang-undangan. Kemudian ada grand design yang dirancang oleh para ahli berdasarkan studi dan pengalaman kita sendiri serta pengalaman bangsa-bangsa lain.Lalukitasepakatisebagaisebuahgrand design yang berlaku dalam jangka waktu panjang. Jadi ke sana pendidikan ini harus di arahkan, dan itu yang tidak kita miliki sampai sekarang.

kemudian mereka mengambil bimbingan belajar saja. Kedua, karena tidak siap maka di seluruh daerah ada disparitas yang begitu senjang, sementara soalnya adalah seragam. Akibatnya, terjadi ketimpanganketimpangan di setiap daerah dan ketidaksiapan di daerah. Para pendidik, guru, masyarakat dan anak-anak menganggapnya itu bukan sebuah tantangan yang harus mereka kejar dan mereka jawab secara positif. Muncullah yang kita kenal beberapaharibelakanganiniadalahantara gurudenganmuridadahiddencurriculum yang mengajarkan pemikiran konspiratif. Inisangatberbahaya.Mengakalisistemnya, dan ini secara dini kemudian menanamkan dan memperkuat nilai-nilai koruptif di dalam diri anak.

WW:Apakahitukarenadiscontinuitas politik ? MA: Saya kembali lagi kepada persoalan politik pendidikan tadi. Politik pendidikan kita sangat rentan dengan kepentingan-kepentingan politik yang sedang berkuasa. Zaman Presiden Soeharto dulu, terkait dia merasa penting nilai-nilai perjuangan tahun 1945 maka hal itu dimasukkan ke dalam kurikulum. Jadi muncul pelajaran Pendidikan Sejarah Perjuangan Bangsa (PSPB) pada waktu itu. Padahal sudah ada pelajaran sejarah, kewarganegaraan, dan sebagainya. Lalu pada zaman Presiden Habibie karena dia lama berada di Jerman dan menteri pendidikannya juga menempuh pendidikan di Jerman, serta di Jerman ada link and match maka program tersebut pun muncul di Indonesia. Ketika diterapkan ternyata link and match tidak pas di kita. Ketika kepala sekolah mau menghadap manajer saja, dia harus melalui beberapa langkah. Tidak ada tradisi link and match di Indonesia dan ini menjadi problem, gagal lagi. Lalu pada zaman Jusuf Kalla karena dia saudagar dan saudagar biasa memilih dan memilah, maka muncullah ujian nasional yang kontrovesial sampai sekarang ini.

WW: Bukankah orang yang dulu membuat ini sudah tidak ada di pemerintahan? MA: Tidak ada, tapi tetap dipertahankan karena secara debat teoritis pedagogis itu sudah tidak didengarkan lagi. Bahkan kita sudah mengajukan ini ke Pengadilan Negeri Jakarta Selatan atas dasar UU. Kita menang di pengadilan dan kebetulan saya saksi ahli waktu itu. Pemerintah banding. Pada tingkat banding, kita menang juga. Pemerintah kasasi, kita menang. Namun tetap saja UN dijalankan sampai 2011.

WW: Rupanya kontroversi besar mengenai ujian nasional belum berakhir. Sewaktu saya menempuh ujian SMA memang ujian itu nasional, bahkan ujian sekolah tidak ada. Ujian nasional itu menjadi ujian sekolah. Sebagai orang awam, mana sebetulnya yang cocok antara ujian nasional dan ujian sekolah? MA: Pada waktu zaman Pak Wimar dulu, ujian nasional tidak menyebabkan seseorang tidak lulus. Saya sempat mengalamiujianuasionalyangdulunamanya ujian negara. Kalau kita tidak lulus ujian negara, maka kita tetap dapat ijazah tapi tidak dapat tanda lulus waktu itu. Jadi dengan ijazah ini saya tidak harus mengulang lagi untuk bisa melanjutkan ke sekolah lain. Biasanya sekolah swasta pada waktu itu. Itu terjadi pada saya pribadi, saya tidak lulus ujian negara pada waktu itu. WW: Apakah itu metode seleksi saja? MA: Bukan seleksi, sebetulnya untuk assesment terhadap pengukuran kualitas secara nasional. Jadi ujian nasional seharusnya tidak berimplikasi pada ketidak lulusan. WW: Jadi dia lulus tapi jalurnya lain, betulkah? MA:Ya.Undang-Undang(UU)tentang Sistem Pendidikan Nasional (Sisdiknas) sebetulnya ujian nasional bukan untuk mengetes kemampuan dan hasil belajar murid karena itu adalah tugas guru. Guru lah yang paling tahu untuk memberikan penilaian terhadap hasil belajar.Jadi fungsinyaberbeda.Ituhanyauntukpenjajakan, sampai dimana kualitas sekolah di suatu daerah, kemudian kualitas nasional. Dari situ seharusnya diambil sebuah kebijakan nasional. Di mana yang harus disalurkan bantuan, dan sebagainya. Ini yang tidak terjadi di Indonesia. WW:Jusuf Kalla mengadakan sistem ujian nasional, apa yang salah dengan sistem ini? MA: Saya melihatnya adalah yang terjadi sekolah melakukan hal yang disebut drilling (pelatihan saja) terhadap anak. Makna pembelajaran menjadi dangkal, lalu orang berfikir hanya untuk lulus. Pada awalnya ujian nasional hanya tiga mata pelajaran. Kita kritik terus karena tiga mata pelajaran tersebut kalau dilihat dari tiga filsafat ilmu sebenarnya hanya satu tipe model berfikir, yaitu: matematika, Bahasa Inggris dan Bahasa Indonesia. Menurut filsafat ilmu, ini model berfikir deduktif, yaitu hanya satu jenis. Setelah kita kritik lalu menjadi lima maka masuklah unsur-unsur sains yaitu Ilmu Pengetahuan Sosial (IPS) dan Ilmu Pengetahuan Alam (IPA). Makna pembelajaran menjadi dangkal, orang belajar hanya untuk berfikir untuk lulus dan

WW:Brilliant!Jadibetul,memangada pendidikan bukannya membawa orang pada pikiran yang murni,tapi mengajar orang untuk menipu. Saya tidak sebut lagi namanya.Mental saudagar barangkalibegitu.Apakahitubisadikembalikan? MA: Sulit ya, kritik ini sudah berlangsung.

WW:Kalau sudah diputuskan pengadilan dan menang, mengapa ujian nasional masih diteruskan? MA: Seharusnya tidak diteruskan. Namun pemerintah berkilah dengan beralasan bahwa dalam amar putusan Mahkamah Agung juga tidak menyebutkan ujian nasional itu dilarang. WW: Jadi tidak ada keputusan, betulkah? MA:Ya, bisa dicari saja alasan-alasan untuk tetap mempertahankan itu. Tadinya saya berharap dari pergantian menteri ke menteri dan pergantian wakil presiden ada kearifan yang bisa melihat persoalan ini secara lebih mendasar. Sepertinya belum sempat terpikirkan, lalu tetap mempertahankan tradisi reaksioner di dalam kebijakan politik pendidikan kita ini. Seperti tahun lalu, menteri sekarang hanya membuat fakta integritas. Masing-masing kepala dinas menandatangani bahwa akan jujur. Ini kekanak-kanakan. WW: Jujur perlu tapi itu tidak cukup? MA: Tidak cukup, karena ini hanya menandatangani fakta integritas. Persoalannya bukan hanya sekadar tidak jujur itu. Kita harus kembali merancang pendidikan dalam konteks strategi yang lebih besar. Lalu, fenomena yang muncul saat ini adalah Sekolah Berstandar Internasional (SBI). Di universitas ada istilah world class university.Menurutsaya,inimenunjukkan cara berpikir dalam mengambil kebijakan pendidikan atau politik pendidikan yang tidakkonseptualdantidakdilatarbelakangi oleh visi yang terang.***

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan dilengkapi CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Kekayaan orang Indonesia melonjak tajam - Kemiskinan juga meningkat * Infrastruktur Kereta Api di Sumut jelek - Kenyamanan dalam kereta pun tak enak * Kasus Indomie ganggu perekonomian Indonesia - Padahal Indomie seleraku!

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Nusantara

WASPADA Sabtu 16 Oktober 2010

A7

Golkar Optimis Geser Demokrat JAKARTA (Antara): Ketua DPP Partai Golkar Priyo Budi Santoso optimistis Partai Golkar bisa menggeser Partai Demokrat pada Pemilu 2014 mendatang. “Saya nilai, hasil survei LSI itu sesuai dengan target kita. Saya optimis, Golkar mampu menggeser Partai Demokrat dan menjadi pemenang pemilu. Menurut Priyo, hasil survei LSI itu akan dijadikan momentum untuk menguatkan konsolidasi partai dan memperkuat infrastruktur partai dari tingkat pusat hingga kecamatan. “Hasil survei LSI tersebut menjadi momentum untuk menguatkan dan menggerakan lebih maksimal seluruh infrastruktur mesin partai. Sebab Partai Golkar bermimpi menjadi pemenang pemilu 2014. Boleh dong Golkar bermimpi sebagaimana Demokrat, PDI Perjuangan bahkan PAN,” kata Wakil

Ketua DPR itu. Ia menyadari pemilu 2014 masih jauh. Namun Golkar akan bekerja cepat menyerap aspirasi rakyat. Bagaimana hasilnya akan diserahkan kepada masyarakat. Ketua DPP Partai Golkar Agun Gunanjar juga meyakini Partai Golkar akan memenangi Pemilu 2014. “Saya bisa meyakini itu. Golkar akan kembali menjadi pemenang,” kata Agun. Ia menambahkan, keyakinan tersebut bisa dilihat dari beberapa indikator. Indikator pertama, kata anggota Komisi II DPR itu, adalah kinerja pemerintahan Susilo Bambang Yudhoyono-Boediono sekarang ini tidak lebih bagus ketikaYudhoyono berpasangan dengan Jusuf Kalla. “Selama kepemimpinan SBY-Boediono, kinerja pemerintah secara umum jauh menurun. Berbeda sewaktu Presiden Yudhoyono berpasangan de-

ngan Jusuf Kalla. Saat ini banyak terjadi masalah, konflik, dan ekonomi juga tidak menunjukan perbaikan sama sekali,” kata Agun. Dia menyebutkan, dari sisi tata kelola pemerintahan, juga banyak terjadi masalah, misalnya masalah Jaksa Agung, kasus Bibit -Chandra, penegakan hukum yang masih tebang pilih. “Kinerja pemerintah yang menurun itu berimbas kepada Partai Demokrat,” kata Agun. Lalu bagaimana dengan PDI Perjuangan, Agun mengatakan, PDI Perjuangan juga akan sulit untuk mengalahkan Golkar dan Partai Demokrat. “PDI Perjuangan, orang masih ragu, siapa pemimpin yang bisa diandalkan, siapa tokoh partai yang bisa diandalkan untuk mendulang suara,” kata dia. Sementara, Partai Golkar sudah selesai melakukan konsolidasi di tingkat internal dan itu

Masyarakat Ingin Penyederhanaan Partai

bisa dilihat dari Rapat Pimpinan Nasional Partai Golkar. Partai Golkar diperkirakan akan menjadi pemenang dalam pemilihan umum 2014. Berdasarkan hasil survey Lingkaran Survey Indonesia (LSI) tingkat keterpilihan Partai Golkar naik signifikan diangka 17,8 persen. Salah satu faktor kemenangan Golkar adalah sosok Ketua Umum Golkar Aburizal Bakrie. Menurut LSI tingkat popularitas Ical masih belum optimal hingga kini. “Sementara dua pesaingnya Megawati dan Susilo Bambang Yudhoyono telah optimal,” ujarnya. Namun, berbekal mesin politik yang mapan dan finansial yang mumpuni Partai Golkar diperkirakan akan menggeser Partai Demokrat. “Kedua tokoh sentral partai ini telah dianggap uzur oleh publik,” ujarnya. Survey ini dilakukan pada September sampai Oktober 2010 di 33 provinsi.

Pergantian Melalui Pemilu JAKARTA (Waspada): Wakil Ketua DPR Pramono Anung menegaskan bahwa pergantian pemerintah harus melalui pemilihan umum atau pemilu. Jika ada upaya menggulingkan atau menjatuhkan pemerintahan, diibaratkan seperti orang yang tidak tidur tapi bermimpi di siang bolong. “Negara ini negara demokrasi. Saya termasuk yang berpandangan bahwa dalam negara demokrasi pergantian pemerintahan itu ya melalui pemilu. Hukuman terhadap pemerintahan yang tidak berhasil tentu pada pemilu mendatang,” kata dia usai menerima Petisi 28 di Gedung DPR Jakarta, kemarin. Bagi Pramono, tindakan

yang tidak sesuai dapat menghasilkan efek negatif. Jika dalam era demokrasi ini kemudian memberlakukan kegiatan atau tindakan ekstraparlementer, juga akan bisa merusak bangunan demokrasi. “Kita harus menyadarkan kepada siapapun bahwa kita boleh mengkritik keras, kita boleh mengabaikan keberadaan pemerintah, tapi apapun ini adalah fakta demokrasi yang harus dihadapi dan harus dihormati,” tegas Pramono. Menjelang satu tahun pemerintahan SBY-Boediono 20 Oktober, diakui banyak ketidakpuasan masyarakat terhadap pemerintah. “Satu tahun pertama pemerintahan ini dibandingkan satu tahun

pertama pemerintahan SBY-JK harus kita akui secara jujur mengalami penurunan luar biasa,” katanya. Sebelumnya, Parmono menerima sejumlah aktivis tergabung dalam Petisi 28 dan memandang Presiden Yudhoyono mempunyai 28 pokok kegagalan mendasar dalam pemerintahannya. Ke-28 kegagalan SBY disampaikan secara tertulis dalam pertemuan dengan wakil ketua DPR Negara aman Sementara, Menteri Koordinator Politik, Hukum dan Keamanan (Menko Polhukam), Djoko Suyanto menegaskan bahwa negara dalam keadaan aman. Pernyaataan disampai-

kan Menkopolkam sekaligus menepis adanya rencana penggulingan pemerintahan SBY. “Sejauh ini tidak ada informasi, termasuk dari Badan Intelijen Negara (BIN) terkait adanya upaya-upaya penggulingan. Nggak ada kekhawatiran,” ujar Menkopolkam di DPR, Jakarta. Gerakan dilakukan sejumlah elemen, menurutnya, bagian dari demokrasi. Demokrasi itu menyediakan ruang untuk menyampaikan aspirasi. Menurut dia, yang diperlukan saat ini adalah kebersamaan seluruh komponen masyarakat. “Kalau kita bersama, saya yakin bisa keluar dari masalah,” tandasya.(aya)

Laporkan Lima Hakim Tipikor

Komnas HAM Akan Tindaklanjuti Permintaan Panda Nababan JAKARTA (Waspada) : Setelah Komisi Yudisial (KY) menyatakan adanya indikasi manipulasi fakta persidangan dengan terdakwa Dudhie Makmun Murod, giliran Komisi Nasional Hak Asasi Manusia (Komnas HAM) akan menindaklanjuti permintaan tersangka kasus suap pemilihan Deputi Gubernur Senior (DGS) Bank Indonesia (BI) Miranda S Goeltom, karena dinilai oleh tersangka Panda Nababan adanya pelanggaran HAM terhadap dirinya. “Kami dapat memahami inti dari pengaduan ini. Pak Panda dan kuasa hukumnya melihat ada pelanggaran HAM dalam proses pengadilan atas nama Dudi Makmun Murod. Berdasarkan hasil pengadilan itu, KPK lantas menetapkan Pak Panda sebagai tersangka,” kata Ketua Komnas HAM Ifdhal Kasim saat menerima pengaduan Panda Nababan di kantornya di Jalan

Latuharhari, Jakarta, Jumat (15/10). Komnas HAM akan memonitor dan menelusuri permintaan Panda Nababan yang juga Ketua DPD PDIP Sumut ini. “Yang jelas setiap orang berhak mendapat keadilan yang fair seperti dalam hal penetapan orang sebagai tersangka atau terdakwa. Kami akan mendalami lebih lanjut untuk menghindari adanya ketidakadilan. Kalau memang iya, kita akan lakukan monitoring. Kita akan memantau dan hasil rekomendasinya akan dikirim ke MA,” ujar Ifdhal. Dalam pengaduannya, Panda Nababan yang juga anggota Komisi III DPR RI itu mengaku sangat terpukul dengan status tersangka yang ditetapkan oleh penyidik Komisi Pemberantasan Korupsi (KPK). ”Dalam hidup saya, saya pernah dipenjara selama dua

tahun pada masa awal Orba (Orde Baru), karena kondisi perpolitikan di masa itu ada deSoekarnoisasi. Saat ini, saya kembali terpukul karena lima hakim Tipikor merekayasa fakta dalam persidangan atas nama terdakwa Dudhie Makmun Murod,” tutur Panda. Dikhawatirkan Panda, pada vonis Dudhie disebutkan dirinya menerima cek sebesar Rp500 juta. “Padahal selama sidang sewaktu saya menjadi saksi, saya tidak pernah sekalipun ditanya oleh majelis apakah menerima cek atau tidak,” terang Panda. Selain menerima uang Rp500 juta, Panda juga disebut sebagai koordinator pemenangan Miranda Goeltom untuk menjadi Deputy senior BI. Sedangkan Tjahjo Kumolo sambung Panda, selaku ketua fraksi dan tiga saksi lainnya menyebutkan tidak ada yang

namanya koordinator pemenangan. “Saya meminta Komnas HAM untuk melakukan monitoring karena proses hukum masih berjalan,” tambahnya. Sebagaimana lima hakim yang dilaporkan Panda kepada KY sebelumnya, Panda juga melaporkan lima hakim Tindak Pidana Korupsi (Tipikor) ke Komnas HAM adalah, Nani Indrawati, Herdi Agustin, Achmad Linoh, Slamet Subagio, dan Sofialdi. Sebelum diterima Komnas HAM, bersama tiga pengacaranya, Panda yang mendatangi kantor Komnas HAM mengenakan kemeja dan celana warna hitam menyatakan, kedatangannya untuk mengadukan pelanggaran HAM. “Saya datang ke sini (Komnas HAM) untuk mengadukan pelanggaran hak azasi saya oleh lima hakim Tipikor,” kata Panda. (j02)

IKLAB Jakarta Temu Kangen Dan Halal Bi Halal MEDAN (Waspada): Warga Labuhanbatu yang berada di perantauan khususnya di Jakarta diimbau untuk tidak melupakan daerah asalnya. Sebaliknya harus meningkatkan kepedulian terhadap kemajuan daerah asalnya yakni Labuhanbatu. Demikian disampaikan Brig. Pol. (Purn). Drs. H. Dfafar Siregar, MM sebagai Ketua Umum Ikatan Keluarga Labuhan Batu (IKLAB) Jakarta dan Sekitarnya, pada temu kangen dan Halal Bi Halal IKLAB Jakarta dan Sekitarnya, di Aula Gedung LIPI Jakarta, Minggu (10/11). Dfafar Siregar mengatakan, semakin kita peduli maka akan semakin erat hubungan yang terjalin antar masyarakat Labuhanbatu. Maka warga Labuhanbatu jangan lupa semboyan, jangan tanyakan apa yang telah diberikan Labuhanbatu kepadamu, tapi tanyakan apa yang telah engkau berikan kepada Labuhanbatu. “Semboyan ini harus tetap tertanam di hati masyarakat Labuhanbatu, sehingga memotivasi kita untuk terus berbuat dan berkarya. Dengan kata lain Motto IKA BINA EN PABOLO sebagai semboyan masyarakat Labuhan Batu tetap relevan hingga saat ini,” katanya. Sementara Ketua Panitia Hasan Basri Sagala menyampaikan, selain acara puncak Halal Bi Halal dan Temu Kangen ini juga diisi dengan pemberian penghargaan kepada mantan Ketua Umum IKLAB. Diantaranya Alm.H. Jamaluddin Tambunan, SH (mantan Gu-

bernur Jambi), Alm. Kolonel. H. Jalaluddin Pane (Mantan Bupati Labuhan Batu), Alm. Brigjen. TNI AD. H. Nazaruddin Rambe, Alm. H. Fatullah Nasution, H. Aziddin, SE, H. Ahmad Munir, MA dan Letkol.(Purn). H. Agus Salim Nasution. “Penghargaan dimaksudkan agar masyarakat Labuhan Batu dapat mengapresiasi usaha mereka dalam mengembangkan IKLAB Jakarta,” kata Hasan Basri Sagala. Penghargaan juga diberikan kepada Surya Fachrizal Ginting/ putra Labuhan Batu satu-satunya sebagai aktivis kema-

nusiaan. Karena beliau turut menjadi korban penembakan tentara Israel di Tepi Barat (kasus Maximarmara) beberapa waktu yang lalu. Sedangkan ceramah agama diisi Ustadz H. Maskhuril Khomis, SH diselingi tausiyah oleh Zagar Tua Ritonga (Zagar si Dai Cilik). Salah satu tokoh Labuhanbatu yang hadir H.AbdulWahab Dalimunthe, SH (Anggota DPR RI Fraksi Demokrat), yang dalam sambutannya menekankan pentingnya menjaga persatuan di antara masyarakat Labuhanbatu.

Sekalipun Labuhan Batu telah dimekarkan menjadi tiga Kabupaten (Labuhanbatu, Labuhanbatu Selatan, Labuhanbatu Utara), namun semangat kebersamaan di antara ketiga kabupaten ini tidak boleh pudar dan harus ditingkatkan. Abah Wahab menambahkan, IKLAB Jakarta lebih memperjuangkan siswa dan Mahasiswa asal Labuhan Batu untuk memperoleh beasiswa dari ketiga Pemda yang ada di Labuhanbatu. Karena dengan pendidikanlah kemajuan suatu daerah dapat ditingkatkan. (rel)

Waspada/Ist

PENGHARGAAN: Para mantan Ketua IKLAB Jakarta yang menerima penghargaan diwakili keluarga masing-masing foto bersama dengan tokoh Labuhanbatu usai acara temu kangen dan Halal bi Halal yang digelar IKLAB Jakarta.

Antara

PEDULI PELAJAR WASIOR.Beberapa pelajar memberikan uang ke dalam kotak sebagai wujud peduli bencana Wasior di SMPN 1 Kudus, Jawa Tengah, Jumat (15/10). Bantuan yang terkumpul selanjutnya untuk membantu pelajar-pelajar korban bencana Wasior.

Jamsostek Rancang Sistem Perlindungan Biaya Murah JAKARTA ( Waspada): Direktur Utama Jamsostek, Hotbonar Sinaga menjelaskan, PT Jamsostek dan BNI tengah merancang sistem perlindungan berbiaya murah dan terjamin untuk tenaga kerja Indonesia (TKI). “Secara prinsip TKI adalah pekerja yang kebetulan mencari nafkah di luar negeri, karena itu Jamsostek terpanggil melindunginya,” katanya di Jakarta, kemarin. Menurutnya, sistem itu dibangun bekerja sama dengan BNI karena terkait dengan remitansi TKI. “Kita sedang merancang mekanisme pembayarannya, mengaitkan dengan remitansi TKI,” kata dia. Pada prinsipnya, biaya yang akan dikeluarkan TKI akan sangat murah karena menggunakan prinsip jaminan sosial, yakni subsidi silang. Untuk tahap pertama, tiga program utama Jamsostek yang dilaksanakan pada TKI yakni, jaminan kematian, jaminan kecelakaan kerja dan jaminan hari tua. Komisaris PT Jamsostek, juga Ketua Konfederasi Serikat Pekerja Seluruh Indonesia (KSPSI), Sjukur Sarto menyatakan sudah selayaknya BUMN itu menjadi pelaksana perlindungan TKI. “PT Jamsostek pernah ditunjuk sebaga lembaga perlindungan TKI ketika Abdul Latief

menjadi Menaker,” kata dia menilai BUMN layak sebagai lembaga tunggal melindungi TKI. Praktik itu saat ini dilakukan untuk melindungi tenaga kerja di perusahaan swasta dalam negeri. Praktik itu wajar karena perlindungan atas pekerja merupakan tanggung jawab pemerintah yang dilaksanakan BUMN nya (PT Jamsostek). Jika dikaitkan dengan TKI, analogi itu juga bisa dikenakan kepada TKI sebagai bentuk tanggungjawab pemerintah. Di luar negeri, keselamatan dan kepentingan badan hukum dan warga negara Indonesia menjadi tanggungjawab pemerintah melalui Kedubes RI. Ditanya tentang ijin beroperasi di luar negeri, Sjukur mengatakan, PT Jamsostek dahulu mendapat ijin beroperasi di Saudi Arabia. “Ijin itu bisa dibuka lagi jika diperlukan.” Sebelumnya, Anggota Komisi IX DPR Rieke Dyah Pitaloka mengatakan, setiap TKI sudah selayaknya mendapat perlindungan dengan sistem jaminan sosial. Dia menilai jaminan sosial lebih terjamin dan tidak menjadikan TKI sebagai komoditas seperti yang dilakukan perusahaan asuransi. Rieke juga mempertanyakan kebijakan Menakertrans Muhaimin Iskandar yang menunjuk hanya satu konsorsium perusahaan asuransi swasta sebagai lembaga perlindungan TKI.(j04)

Korban Penembakan Polisi Menuntut Keadilan JAKARTA (Waspada): Sejumlah lembaga hukum dan perlidungan hak asasi manusia di Jakarta berjanji menindaklanjuti pengaduan Zainal Abidin, diduga korban penembakan oknum polisi Polsekta Medan Kota. “Kami akan menindaklanjuti laporan ini sesuai kewenangaan dimiliki Komisi Yudisial (KY),” kata Friska, staf bidang pengaduan KY usai menerima pengaduan Zainal Abidin didampingi kuasa hukumnya, Surya Dinata dari LBH Medan, Rabu (13/10) di Jakarta. Menurut Friska, berkas laporan itu akan segera diserahkan ke pimpinan. Mekanisme selanjutnya, ketua bersama para staf ahli KY meneliti dokumen yang diserahkan pelapor. “Selanjutnya KY mengirim timnya mengawasi proses persidangan yang saat ini sudah di tingkat kasasi,” kata dia. Setelah seminggu ke depan, sebut Frisaka, pelapor yang ingin mengetahui perkembangan pengaduannya dapat menguhubungi nomor kontak bidang pengaduan KY. Kuasa hukum Zainal Abidin, Surya Dinata mengatakan, pihaknya mendatangi KY bermohon agar lembaga ini mengawasi proses persidangan klienya di Mahkamah Agung. “Ada informasi menyebutkan indikasi kelompok mafia kasus/hukum tengah melakukan upayaupaya penyuapan kepada hakim di MA agar mengkondisikan Zainal yang divonis bebas di PN Medan bersalah dan dihukum,” sebutnya. Menurut dia, pihaknya datang lebih awal ke KY untuk mengantisipasi campur tangan markus. “Kita sedia payung sebelum hujan. Sebelum markus terlibat, kita langsung membentengi diri dengan melapor ke KY selaku lembaga berwenang menghadang peran markus dalam perkara ini,” tegasnya. Kata Surya, kekhawatiran mereka cukup beralasan, karena pada saat kasus ini bergulir di PN Medan, indikasi gerakan mafia hukum mencampuri perkara ini sudah terlihat. “Untungnya majelis hakim memiliki hati nurani, hingga tegaklah hukum, klien saya divonis bebas,” kata Surya. Sebelumnya, Satuan Tugas Pemberantasan (Satgas) Mafia Hukum menyatakan segera memelajari semua dokumen barang bukti surat, rekaman dan foto yang diserahkan pelapor. “Berkas ini segera diteliti, seminggu kemudian hasilnya kami sampaikan kepada saudara,” kata Agus Irawan, tim Kesekretariatan Satgas

Mafia Hukum. Pada kesempatan itu Zainal Abidin dan kuasa hukumnya menceritakan dan memperlihatkan foto-foto ketika kaki korban ditembak oknum polisi yang menuduhnya sebagai pelaku pembunuhan Kesuma Wijaya. “Kita sudah serahkan semua dokumen berkaitan perkara ini,” kata Surya, usai melapor ke Satgas Mafia Hukum. Hal serupa disampaikan Komisioner Subkomisi Mediasi Komnas HAM, M Ridha Saleh saat menerima Zainal dan kuasa hukumnya. “Dalam waktu dekat pihaknya akan menyurati Mabes Polri dan Polda Sumut terkait kasus penyiksaan dan penembakan Zainal.” Saleh mengatakan, setelah mendengar penjelasan Zainal secara langsung dan kuasa hukumnya, Komnas HAM menilai persoalan ini sangat serius, karena tindakan penyidik melakukan penyiksaan menyalahi koridor hukum yang berlaku. Dia berharap pimpinan Polri menindak dan memberikan sanksi terhadap oknum anggota Polri yang diduga melakukan penyidikan menggunakan kekerasan, hingga penyiksaan terhadap seseorang yang disangkakan sebagai pelaku tindak pidana. Ridha menilai ada unsur pelanggaran HAM. Dari sudut pemaparannya mengenai proses penyelidikan kasus itu, merupakan pelanggaran serius terhadap prosedur hukum dan HAM, karena seorang yang tersangka punya hak didampingi penasehat hukum dan tidak disiksa. Apalagi belum ada indikasi perlawanan. Ditegaskan juga, Komnas HAM akan mengirim surat ke Poldasu. “Jika surat ke-3 tidak mendapat klarifikasi, maka tidak tertutup kemungkinan tim Komnas HAM turun ke Medan melakukan investigasi ke lokasi kejadian,” katanya. Zainal Abidin warga Jl. Pancing, Medan divonis bebas PN Medan karena tidak terbukti bersalah melakukan pembunuhan KesumaWijaya, direktur PT Sewangi Sejati Luhur, sebagaimana di dakwakan jaksa. Saat dalam pemeriksaan, Zainal diduga mengalami penyiksaan, kakinya ditembak tiga kali diduga olek penyidik. Pasca putusan bebas itu, Zainal dan kuasa hukumnya menuntut keadilan. Namun karena laporannya ke Poldasu belum ada tanggapan, mereka mencari keadilan ke Komnas HAM, YLBHI, Lembaga Perlindungan Saksi dan Korban, KY dan Satgas Mafia Hukum di Jakarta.(h05)

JAKARTA ( Waspada): Mayoritas masyarakat di tahun 2014 menginginkan adanya penyederhanaan partai, dari 48 partai politik (parpol) saat ini menjadi 5 parpol, misalnya. Mayoritas publik (73,8%) meng-anggap jumlah partai yang ada sekarang sudah terlalu banyak. “Meskipun pemilih saat ini sangat labil akibat dipengaruhi banyak faktor, seperti tokoh parpol yang dipilih, kekuatan finansial dan kestabilan partai itu sendiri,” kata Peneliti Lingkaran Survei Indonesia (LSI), Barkah Pattimahu di Jakarta, Kamis (14/10). Berdasarkan survei LSI secara nasional, sentimen atas jumlah partai yang terlalu banyak ini merata di setiap responden. Namun segmen pemilih di perkotaan dari kalangan terpelajar lebih kuat keinginannya agar partai disederhanakan, dibandingkan pemilih pedesaan dan penduduk di bawah universitas. Karena itu mayoritas responden (82,4%) ingin ada pembatasan sistematis, dimana 68,9% responden setuju jika syarat parpol yang ikut pemilu diperberat. Misalnya syarat partai yang sudah ada untuk bisa mendapatkan kursi di parlemen (Perliamentary Threshold/PT) juga dinaikkan menjadi minimal 5% atau 10%. Tentunya, kata Barkah, jika rencana itu dijalankan akan mengurangi jumlah partai. Dari survei LSI Oktober ini, parpol potensial yang lulus dukungan minimal 5% hanya lima yakni, Demokrat, G o l k a r, P D I P, P K S d a n PAN.(j03)

Alih Fungsi Hutan Ancam Gajah Sumatera Bengkulu (Antara): Rencana Pemerintah Provinsi Bengkulu mengalihfungsikan hutan produksi terbatas Lebong Kandis menjadi area penggunaan lain akan mengancam kelestarian satwa Gajah Sumatra (Elephas maximus) yang hidup di kawasan itu. “Tanpa alih fungsi hutan pun, habitat satwa itu semakin terdesak dan konflik semakin tinggi, apalagi kalau HPT Lebong Kandis menjadi area penggunaan lain bisa dibayangkan dampaknya bagi kelestarian Gajah Sumatra,” kata Representatif ProFauna Bengkulu Radius Nursidi di Bengkulu, Jumat (15/10) . Ia mengatakan, HPT Lebong Kandis di Kabupaten Bengkulu Utara tersebut berbatasan langsung dengan kawasan hutan produksi dengan fungsi khusus Pusat Konservasi Gajah (PKG) Seblat. Usulan alih fungsi HPT Lebong Kandis bersama sejumlah kawasan hutan lainnya seluas 99 ribu hektare telah disampaikan Dinas Kehutanan Provinsi Bengkulu ke Kementerian Kehutanan yang menjadi bagian dalam revisi Recana Tata Ruang Wilayah. Sementara itu Kabid Tata Usaha Balai Konservasi Sumber Daya Alam (BKSDA) Bengkulu, Supartono mengatakan rencana alih fungsi itu jelas mengancam keberadaan Gajah Sumatra.

Ribuan Siswa Semarakkan Hari Cuci Tangan Sleman (Antara): Ribuan siswa dari sekitar 30 sekolah dasar yang ada di Kabupaten Sleman, Daerah Istimewa Yogyakarta, menyemarakkan peringatan Hari Cuci Tangan Pakai Sabun se-Dunia yang berlangsung di Lapangan Denggung, Sleman, Jumat (15/10). Kegiatan yang dipandu artis Ibu Kota Dik Doang ini, selain ditandai dengan cuci tangan pakai sabun secara serentak, juga diisi dengan pelantikan kader kesehatan dari para siswa sekolah dasar (SD). Public Health Education Program Manager Yayasan Unilever Indonesia Leo Indarwahono mengatakan, kegiatan ini untuk membudayakan cuci tangan pakai sabun (CTPS) pada anak-anak dan keluarga. Menurut dia, sejak pertama kali PBB meluncurkan Hari Cuci Tangan Pakai Sabun se-Dunia pada 15 Oktober 2008, Lifebuoy yang merupakan produk dari Unilever telah turut merayakan di Indonesia dengan melakukan pendidikan dan sosialisasi mengenai pentingnya CTPS.

A8

WASPADA Sabtu 16 Oktober 2010

Penerbangan Haji Embarkasi Medan Jamin Berangkat Sesuai Jadwal MEDAN (Waspada) : Pemberangkatan haji Embarkasi Medan dijamin tidak bakal terlambat seperti dialami jamaah haji Bekasi Jabar dan jamaah haji asal Batam, masing-masing mengalami keterlambatan 15 hingga 20 jam. Melalui Embarkasi Medan saya yakini tidak bakal ada delay (keterlambatan) seperti itu. “Kami gunakan pesawat charteran Corsair asal Perancis dan memungkinkan terbang ke tanah suci sesuai jadwal yang diminta otorita Bandara King Abdul Azis Jeddah,” kata General Manajer (GM) Garuda Indonesia Cabang Medan Muchwendi Harahap. Saat menyaksikan pemberangkatan haji Kloter 5 asal Langkat di Bandara Polonia Medan, Jumat (15/10), Muchwendi didampingi H. Syafnir, staf Garuda Medan membenarkan,

pesawat yang dicharter mengangkut jamaah asal Medan operasional tahun 1992, jadi pesawat jenis Boeing 747-400 masih tergolong baru. Munchwendi menyebutkan, pesawat tiba kembali di tanah air antara empat dan lima jam sebelum jamaah diterbangkan ke tanah suci. “Kalau terjadi keterlambatan atau kerusakan teknis masih ada waktu memperbaikinya,” ujarnya. Bahkan Syafnir menambahkan suku cadang (sparepart) pesawat Corsair tersedia di Medan, tidak bakal lama jamaah menunggu. “Mudahmudahan tidak terjadi,” ujarnya. Namun GM Garuda Medan menyatakan, kalaupun ada beberapa Kloter mundur dari jadwal semula antara 30 menit hingga 1,5 jam, hanya permintaan petugas otorita Bandara King Abdul Azis, menyesuaikan pesa-

wat mendarat di sana. Ikuti Petunjuk Sementara itu Bupati Langkat Ngosesa Sitepu saat melepas 454 jamaah Kloter 5 asal Langkat di Bandara Polonia Medan menyatakan harapannya agar jamaah Langkat dapat mengikuti petunjuk yang telah diajarkan pada pelaksanaan Manasik Akbar selama tiga hari di Langkat. Dia juga mengibau jamaah agar selama di tanah suci dapat berkoordinasidengankepalarombongan (Karom), dengan demikian jamaah Langkat tidak akan berpencar selama di tanah suci. Menurut Ngosesa, jumlah jamaah asal Langkat melaksanakan ibadah haji setiap tahunnya meningkat, namun selalu dibatasi quota daerah sehingga masih banyak jamaah calon haji (Calhaj) masuk daftar tunggu (waiting list). Misalnya, pada musim haji

DAMPAK HAJI ...

yang ditulis oleh Malcolm X ketika beliau menunaikan rukun Islam yang kelima pada 1964. Siapakah tokoh Malcolm X ini? Ia terlahir sebagai seorang keturunan Afrika-Amerika di Omaha, negara bagian Nebraska, Amerika Serikat pada 1925 dengan nama Malcolm Little. Ketika Malcolm berusia 6 tahun,

ayahnya, seorang aktivis pembela kaum berwarna, ditemukan tewas mengenaskan, hingga keluarganyaberantakan. Ia menaruh dendam terhadap kaum kulit putih yang membuat ayahnya terbunuh dan yang menindas kaumnya. Sebagai anak yang cerdas, ia ingin menjadi pengacara untuk membela keluarga

dan non-kulit putih. Apa yang saya lihat dan alami telah memaksa saya untuk merombak banyak dari pola pikir yang saya perpegangi sebelumnya, dan membuang beberapa kesimpulan saya terdahulu. Ini adalah bagian dari surat

Waspada/Anum Saskia

BERTAMBAH: Calon jamaah haji menggunakan kursi roda semakin bertambah, pada kloter 5 yang berangkat, Jumat (15/10) menjadi lima orang, sebelumnya hanya 3 orang saja. Meski menggunakan kursi roda, para Calhaj ini mengaku tetap semangat menunaikan ibadah haji. Mereka yakin Allah akan memberikan kemudahan di tanah suci, karena setiap orang muslim yang datang kesana memenuhi panggilan Allah. Siapa yang mengundang pastilah menerima dengan baik dan memberikan kemudahan.

Engkau Hadir Untuk Membangun Networking Ummah

Waspada/Surya Efendi

LEPAS HAJI LANGKAT: Bupati Langkat Ngogesa Sitepu bersama isteri menyalami ketua rombongan ketika melepas jamaah calon haji Kloter 5 asal Langkat dan Medan di Asrama Haji Medan, Jumat (15/10). Bupati dan isteri juga ikut menunaikan ibadah haji tahun ini. 2010, jamaah Langkat mencapai 329 orang, sementara musim haji 2009 hanya 310 orang. “Disamping meningkat keimanan dan ketaqwaan mereka berangkat ke tanah suci juga faktor ekonomi masyarakat semakin membaik,” ujar Sitepu.

Musim haji 2010, Pemkab Langkat memberikan berbagai kemudahan seperti obat-obatan,angkutanbusdanlainnya,denganharapanmenjadihajimabrur. Ke 454 jamaah asal Langkat dan Medan bertolak dari Bandara Polonia Medan menuju Jed-

dah pukul 16:40, turut juga dilepas Sekretaris PPIH Medan Drs H. Abd. Rahman Harahap, MA. Seorang jamaah asal Langkat menunda berangkat yaitu Ramli Lubis bin Abu Bakar, 79, sakit setelah masuk asrama haji. (m32/m36)

dan kaumnya, namun gurunya di sekolah, seorang kulit putih, menyatakan bahwa ia sebaiknya melupakan cita-citanya itu, karena warna kulitnya hitam. Kecewa bercampur dendam, ia pindah ke Harlem, pemukimankaumkulithitamdikotaNew York pada 1942. Ia berkembang menjadi bandit besar dan kriminalis ulung. Selain penjual, ia juga pengguna obat-obat terlarang. Ia bahkan menjadi ‘boss’ para bandit tidak saja di kota NewYork, tetapi juga di Boston. Kehidupan ini menjerumuskan dirinya berkali-kali ke penjara. Di balik terali besi penjara inilah ia bertemu dengan sekelompok orang dari NOI (Nation of Islam) yang dipimpin oleh Elijah Muhammad. Mereka inilah yang mendakwahkan agama Islam, dalam versi NOI atau Black Muslims, antara lain menganggap kaum kulit putih adalah iblis,sebaliknyamenaikkankaum kulit hitam sebagai manusia terpilih. Pada 1952 ia menyatakan dirinya masuk Islam dan menjadipengikutNOIsertamengganti namanya Malcolm X. Namanya kian dikenal dan gerakannya semakin menggema, namun ini pulalah yang menyebabkan ia kian renggang dengan pimpinan NOI. Pada 1964 ia memutuskan beberapa hal penting dalam hidupnya: pergi naik haji. Selama haji inilah yang mengalami transformasi

diri, melewati pencerahan, dan nama baru ditabalkan untuk dirinya, El-Hajj Malik El-Shabbaz. Sekembalinya ke Amerika Serikat ia menyatakan keluar dari NOI dan mendirikan OAAU (Organization of Afro-American Union). Sejak itulah, ia banyak belajar tentang mainstream ajaran Islam yang penuh perdamaian dan ajaran kemanusiaan. Ia menyatakan bahwa kaum kulit putih dan hitam adalah samasama korban masyarakat rasis, yang sangat bertentangan dengan ajaran Islam yang murni. Namun tragis, ketika berpidato dalam rapat OAAU di Harlem padaFebruari1965,iasyahid,ditembak mati oleh suruhan mereka yang ketakutan terhadap pemikiran dan sepak terjangnya. Bahwa ibadah haji menjadi penyebab terjadinya transformasi diri yang luar biasa pada pribadi mereka yang melaksanakan ibadahhajisudahbanyakdipaparkanbanyakpenulisdanilmuwan. Yang lebih kontemporer dan ilmiah serta bertaraf antara bangsa adalah penelitian yang dilakukan sekelompok peneliti Harvad University beberapa tahun yang lalu terhadap para haji asal Pakistan. Hasilnya telah dipublikasi dengan judul ‘Estimating the Impact of the Hajj: Religion and Tolerance in Islam’s Global Gathering’ [Meng-ukur Dampak Haji: Agama dan Toleransi dalam Pertemuan Global

Islam] yang terbit April 2008. Penelitian ini menyimpulkan bahwa haji menimbulkan a feeling of unity (rasa persatuan) dengan warga umat Islam global. Ibadah haji juga meningkatkan observance of global Islamic practices while decreasing participation in localized practices and beliefs (pengamalan terhadap praktek keislaman dan mengurangi keikutsertaan dalam praktek dan kepercayaan lokal).Tambahan lagi, keyakinan terhadap perdamaian, kesetaraan dan harmoni semua umat Islam, bahkan umat manusia, semakin menguat. Dalam lembaran sejarah pergerakan dan perjuangan melawan kolonialisme di negeri ini, kita bisa menelaah betapa pemerintahan kolonial dulunya begitu khawatir dan takut bahwa ibadah haji akan membuat umat Islam kian radikal, makin bersemangat melawan tirani penjajahan. Memang tidak berlebihan kalau kebanyakan gerakan antipenjajah didorong dan dipimpin oleh beberapa tokoh haji. Semoga dampak itulah yang terjelma pada diri Anda sekembalinya dari mengerjakan ibadah haji. Anda tidak saja berbuat baik untuk diri sendiri, tetapi juga kepulangan dan kehadiran Anda ditunggu-tunggu kaum keluarga dan warga sekitar karena juga telah menaburkan kebaikan buat masyarakat yang lebih luas.

Dhuyufurrahman, para tamu Allah, Engkau hadir di sini tidak semata-mata untuk menemui Tuhan dan mencari keampunan atas dosa-dosa yang pernah Engkau lakukan. Jika hanya untuk itu, Allah telah meneyediakan fasilitas untukmu di tanah air. Tetapi Engkau hadir di sini untuk kesempurnaan keislamanmu; tidak saja untuk kesalehan individu tetapi juga untuk kesalehan sosial bahkan kesalehan mondial; tidak hanya untuk keluarga dan bangsamu tetapi untuk antarabangsa, tidak saja untuk zaman ini tetapi untuk antarzaman. Engkau hadir di sini untuk perbaikan jaringan umat. Terdapat sejumlah isyarat dalam Al-Qur‘ân yang memesankan bahwa ukhuwah islâmiyah itu berarti jaringan, team work: “Mereka bertanya kepadamu tentang (pembagian) rampasan perang. Katakanlah: rampasan perang demikian kepunyaan Allah dan Rasul-Nya. Maka bertakwalah kamu kepada Allah dan perbaikilah hubungan antara kamu, taatilah Allah dan Rasul-Nya, jika kamu orang yang beriman.” (Q.S. 8/al-Anfâl; 1) AbdullahYusuf Ali menyebut pentingnya perbaikan jaringan orang beriman dalam perjuangan mereka di jalan Allah. Untuk itu, mereka harus: (1) bersatu dan menyisihkan perbedaanperbedaan kecil, (2) niat di hati harus tetap lurus, (3) tidak boleh dirusak oleh keserakahan harta dan kepentingankepentingan duniawi untuk mencari keuntungan. Dengan begitu, maka yang hendak Engkau perbaiki adalah ukhuwah sebagai jaringan kerja (net working) umat dalam arti global, sebagai yang pernah diserukan oleh Hasan alBannâ dalam kitab al-Majmû’: “Wahai segenap ikhwân, ingatlah baik-baik, setiap kelompok membentuk satu kesatuan dengan kelompok lain. Mereka memiliki keterikatan ruh dan hati. Terikat dengan satu tujuan, satu cita-cita, satu hasrat, dan satu perjuangan. Semua kelompok itu saling terpaut, saling tersambung, saling merindukan dan saling menghormati. Setiap kelompok merasa tidak bisa berdiri sendiri tanpa menjalin ukhuwah dengan kelompok lain, seperti batu bata bangunan kokoh yang saling menopang. Seluruhnya terpaut dengan pusatnya dalam ikatan yang sangat kuat dan mulia, baik dalam aspek spritual, administrasi, aktivitas, maupun penampilan. Semuanya berputar mengelilingi pusat porosnya, seperti gugusan bintang yang bersinar terang yang berputar mengitari pusat peredarannya.” Kesediaanmu untuk memahami, mendemonstrasikan, dan mengaktualisasikan ukhuwah sebagai jaringan kerja melalui pertemuan global di tanah suci diharapkan akan memperkecil wilayah-wilayah tak terpikirkan (unthinkable) di dunia Islam. Memang, kita secara tidak sadar, telah mempertebal wilayahwilayah yang tak terpikirkan: “Kita telah gagal memahami hubungan kerja antara muslim Arab dengan muslim Afrika, antara muslim Arab dengan muslim Asia, antara muslim Timur dengan muslim Barat, dan antara muslim dunia maju dengan muslim dunia berkembang. Sementara ditingkat lokal kita telah gagal menghubungkan antara seorang jenderal muslim dengan pemimpin pesantren. Kita telah gagal memahami hubungan kerja preman muslim yang menjaga keamanan-keamanan terminal bus dengan cendekiawan muslim. Kita telah memisahkan masjid-masjid kita dengan pasar, dan kita telah memisahkan seorang muslim yang bekerja di bank konvensional dengan muslim yang bekerja di bank syariah. Kita telah lupa menghubungkan kerja seorang pejabat muslim dengan seorang pengusaha muslim, dan kita telah memisahkan politisi muslim dengan guru mengaji di surausurau desa terpencil, dan banyak lagi muslim yang kita buang, karena ambisi dan egoisme kita sendiri, dan lain-lain.” InilahyanghendakEngkauperbaikimelaluiperjalanansucimu ini, dan upaya ini boleh jadi akan menjadi kontribusimu yang teramat penting bagi peradaban. Wa Allâhu A’lamu bi al-Shawâb.

Nama-nama Jamaah Calon Haji Kloter 7 Asal Medan Dan Deliserdang, Masuk Asrama Haji Embarkasi Medan Minggu (17/10), Berangkat Senin (18/10) Melalui Bandara Embarkasi Polonia Medan 01. Muhammad David Saragih Bin Atip Saragih (TPHI), 02. Senen SulaimanTukiman Bin Tukiman (TPHI), 03. Syoufi Rizal Husni Bin Husin Abdul Az (TKHI/Dr), 04. Suryati Abdi Binti Ahmad Darji (TKHI-Paramedis), 05. Nurleli Ruslan Lubis Binti Ruslan Ubi, 06. H Harapan Bangsa Siregar Bin Sanu, 07. Sulaiman Bin Ismail H, 08. Amaliyah Binti Mhd Ali H, 09. Rosleiner Pohan Binti Musa Pohan, 10. Makmur Efendi Bin Jasobandingan. 11. M Nazari Se Bin M Djunaidy Nurdin H, 12. Ida Hafni Hanafiah Binti Hanafiah, 13. FatmahRailisBintiRidwanEfendi, 14. Sri Fauziah Anum Binti Ibrahim, 15. Ida Chairani Binti M Ali Rahman Simat, 16. Liper Purba BinTuan Unnan Purba, 17. Imansyah Dalimunthe Bin Amran Dalimunthe, 18. Martiam Purba Ir Bin Tarima Purba, 19. Thamrin Bin Hasan Ibrahim H, 20. Zuraida Binti Abdullah Yusuf. 21. Eliya Sopia Binti Sofyan, 22. Yuniarti Sikumbang Binti St Yushar, 23. Supriati Binti Tupar, 24. Sukamto Bin Sabilan, 25. Samingan Bin Amat Kusen, 26. Hamidah Siregar Binti Bactiar Siregar, 27. Suyatik Binti Sofyan, 28. Sukadi Fairuzi Drs Bin Wage, 29. Abu Machlil Siregar Se Bin Maga Siregar, 30. Nirwana Efrida Hrp Amkeb Binti Husnan. 31. Aisyah Harahap Binti Ikhsan Harahap H, 32. Maga Siregar Bin Solupa Siregar H, 33. Amir B Bin Nabun, 34. Asnah Binti H.Arifin Ms, 35. Yunizar Binti Harun Effendi, 36. Aminah Binti Latif, 37. Hasan Bin Jalaluddin H, 38. Agus Salim Bin Mahsih Alm, 39. Syahruddin Purba Bin Abdullah Hukum P, 40. Zulfahrudin Siregar Bin Amir Hasan. 41. Lis Leliyanti Binti H.Sanusi Harahap, 42. Suharti Ningsih Binti Suwarno, 43. Waginem Binti Sipon, 44. Sutarto Bin Tukiran, 45. Riswan Simarmata Ir Bin H Masdi Simar, 46. Nurhanizar Sp Binti Burhan Siregar, 47. AldawendraDraBintiDamiSutan Batua, 48. Maulina Sari Siregar Binti Kanato Siregar, 49. Halimah Binti Okkat Siagian, 50. Marulak Siagian Ir Bin Okkat Siagian. 51. Akhiruddin Tanjung Drs. Bin Usman Tanjung, 52. Eka Nuryanto Msi Bin Soeparno, 53. Hani Hadiyati Binti Ikhlas Atmojo, 54. Roslaini Dra Binti Mah-

yuddin Asro H, 55. Ribut Binti Ahmat Juremi, 56. Sonem Binti Darmo Utomo, 57. Maimunah Siregar Binti Baris Siregar, 58. Nuraini Binti Abubakar, 59. Ernawati Binti Anwar Damanik, 60. Nusan Sofyan Batubara Bin Ahmad Yahya. 61. Ermanila Ba Binti Kiaman, 62. Syafrizal Ray Bsc Bin A Anwar Ray H, 63. Suprayetno Bin Saman, 64. Samardi Bin Marsidi, 65. M Nurdin B Bin H Bahauddin, 66. Rohana Binti Nokman, 67. Zahara Binti Suman, 68. Kasmini Binti Kadirun, 69. Yusni Binti Peak, 70. Rodiah Saragih Binti Kamaruddin Saragih. 71. Maryana Binti M Nur Katan, 72. Ishak S.Pd Bin M Nurdin, 73. Jamaluddin Abdullah Sani Bin Abdullah, 74. Mursid Bin Hasan Bakri, 75. Samaiyah Binti H Sanusi, 76. Sa’dijah Binti Muhammad, 77. Saliyah Binti Tukacil, 78. Rahimah Binti Sanik, 79. MYusuf R Bin Rapa’i, 80. Rasidi Bin Riduan, 81. Saudah Binti Muhammad, 82. Saedah Binti Rafa’i, 83. Jamnah Binti Lukmanul Hakim, 84. Abdul Rahman Bin H Mhd Ali Nafiah, 85. Muhlis Siregar Bin Sopiyan Siregar, 86. Erni Haida Harahap S.Pd Binti Marahad, 87. Saiyah Binti Napiah, 88. Misnawati Binti Supardi, 89. Bahrum.S Bin Amat Sabran, 90. Parno Bin Karyo Rejo. 91. Darimah Binti H Bustani, 92. Jamilah Binti Arsani, 93. Aminah Binti Basran, 94. Jakaria Bin Nafiah, 95. Muhammad Nasir,Drs Bin Usman Nasution, 96. Aswan Iriadi. Drs. Bin Abdullah Amans, 97. Sukadi Bin NotoWinangun, 98. Erliana Binti Burhanuddin, 99. Ekawati Binti Sujono, 100. Sajiah Binti H Sulaiman. 101. Turasmi Binti Noto Winangun, 102. Joni Bin Jasmen, 103. Supendi Bin Noto Winangun, 104. Kasiati Binti Mustar, 105. Ratna Kartika Sari Binti Arifin, 106. Ngadikem Binti Codi Kromo, 107. Asrul Sani Sh Bin Abd Munir Dalimunthe, 108. Drs Dani Hapianto Msi Bin Sujati Suri, 109. Tuti Suriyanti Binti Tumino, 110. Randah Julinar Nasution Binti Usman. 111. Syamsir Lubis Bin Zakaria Lubis, 112. Samiran Bin Waji, 113. Mariani Binti Kamarudin, 114. Sumiati Binti Tarman, 115. Siti Hasnah Binti H. Ismail, 116. Paisah Binti Romo Wiryo, 117. Pariah Binti Amat Darum,

118. Siti Kurniati Binti Alimin Purba, 119. Bahrin Nasution Drs Bin Abdullah Sani, 120. Zainal Arifin Bin Anwar Tongah. 121. Chairuddin Batubara Bin Abd.Mutholib, 122. Nurhayati Binti Khatib, 123. Hartini Ba Binti Ngadi H, 124. Fatimah Binti Imurejo, 125. Duma Sari Binti M.Tohir, 126. Bahzawarni.Dra.Sk Binti Bachtaruddin, 127. Baharuddin Bin Raden Pasirah, 128. Tasliman Bin Samiardi,129.SyahminanBinBilalTubah, 130. Syamsir Bin Kartomonadi. 131. Hayaruddin Purba Bin Mahisar Purba, 132. Nurlela Haloho Binti Mahmud Haloho, 133. Nursiah Br Damanik Binti M Damanik, 134. Tami Purba Bin Runggu Purba, 135. Ali Asgor Nasution Bin Mhd Nuh Nasuti, 136. Kamal Bin Amat Rusdi, 137. Sumarno Bin Supardi, 138. Jumin Sp Bin Temu Suparto, 139. Kasman A.M.Sinambela,Smhk Bin Juang S, 140. Sumarsih, Dra,Mpd Binti Rusmin. 141. M Nur Jamak Bin Jamal, 142. Syahril Lubis Bin Abbas Lubis, 143. Abdul Wahid Bin Santanik, 144. Asmah Binti Hasbullah Ali, 145. Rukiah Binti H Zakaria, 146. Nurmidah Binti Sampurno Raja Daulai, 147. Ramaini Binti Kamaruddin, 148. Masriana Pohan Binti Coki Pohan, 149. Supiani Binti Saring, 150. Ramidi Bin Suhadi. 151. Nurainah Binti Muhtar, 152. Boimin Bin Poniman, 153. Effendy Bin Wagino, 154. Nurhayani Pane Binti Musa Pane, 155.Yulinar Binti Bahar, 156. Zawahir Binti Adam, 157. Masrawati Nasution Binti Muhammad Tha, 158. Chairuddin Nasution Bin H. Ibrahim Na, 159. Muhammad Yusuf Nur Daulay Bin Datu Daulay, 160. Saima Hanum Se Binti Mahmud Syarir. 161. Suriati Binti Buang, 162. PaiminWinata Bin Karsowirono, 163. Mukhtaruddin Bin Idris.H, 164. M. Husin Bin H Fatullah, 165. Usman S Bin H Hasanuddin, 166. Mariyam Binti Burhan, 167. Jaisimah Binti M.Syafii, 168. Siti Aisyah Binti H.Ghazali Efendi, 169. Amui Bin Aman, 170. Budiah Binti M Yakub. 171. Haribut Bin Abdul Kahar, 172. Parida Hanim Panjaitan Binti Abdul Wa, 173. Salbiah Br Sinaga Binti Mahya Sinaga, 174. Ok Birman Bin Ok Gulamuddin, 175. Suparman Bin

Mangun Wiyono, 176. Mangun Wiyono Bin Stro Karyo, 177. Suparni S.Si Binti MangunWiyono, 178. Rohana Binti M.Ja’par, 179. Masniah Binti UlongYunus, 180. Fahmy Anisyah Harahap Binti H.Abdul M. 181. Hakimah Binti Badaruddin, 182. Rajenah Binti Hepni, 183. Zuriah Binti Badaruddin, 184. Natini Binti Ribut, 185. Rizlan Bin Alfit, 186. Amir Saleh Nst Drs Bin Abbas Saleh Ns, 187. M. Sapril Bin Moch. Kasim, 188. Tri Seniastuti Binti Umbran Ya’cub, 189. Reidhwana Binti Gazali Latif, 190. Mustafrizal Bin Jamaris. 191. Sulastri Binti H.Rustam, 192. Rusianik Binti Pawiro Wahab, 193. Nursyamsiah Ritonga Binti H Koddam Ri, 194. Cahyono Bin Muhammad Syarif, 195. Bety Sulastri Binti Bambang Sukardi, 196. Salfi Binti Muhammad Johan, 197. Amir Syari Bin M. Syari, 198. Baharuddin Lbs,Spd,Drs Bin Abdul Hali, 199. Yunihar, Dra Binti Hasim, 200. Dra. Elpi Binti Tk. Syarip Harahap. 201. Supangat Bin Kemin, 202. Zulhamdhi Eko Dharmawan Bin Supangat, 203. Kurniati Binti Samidi, 204. Sarwi Binti Bejo, 205. Suparni Binti Supian, 206. Fauziah Binti Amban, 207. Ari Atun Binti Kusri, 208. Wagini Binti Amat Sardi, 209. Hermanto Bin Rubino, 210. Suriani Binti M.Saleh Husni. 211. Tinem Binti Rohami, 212. Hasnah Binti Zakaria, 213. Nazariah Rangkuti Binti Nurotip, 214. Nursiti Binti Badaruddin Lubis, 215. Hamdah Binti Badaruddin Lubis, 216. Siti Sarah Se Binti Ahmad Syairi, 217. Abdul Latif Bin Abdul Basir Hs, 218. Umar Bancin Bin Jalang Bancin, 219. Rusni Sitepu Binti Meja Sitepu, 220. Kasturi Bin M.Basir. 221. Masarda Harahap,Drs Bin H,Sarmadan Ha, 222. Rina Purnama Sari,Drg Binti H.Arshad , 223. Kartini Binti Abdul Karim, 224. Fatimah Nuraini Binti Abdul Karim, 225. Halizah Binti Uteh Ranggong, 226. Tamcik Sy Binti Syahrum, 227. Suriah Binti Amat Samino, 228. Sri Marliana Binti Wartono, 229. Khairuddin Bin Ok Kohir, 230. Sapuan Bin Yasir. 231. Syahruddin Lubis Bin Syamsul Anwar Lu, 232. M. Syakranik Bin Muhammad Yunan, 233. Rohayah Binti Nafiah,

234. Patimah Binti Tukacil, 235. Saibun Bin Sabran.H, 236. Mhd. Yusuf Bin Abdullah, 237. Asrah Binti Zainuddin, 238. Mariam Binti Amat Basirun, 239. Halijah Binti Tugimin, 240. Mardiah Binti Amran S. 241 Surian Bin Mahlil, 242 Elida Binti Muhammad Efendy Ali , 243 Nius Afifuddin Bin Ismadun, 244 Kardi Bin Karyo Utomo, 245 Tukiyem Binti Atmo Wiyono, 246 Rubinem Binti Senin, 247 Waginah Binti Nadiwirya, 248 Muslimah Binti M.Nawawi, 249 Kamra Binti Lian, 250. Karmal. Ap Bin Ismail. 251 Sabirin Bin Bgd Nurut, 252 Siti Aisyah Binti Abd Majid, 253. Ermanida Binti Sutan Rasyid, 254 . Rudy Syahputra Bin Bustami , 255. Siti Zarmah Binti Kasman, 256. Maimunah Sag Binti Bustami, 257. Sarifah Binti Bahari , 258. Siti A’ah Binti M.Tahir, 259. Zahara Damanik Binti M.Ya’cub, 260. Rohaida Hasibuan Binti Abdul Rasyid H 261.Nursaniah Binti Mansyur, 262.Rosminar Harahap Binti Abdul Hadi Har, 263. Syahroini Binti M.Arsyad, 264. Sri Rahayu Binti Sukar, 265. M Idris Harahap Bin M Nur Harahap, 266. Siti Fatimah Binti Sabarun, 267. Nurhalimah Ritonga Binti Sulaiman Rit , 268. Painem Binti Wagiman, 269. Sumarni Binti Boimin, 270. Ngateman Bin Paijan. 271 .Karnafi Bin Marmin, 272 .M.Yusuf Bin Usman, 273. Syarifuddin Bin Ismail Monang, 274 . Anzaruddin Tarigan Bin Ismail Monang, 275 .Salamah Binti Muhammad Kasim, 276. Poniman Bin Atmo, 277. Dahler Siregar Bin Bgd Mandugu Siregar, 278 . Nurkasidah Harahap Binti Mgr Diakkola, 279 . Sahnidarwati Pakpahan Spd Binti Josep, 280 . Waladdin Siagian, Drs Bin Bgd. Kalisa. 281 .Dharman Fase, Ir Bin Faskinardi, 282 . Febri Yanti Zain,Dra Binti Zaini Boy, 283 . EnyYuni Rustini Binti Nursaleh, 284 . Sutinah Binti Daliman, 285 .Rahmat Se Bin Muhammad Sali, 286 . Adi Subirin Bin Cemeng Alias Rasan, 287 . Senti Purba Bin Tunggal Purba, 288 . Setiyarno Ir Bin Jumiran, 289. Mhd.Said Bin Askurdi, 290. BettyWiriaWaty Binti Sahang Dalimun. 291. MuhammadYusuf Purba Bin Baki Purba, 292 . Rahmady Bin Legiman, 293 . Elnizar,

Spd Binti Ali Amran, 294. Zainurlia Binti Ok Ajir, 295.Sakdiyah Binti Kasdi, 296. Sartini Binti Ropingi, 297.Paini Binti Tukimin, 298. Surtiati Dr Binti Msudian, 299. Mursal Harahap Bin Maraidin Harahap, 300. Nurimah Siregar Binti Dalim Siregar. 301. Bunyamin,Drs Bin Syafii, 302. Nursiah Binti Muhammad Akib, 303. Misar Bin Wono Karyo, 304. Ponijem Binti Diporejo, 305. Raja Dolly Srg Siagian Bin Mangatas S, 306. Sofiah Pohan Binti Abdurrahman Pohan, 307. Supardi Bin Abdul Majid, 308. Muhammad Saib Muda. Nst.Drs Bin Zakari, 309. Achmad Yamin Machmud Bin Machmud, 310. Ely Winoto Buono Sh Bin Drs Hs.Ardi. 311. Nuraini Binti Misran, 312. Abdul Rahman Bin Landung Sastro, 313.Sahrin Usman Bin Usman, 314 . Wagino St Bin Senen, 315. Supriadi Bin Sujak, 316. Amir Hasan Tanjung Bin Muhammad Syari, 317 . Amir Hasan Bin Tholib Alm, 318. M.Effendy Bin B.Albalas Alm , 319. Syamsiah Matondang Binti Siddik Alm, 320 . Rasminah Binti Amat Rejo,. 321. Nazri Bin Ahmad Tamsir, 322 . Ramisah Binti H.Gimin Alm, 323. Ngidupi M. Luthfi Tarigan Bin M.Yahya, 324. Kamisyah Binti Ismail, 325. Pudji Astuti Binti Alip Djaja, 326. Roosdi Soeli Hartojo Bin Ahmad Soliki, 327. Zulfiqar Hajar, Bin Ibnu Hajar, 328. Mustar Bin Paridin, 329. M. Ali Usman Bin Usman, 330. Darmiah Syamaun Binti Syamaun 331. Agustina Br Panjaitan Binti Prize Pan, 332 . Umi Salmah, S.Ag Binti Husin, H, 333. Nilawati Situmorang Binti Halus Situm, 334.Tengku Mahani, Ba Binti Tengku Soran, 335. Sriwaty Binti Kaboel, 336. Halimah Binti Dtm Abdul Majid, 337. Drg.Mimi Defrina.Mhsm Binti Usman Abu, 338. Ir.Syamsul Bahri.Msi Bin Saoeni, 339. Mukhlis Bin Kalamuddin, 340. Amrin Bin Arifin Hamzah. 341. Hartini Binti Haji Raden Sugiri. 342. Nurhayati Lubis Binti Hasyim Lubis H., 343. Nurjannah Binti Haluddin, 344. Husnah Binti H. Musthafa, 345. Istarti Binti Ainal Muthalib, 346. Jumilah Binti Mijan, 347. Halimah Nasution Binti Hasan Nasution, 348.Rosmala Dewi Binti Djamaan, 349 .Hafizham Bin

H.M.Yunan, 350 . Abdullah Sinaga.Se Bin Jaiman Sinaga. 351 .Parsono Hendrawan Bin Parso, 352. Dr.Azli.Spm Bin St.Kali, 353. Asmawati Binti Aliluddin, 354.Efidarhani Br Siregar Binti Dahroem S, 355. Mariaty Silalahi,Skm Binti Abdul Mali, 356. Lily Damita. Dra. Binti H. Soetomo, 357. Deliana Harahap, Dra Binti Sorip Hara, 358. Halimah Binti Mhd. Ilyas, 359. Maherani Daud Binti Mhd. Daud, 360 .Lasmini Binti Sarimin. 361. Marwan Bin Achmad Muchtar, 362. Mariyam Binti Hamdan, 363. Rini Adriani Binti Syamsul, 364. Baban Sukmana Bin Miskadireja, 365.Hermansyah,H,Se Bin Abdullah.A.Sani, 366. Halimatussa’diah Binti Muhammad Syari, 367. Yusmidar Binti Idris, 368. Rismalita Binti Idris , 369. Junidar Burhan, Dra Binti Burhan, 370. Afni Indah Binti H.Anwar. 371. Emmir Pramudya Bin H.Abu Sofyan, 372. H Kaswinata Se Ak Bin Kastaman Kasima, 373. Ali Nafiah Nasution Bin H.M. Ishak Nas, 374. Nur Balatif Binti H. Mubarak Balatif, 375. Aisyah Se Binti Mubarak Balatif, 376. Nelly Haryati Binti H.Rustam Jamil, 377. Zainal Bakri Bin Bakhtiar, 378. Atma Wijaya,Drg. Bin Abdul Aziz Moein, 379. Rosuma Nasution,Drg. Binti Rotim Nasu, 380. Helmy Sulaiman Binti Mhd.Idris. 381.Asmah Binti Abd.Aziz H, 382. Mirna Liza Binti H.Amiruddin, 383. Burhanuddin Ginting Bin H.Lawanuddin, 384. Mustajab Bin Toe, 385. Murina Binti Paimin, 386. Ida Farida Binti Enjat Sudrajat, 387. Arief Hermawan Bin Zainuddin, 388.R. Syahrial Effendi Bin Raja Abdul Jal, 389. Rita Haslinda Binti Muchtar Amas, 390. Titien Isnarti Binti H.Sjamsul Bahri 391. Muhammad Harahap Bin Baginda Barayun, 392. Basariah Binti Mustafa Pohan,H, 393. Inggir Deviandari Binti Ilham Dalimun, 394 .Riswan Bin Abd. Rahman Lbs, 395. Ir. Amru Siregar Mt Bin Baginda Malim, 396. Rusfian Drg M Kes Bin D Saelan, 397. Muhammad Rusli Bin Mhd Satar, 398. Tuti Hj Binti Martoradin, 399. Nurmala Binti Abd. Muthalib, 400. Setiawati, Dra Binti H. Sarkawi. 401.Aprimidia Sari Binti H.Mhd.Idris Kams, 402. Dra. Rina Sariwardani Binti H.Mhd. Id,

403. Rosita Idris Binti H.Mhd.Idris Kamso, 404. Sri Widyastuti Binti Darmo Subiyanto, 405. Ir. Yarwoto, Mm Bin Joyo Pawiro, 406. Fachruddin Nasution Bin Mhd. Amin Nas, 407. Hilman Lubis Sh. Bin H. Ismail Lubis , 408. Dra. Erpi Desriana Hasibuan Binti H., 409. Lely Afriana, Dra Binti Muslim Roufdy, 410. Armen Hamonangan Rkt, Dr, Sprad Bin Arj. 411.Ir.Nazli Mma Bin H.Ismail, 412. Nurlela Binti Ramli, 413. Deliana Binti Sanusi Thalib, 414. Yuliana Binti Bachtiar Ibrahim, 415. Uswatun Hasanah Drg Binti Dahlan Nurd, 416. Tornanda Syaifullah Bin Mansur St Ali, 417.Amir Syarifuddin Bin Sulaiman, 418. Parlindungan Pane,Sh Bin Maksum Pane, 419. Suparno Bin Sukardi Atmosuwito, 420. Ismart Edy Hasibuan Dr.Sp.A Bin Makir. 421. Sri Ninin Asnita Dr.Spm Binti Slamet, 422. Rosmaida Saragih Binti Jakirman Sarag, 423. Siti Ruminah Binti Samud, 424. Rosmawaty Pakpahan Binti Tigor Pakpah, 425. Rismawati Br Pakpahan Binti Tigor Pak, 426. Siti Ayun Br Pakpahan Binti Husien Pa, 427. Deliana Nasution Binti Zainal Nasutio, 428. Sungai Sembiring Binti Jamintan Sembi, 429. Roswin. Drs. Bin Abd. Hakim, 430. Yas’a Binti Busman Adami . 431. Jairina Binti Tambeng, 432. Masiah Binti Saring, 433. Nurjasmaini Binti M. Berkat, 434.Husnati Binti Nurdin Tahar, 435. Alfyan Bin Baharun, 436. Nurdin Berampu Bin Abd. Rani Berampu, 437. Syamsinar Binti Ondar, 438. Tempon Binti Arok, 439. Kamaluddin Bin Sogek, 440. Dicky Martin Siregar Se Bin H.Ali Akb 441. Yulianti Siregar Binti Darwin Muar Si, 442. Cut Khairana Spd Binti T. Khairun. H., 443. Ali Hazmi Bin Razali, 444. Irham Yajid. P. Bin Abdul Halim, 445. Bainuddin Bin M. Jai’e, 446.Suharti Binti Hambali, 447. Aswani Binti M.Idris, 448. Sudarman Bin Kaolah, 449. Abul Hasan Syazali Bin H. Abd Rahcman, 450 .Kamiyem Binti Mantono 451. Drs.Mhd.Kasim Yusuf Bin Mhd Yusuf, 452. Habibah Ali Binti Mhd Ali, 453. H.M.Ilyas Tarigan,Drs Bin H.Husin Tar, 454. Norma Gr.Ginting Binti Aleng Ginting, 455. Siti Zubaidah Binti M. Rasyid. (h10/m32/m36)

Luar Negeri NATO Kehilangan 17 Tentara Dalam 3 Hari Di Afghanistan

A9

WASPADA

Sabtu 16 Oktober 2010

KABUL, Afghanistan (AP/Antara/Reuters):Tiga lagi tentara NATO tewas di Afghanistan Jumat (15/10) dalam satu peningkatan serangan sehingga menambah jumlah korban tentara asing menjadi 17 orang dalam tiga hari terakhir.

Orang Terkaya India Bangun Rumah Bergaya Pencakar Langit NEW DELHI, India (Antara News):Orang kaya biasanya membangun rumah seperti istana, tapi orang terkaya di India, Mukesh Ambani, punya cara lain. Dia membuat gedung pencakar langit sebagai rumahnya yang baru. Kediaman itu mempunyai 27 lantai dan bernilai 630 juta poundsterling, demikian tulis The Telegraph, Kamis (14/10). Rumah dengan 27 lantai itu mempunyai klub kesehatan yang dilengkapi pusat kebugaran, studio menari, ballroom, ruang tamu, sejumlah lounges dan sebuah bioskop dengan 50 tempat duduk. Bahkan dia juga membangun sebuah taman gantung lengkap dengan pohon-pohon kecil. Ambani bersama istri dan tiga anaknya pindah ke rumah yang dinamainya Antilia, sesuai dengan nama sebuah pulau dalam dongeng. Rumah itu dilengkapi dengan tiga ‘helipad’ di atapnya dan juga memiliki sebuah tempat parkir bawah tanah yang bisa memuat 160 mobil. Dari puncak rumah yang setinggi 173 meter itu akan tampak pemandangan kota Mumbay dan Laut Arab. Pengusaha berusia 53 tahun itu bukan saja orang terkaya di India tetapi juga berada di urutan keempat untuk ukuran dunia. Rumahnya dilaporkan memiliki luas 37.000 meter persegi yang artinya lebih dari luas Istana Versailles, di Prancis. Untuk merawat rumah itu dia mempekerjakan 600 pelayan. Menurut Majalah Forbes, Ambani memiliki saham terbesar pada perusahaan Reliance Industries, yang bergerak di bidang perminyakan, bisnis eceran, dan konglomerasi bioteknologi. Dia diperkirakan mempunyai kekayaan senilai 18 miliar Pound-sterling.

Salah seorang anggota tentara asing tewas Jumat dalam satu serangan pemberontak di timur dan seorang lainnya tewas akibat ledakan bom jalanan di selatan Afghanistan, demikian kata pernyataan sekutu. Tidak disebutkan kebangsaan atau lokasi pastinya serangan tersebut. Prancis mengatakan seorang tentara Prancis tewas Jumat akibat lukanya dalam bentrokan di Lembah Uzbin di timur Kabul hari sebelum. Kamis, delapan tentara NATO tewas dalam satu serangan, termasuk empat serangan bom jalanan. Di provinsi Helmand di selatan Kamis, seorang pengebom bunuhdiri menewaskan seorang perwira polisi, kata kepala polisi distrik Reg-i-Khan Nishin, Kamal Uddin Jumat. Perwira itu melihat penyerang mendekati satu kompleks dan melakukan pencegatan atas dirinya. Penyerang meledakkan sendiri dirinya, yang menewaskan perwira polisi tersebut, kata

Uddin. Jurubicara Taliban QariYousaf mengatakan pengebom bunuhdiri menewaskan 11 polisi di gerbang kompleks tersebut. Tidak mungkin untuk mendapatkan konfirmasi atas pernyataanYousof itu dan Taliban diketahui selalu melebihkan angka kematian akibat serangannya. NATO itu tidak merinci Lebih dari 150.000 tentara asing dikerahkan di Afghanistan untuk mengalahkan perlawanan pimpinan Taliban, yang bertujuan menjatuhkan demokrasi negara dukungan Barat itu. Pejuang meningkatkan serangan setiap tahun sejak penguasa Taliban digulingkan dalam serbuan pimpinan Amerika Serikat pada ahir 2001. Untuk membasmi pejuang itu, Washington menempatkan sekitar 30.000 tentara tambahan pada tahun ini sebagai dasar siasat gelombang guna mempercepat ahir perang. Sekitar 10.000 lagi tentara NATO juga dikerahkan. Pada tahun ini, yang bakal

paling mematikan bagi pasukan asing, 590 tentara pimpinan NATO tewas, kata angka berdasarkan atas hitungan laman mandiri icasualties.org, sementara pada tahun lalu, 521 serdadu tewas. Sejak serbuan pada 2001 itu, sejumlah 2.159 tentara asing tewas di negara terkoyak perang tersebut, dengan Amerika Serikat menderita korban terbanyak, 1.334 orang, diikuti Inggris dengan 340 orang, Kanada (152), Prancis (50), Jerman (45), Denmark (37), Italia (34), Spanyol (30), Belanda (24), dan 113 lagi dari sisa 43 negara lain. Peningkatan jumlah korban tewas menjadi berita buruk bagi Washington dan sekutunya, yang pemilihnya semakin putus asa oleh korban dalam perang di tempat jauh itu, yang tampak berkepanjangan dan tak berujung. NATO menghadapi kemunduran besar di Afghanistan saat Gedung Putih memecat Jenderal Amerika Serikat Stanley McChrystal, yang mengecam presiden dan penasehat utama da-

lam wawancara dengan sebuah majalah. Perpecahan muncul di persekutuan 46 negara itu saat berusaha memadamkan perlawanan sembilan tahun Taliban, dengan utusan khusus Inggris memperpanjang cuti, korban meningkat dan laporan bahwa Amerika Serikat “tanpa sengaja” mendorong panglima perang. Penarikan NATO dari Afghanistan akan bertahap dan tidak terburu-buru pada Agustus mendatang, kata panglima pasukan asing di sana, Jend. AS David Petraeus, pada tengah September. Perang di Afghanistan tahun ini merupakan yang paling mematikan sejak invasi 2001 yang menggulingkan rezim Taliban. Korban-korban asing terakhir berjatuhan setelah Jend. AS David Petraeus pada 4 Juli mulai memegang komando atas 140.000 prajurit AS dan ISAF di Afghanistan, menggantikan Jend. AS Stanley McChrystal, yang dipecat karena pembangkangan.(m07)

Swiss Siap Untuk Resmikan Terowongan Terpanjang Di Dunia SEDRUN, Swiss (AP/BBC): Para pejabat Swiss menyatakan hari gembira Jumat (15/10) ketika para penduduk di Alpine dengan penuh semangat menantikan saat peresmian terowongan terpanjang di dunia — satu proyek yang memakan waktu 60 tahun untuk mewujudkannya. Para insinyur mulai menghidupkan mesin Engineers pada pukul 02:00 siang yang akan melobangi batu yang masih menjadi sekat yang memisahkan kedua ujung terowongan sepanjang 57 km yang diberi nama Terowongan Gotthard Base di Swiss Pusat. Terowongan itu nampaknya merupakan satu patokan penting pembentukan satu jaringan angkutan berkecepatan tinggi yang menghubungkansemuasudutEropa.Terowonganitumemungkinkan jutaan ton barang yang saat ini diangkut melalui pegunungan Alps dengan truk-truk berat akan diubah melalui jaringan rel, yang secara ekonomi terowongan itu jadi penghubung penting antara pelabuhan Rotterdam di Belanda dan pelabuhan Genoa di Laut Tengah Italia. Para pekerja di Swiss yang sedang menggali terowongan kereta terpanjang di dunia akan melakukan terobosan terakhir hari ini dengan mengebor lapisan batu sepanjang beberapa meter. Terowongan Gotthard sepanjang 57 kilometer itu akan memungkinkan kereta berkecepatan tinggi meluncur antara Zurich di Eropa utara dan Milan di Eropa selatan. Perjalanan kereta bisa dipersingkat satu setengah jam. Terowongan ini juga akan mengurangi kepadatan lalu lintas di berbagai jalan di daerah pegunungan Alpen setelah diresmikan pada 2017 nanti. Pembangunan terowongan terpanjang itu memakan waktu 14 tahun dan menelan biaya sebesar AS$10 miliar. Sekitar 2.500 orang telah bekerja di terowongan dan delapan orang meninggal dunia dalam proses konstruksi. “Terowongan Gotthard akan selamanya menjadi monumen luar biasa dan besar yang akan dibandingkan dengan semua terowongan yang ada,” kata Menteri Perhubungan Swiss Moritz Leuenberger. Terowongan di Swiss tersebut akan mengalahkan terowongan Seikan di Jepang sepanjang 53,8 kilometer yang menghubungkan Pulau Honshu dengan Pulau Hokaido. Terowongan terpanjang ketiga di dunia adalah Channel Tunnel yang terletak di bawah Selat Inggris sepanjang 50 kilometer yang menghubungkan Inggris dengan Prancis. (m07)

Carter Ke Timteng Dukung Perdamaian Israel-Palestina ATLANTA, AS (Antara/Reuters): Mantan presiden Amerika Serikat Jimmy Carter akan memulai lawatan ke Timur Tengah, Sabtu (16/ 10), untuk menambah dukungan bagi dicapainya perjanjian perdamaian antara Israel dan Palestina. Carter, 86, akan mengunjungi Mesir, Syria, Jordania, Israel dan wilayah Palestina. Dia akan pergi bersama dengan delegasi yang disebut The Elders, yang akan dipimpin oleh mantan pre-siden Irlandia Mary Robinson dan mencakup mantan utusan PBB Lakhdar Brahimi. “Tujuan dari kunjungan mereka adalah untuk mendorong dukungan di seluruh wilayah itu pada pembicaraan status akhir sekarang ini dengan menekankan pada perlunya mencapai perdamaian yang adil dan menjamin,” kata pernyataan The Elders, kelompok yang didirikan oleh mantan presiden Afrika Selatan Nelson Mandela pada 2007. Palestina telah menghentikan pembicaraan perdamaian langsung dengan Israel hanya beberapa pekan setelah mereka mulai bulan lalu sesudah Israel menolak memperpanjang mora-torium 10 bulan pembangunan permukimanYahudi diTepi Barat yang mereka duduki. Carter telah aktif dalam diplomasi internasional sejak menjabat sebagai presiden dari 1977 hingga 1981. Dia menerima hadiah Nobel perdamaian pada 2002, sebagian karena sumbangannya pada Perjanjian Camp David 1978 antara Israel dan Mesir.

Reuters

Laura Dekker ,15, dari Belanda melayarkan boatnya Guppy di pelabuhan Pasito Blanco di Gran Canaria, Pulau Canary, Spanyol, Kamis (14/10). Dekker melanjutkan usahanya menjadi pelaut remaja yang berlayar keliling dunia sendirian (solo).

Partai Komunis China Memulai Pertemuan Tahunan BEIJING, China (Antara/AFP): Partai Komunis China memulai pertemuan tahunannya untuk mendiskusikan rencana nasional lima tahun ke depan di tengah spekulasi reformasi politik yang dapat menjadi agenda pertemuan tertutup tersebut. Sidang pleno dengan sekitar 300 anggota Komite Sentral di Beijing akan berlangsung hingga Senin (18/10), seperti biasa diselimuti rahasia besar tanpa ada pengumuman tentang rincian sidang hingga pleno berakhir. Kantor berita Xinhua mengatakan pertemuan, yang diperkirakan akan dihadiri oleh Presiden Hu Jintao, PM Wen Jiabao, dan pemimpin tinggi lainnya, terbuka “untuk mendiskusikan rencana nasional lima tahun mendatang” dari 2011-2015. Namun, spekulasi telah beredar kalau reformasi politik juga akan menjadi topik hangat setelah Wen —yang dikenal lebih liberal— baru-baru ini mengeluarkan pernyataan yang tidak biasa tentang reformasi politik. Debat mengenai reformasi sepertinya akan berlangsung intensif setelah aktivis yang sedang dipenjara Liu Xiaobo minggu lalu memenangkan Nobel Perdamaian yang pertama untuk China, membuat marah China. Analis mengatakan perdebatan itu bukan berarti para pemimpin akan memperdebatkan sesuatu yang mirip dengan demokrasi Barat, namun hal itu menunjukkan ketidakpuasan yang dirasakan karena kurangnya demokrasi di dalam partai yang makin terlihat didominasi oleh Hu. “Pernyataan terakhir oleh Wen Jiabao menunjukkan pandangan dari satu faksi dalam partai yang berharap untuk bergerak cepat dalam hal itu (reformasi), namun faksi ini tidak akan dapat menguasai pembicaraan,” kata Willy Lam, analis politik di Chinese University of Hongkong. Wen mengatakan bulan ini dalam wawancara dengan CNN —dilarang disiarkan di China— bahwa permintaan atas “demokrasi dan kebebasan menjadi hal yang tidak dapat terhindarkan.”

Korut Ancam Serang Korsel Karena Selebaran

SORAK GEMBIRA SETELAH TEROWONGAN TERPANJANG TEMBUS

The Associated Press

Para penambang bersorak gembira setelah mesin pengebor ‘Sissi’ menembus bagian akhir dari Terowongan Gotthard Base dekat Sedrun di Grisons, Swiss, Jumat (15/ 10). Dengan panjang 57 km, terowongan St. Gotthard itu adalah terowongan terpanjang di dunia saat ini.

Ahmadinejad Kirim Pesan Kepada AS Lewat Kunjungan ke Lebanon BEIRUT, Lebanon (Antara): Kunjungan pemimpin Iran Mahmoud Ahmadinejad pada minggu ini mengirimkan pesan ke Washington bahwa Teheran adalah pemain kunci di kawasan Timur Tengah dan tidak dapat diisolasi, tulis koran-koran Lebanon pada Jumat (15/10). “Pesan yang disampaikan kepada Amerika yaitu `Kalau Anda mengisolasi Iran, maka Iran akan mengurung Anda di Lebanon atau di tempat lain,” tulis satu editorial di harian independen berbahasa Arab Al-Anwar. “Pesannya adalah bilaWashington menginginkan solusi di kawasan (timur tengah) ...Amerika harus mengetuk pintu Iran.” Amerika Serikat dan sekutunya berusaha untuk mengiso-

lasi Iran sebagai usaha menekannya untuk menghentikan program nuklir yang terus Teheran katakan bertujuan untuk kepentingan sipil. Kunjungan dua hari Ahmadinejad ke Lebanon, kunjungan pertamanya sejak dia terpilih pada 2005, dianggap secara luas sebagai dorongan bagi sekutu kuncinya Hizbullah, kelompok militan kuat beraliran Syiah yang berperang melawan Israel pada 2006 dan dianggap sebagai perpanjangan tangan Iran. “Bagi warga Iran, kunjungan presiden mereka dapat dianggap dalam konteks pengerahan kekuatan besar sedang terjadi di kawasan hari demi hari,” tulis harian Al-Akhbar yang dekat dengan Hizbullah.

Harian pan-Arab, Al-Hayat mempertanyakan apakah kunjungan itu menandakan proposal Iran untuk menunjukkan dirinya sebagai pemain kunci di kawasan Timur Tengah. “Dapatkah Iran mengisi kekosongan di Timur Tengah setelah `bunuh diri` Uni Soviet dan penarikan AS dari beberapa wilayah?” tanya harian yang bermarkas di London itu menyinggung berkurangnnya jumlah personil militer AS di Irak. Akhiri kunjungan Ahmadinejad mengakhiri kunjungan kontroversial dua hari ke Lebanon ketika dia bertemu ketua Hizbullah Hassan Nasrallah. Ahmadinejad dan Nasrallah bertemu Kamis (14/10) malam

di kedutaanbesar Iran di Beirut, di mana mereka membahas berbagai perkembangan politik mutakhir dan hasil kunjungan presiden Iran, kata pernyataan yang didistribusikan oleh kantor media kelompok garis keras Syiah. Pesawat AhmadinejadmeninggalkanbandaraBeirut Kamis tengah malam. Ahmadinejad memperkirakan ‘kemusnahan’ Israel dalam pidato Kamis di kota Lebanon Selatan, Bint Jbeil, yang berjarak hanya empat kilometer dari perbatasan dengan Israel. Dia mendapat sambutan hangat di Lebanon Selatan yang didominasi kelompok Syiah, dengan puluhan ribu penduduk setempat menghadiri majelis di Bint Jbeil dan di kota Qana.

SEOUL, Korea Selatan (AP): Korea Utara memperbarui ancamannya Jumat (15/10) untuk menyerang Korea Selatan sehubungan dengan penyebaran selebaran anti-Pyongyang yang dikirimkankenegaratersebut,satupertandabertambahnyaketegangan setelah kasus tenggelamnya kapal Korea Selatan. Para aktivis biasanya menggunakan balon untuk meluncurkan selebaran yang mengutuk pemimpin Korea Utara (Korut) Kim Jongil agar menyeberangi perbatasan yang dijaga ketat, satu taktik yang dipandang Pyongyang sebagai bagian dari kampanye psikhologis Korea Selatan (Korsel) yang bertujuan menggulingkan rezimnya. Korut memperingatkan dalam perundingan militer dengan Korsel bulan lalu bahwa pihaknya mungkin menembakkan artileri ke lokasi yang digunakan para aktivis untuk meluncurkan balonbalon tersebut. Menteri Pertahanan Korsel Kim Tae-young mengatakan awal bulan ini bahwa militer segera akan melanjutkan kegiatan propaganda berskala besar terhadap Korut, namun sampai sejauh ini masih membatasi dalam bentuk siaran militer. Siaran itu telah dilanjutkan setelah tenggelamnya satu kapal perangKorselMaretlaluyangmenewaskan46pelaut.Satupenyelidikan multinasional yang dipimpin Korsel menyimpulkan bahwa satu torpedo Korut menenggelamkan kapal perang itu, namun Pyongyang membantah keterlibatannya. Jumat, militer Korut mencela komentar menteri pertahanan Korsel sebagai satu deklarasi perang terhadap Korut, kata laporan kantor berita Korean Central News Agency. “Jika pihak Selatan tidak menghentikan... siaran dan selebaran anti-Korut, maka negara itu tidak akan pernah dapat menghindar dari serangan fisik Tentara Rakyat Korea (KPA) pada pusat penyiaran dan penaburan selebaran,” kata militer Korut. Korut mengirimkan pesan protes kepada para pejabat militer di Korsel, kata KCNA. Militer Korut mengatakan responnya bergantung pada bagaimana reaksi Korsel. Kementerian Pertahanan Korsel mengatakan pihaknya belum sedia berikan komentar terhadap ancaman Peringatan terakhir itu muncul di tengah berbagai pesan dari Korut. Pyongyang barubaru ini mengulurkan tangan pada Korsel dan menyerukan agar dilakukan perundingan yang terkendala di satu daerah wisata Korut. Kedua belah pihak juga sepakat untuk mengadakan reuni pertama bulan ini setelah terputus setahun bagi keluarga yang terpisah akibat Perang Korea. Pyongyang juga menunjukkan kemarahannya pada Seoul karena melakukan latihan angkatan laut dengan AS, Australia dan Jepang pekan ini yang dikatakan sekutu adalah pelatihan untuk mencegat pengiriman senjata dari negara-negara seperti Korut. Korut yakin setiap latihan militer melibatkan AS secara lambat laun bertujuan untuk invasi. (m07)

Sport

A10

Reuters

Jose Mourinho disebut-sebut ingin reuni lagi dengan kapten Chelsea John Terry (kiri).

Mourinho Cukup MADRID (Waspada): Entrenador Real Madrid Jose Mourinho, mengaku skuadnya sudah cukup hingga tidak berencana mengontrak pemain lagi pada jendela transfer musim dingin mendatang. Sabtu, 16 Oktober Atletico Madrid vs Getafe *TVOne Live pkl 23.00 WIB Barcelona vs Valencia *TVOne Live pkl 01.00 WIB Malaga vs Real Madrid *TVOne Live pkl 03.00 WIB

Minggu, 17 Oktober Deportivo vs Osasuna R Santander vs Almeria Real Mallorca vs Espanyol Hercules vs Villarreal Levante vs Real Sociedad *TVOne Live pkl 22.00 WIB Ath Bilbao vs Zaragoza *TVOne Live pkl 00.00 WIB Sporting Gijon vs Sevilla *TVOne Live pkl 02.00 WIB

“Ini lah tim kami mulai sekarang sampai akhir musim nanti. Ini para pemain yang kami percayai,” ujar Mourinho dalam laman El Real, yang dikutip Jumat (15/10). “Kami memiliki tim yang optimal dengan para pemain yang menambah rasa percaya diri saya. Karena itu saya tidak ingin menambah pemain di jendela transfer musim dingin,” katanya lagi. Namun menjelang lawatan pasukannya ke Malaga untuk melakoni laga lanjutan La Liga Primera dinihari WIB nanti, ambisi belanja Mourinho tetap saja diusik media Spanyol. Mantan manajer Inter Milan, Chelsea dan FC Porto itu disebut-sebut ingin membeli

bomber baru, walaupun Los Blancos telah memiliki striker Argentina Gonzalo Higuain dan penyerang Prancis Karim Benzema. Mourinho juga dikabarkan, berambisi mendatangkan bek kesayangannya ketika menukangi Chelsea, John Terry. Untuk memuluskannya, Los Galacticos siap menukar tambah Terry dengan bek Portugal Kepler Laveran Lima alias Pepe. Barcelona-Valencia Real nilai 14 kini menghuni peringkat tiga klasemen La Liga, dijepit oleh Valencia (15 poin) dan Barcelona (13 poin) yang malam ini malah saling bentrok di Camp Nou. Dalam duel itu nantinya, playmaker Barca Xavi Hernandez rawan absen demi kepentingan memperpanjang masa penyembuhan cedera otot tendon yang dideritanya sejak akhir bulan lalu. “Dia ingin bermain melawan

Toni Ambisi Bobol Roma ROMA (Waspada): Penyerang jangkung Genoa Luca Toni (foto) berambisi membobol gawang AS Roma dalam laga lanjutan Liga Seri A dinihari WIB nanti di Stadion Olimpico Roma. “Saya benar-benar sangat bersemangat untuk mencetak gol sekaligus menandai suatu dedikasi spesial,” tegas Toni, seperti dikutip dari FootballItalia, Jumat (15/10). Bomber Italia itu membela Il Lupo dengan status pinjaman dari Bayern Munich pada Januari-Juni 2010, tapi gagal mencuri hati alenatorre Roma Claudio Ranieri. Tampil lumayan bagus dalam masa peminjamannya selama enam bulan, Srigala Me-

Valencia, namun saya mengatakan kepadanya untuk menunggu lebih lama lagi,” jelasDr Ramon Cugat, spesialis yang menjaga kebugaran pemain El Catalan. “Kondisinya masih belum memungkinkan untuk tampil. Masih terlalu dini baginya untuk bermain,” tambah Cugat dalam Sportinglife. Xavi sebelumnya juga tidak ikut berpartisipasi membela Spanyol pada babak kualifikasi Euro 2012 menghadapi Lithuania dan Skotlandia. Dia diistirahatkan pelatih Barca Pep Guardiola sejak akhir September lalu dan hanya jadi penonton saat timnya ditahan 1-1 oleh Real Mallorca. Pahlawan El Matador saat menjuarai Euro 2008 dan Piala Dunia 2010 itu kemungkinan baru bisa beraksi lagi saat Los Azulgranas menjajal FC Copenhagen di Liga Champions, Rabu mendatang. (h01/bb/afp/sl)

Sabtu, 16 Oktober AC Milan vs Chievo AS Roma vs Genoa

Minggu, 17 Oktober Cagliari vs Inter Milan Sampdoria vs Fiorentina Catania vs Napoli Palermo vs Bologna Cesena vs AC Parma Brescia vs Udinese Juventus vs Lecce Bari vs SS Lazio

AP

rah malah melepas Toni demi merekrut mantan penyerang Inter Milan asal Brazil Adriano Leite Ribeiro. Maka, laga nanti bakal men-

jadi arena unjuk ketajaman bagi mantan maskot Fiorentina tersebut. Kans Toni cukup bagus, mengingat Roma menghadapi masalah besar jelang

Klasemen Liga Premier

Klasemen Liga Seri A

Chelsea Man City Man United Arsenal Tottenham West Brom Stoke Aston Villa Blackpool Fulham Sunderland Bolton Blackburn Wigan Newcastle Birmingham Everton Liverpool Wolves West Ham

Lazio Inter Milan Napoli AC Milan Chievo Brescia Juventus Palermo Catania Genoa Bari Lecce Cagliari Sampdoria Bologna Cesena Fiorentina Parma AS Roma Udinese

7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7

6 4 3 3 3 3 3 3 3 1 1 1 2 2 2 1 1 1 1 1

0 2 4 2 2 2 1 1 1 6 5 5 2 2 1 4 3 3 2 2

1 1 0 2 2 2 3 3 3 0 1 1 3 3 4 2 3 3 4 4

23- 2 18 9 - 3 14 16- 9 13 16- 9 11 8 - 6 11 9 -12 11 8 - 9 10 9 -12 10 11-15 10 8-7 9 7-7 8 10-11 8 7-8 8 4 -13 8 10-10 7 7 -10 7 6-7 6 7 -11 6 7 -12 5 5 -14 5

6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6

4 3 3 3 3 3 2 2 2 2 2 2 1 1 1 2 1 1 1 1

1 2 2 2 1 0 2 2 2 2 2 2 4 4 4 1 2 2 2 1

1 1 1 1 2 3 2 2 2 2 2 2 1 1 1 3 3 3 3 4

8- 5 8- 3 12-8 8- 4 8- 5 7- 8 12-9 10-9 7- 6 6- 7 6- 9 5- 8 7- 5 7- 6 7- 8 4- 7 6- 7 5- 7 5-11 3- 9

13 11 11 11 10 9 8 8 8 8 8 8 7 7 7 7 5 5 5 4

Klasemen Liga Primera

Klasemen Ligue 1

Valencia Villarreal Real Madrid Barcelona Sevilla Getafe Atl Madrid Espanyol Mallorca Malaga Ath Bilbao Hercules Sociedad Almeria Osasuna S Gijon Levante Santander Zaragoza Deportivo

Rennes St-Etienne Lille Toulouse Brest Sochaux Paris SG Marseille Caen Bordeaux Montpellier Valenciennes Nice Auxerre Monaco Lorient Lyon Nancy Lens Arles-Avignon

6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6

5 5 4 4 3 3 3 3 2 2 2 2 2 1 1 1 1 1 0 0

1 0 2 1 2 1 1 0 2 1 1 1 1 3 2 2 2 1 3 3

0 1 0 1 1 2 2 3 2 3 3 3 3 2 3 3 3 4 3 3

11-4 12-4 12-2 10-5 10-6 11-8 10-7 5- 9 5- 6 12-12 9- 9 5- 6 6- 9 5- 5 4- 6 6-11 5-11 3- 8 5-10 3-11

16 15 14 13 11 10 10 9 8 7 7 7 7 6 5 5 5 4 3 3

8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8

5 5 3 4 4 4 3 3 3 3 3 4 2 1 1 2 2 2 1 0

3 0 12- 4 18 2 1 13- 7 17 5 0 11- 5 14 2 2 10- 7 14 2 2 7 - 4 14 1 3 16- 9 13 3 2 11- 6 12 3 2 14-10 12 3 2 8 - 8 12 2 3 8 - 7 11 2 3 7 - 9 11 2 2 8 - 8 10 4 2 7 -10 10 5 2 11-10 8 5 2 7-7 8 2 4 7-9 8 2 4 7 -11 8 2 4 9 -15 8 2 5 7 -17 5 0 8 3 -20 0 (jonny/uefa)

Sabtu, 16 Oktober Fulham vs Tottenham Bolton vs Stoke City Newcastle vs Wigan Ath Wolves vs West Ham Arsenal vs Birmingham *Global Live pkl 21.00 WIB Man United vs West Brom *TPI Live pkl 21.00 WIB Aston Villa vs Chelsea *TPI Live pkl 23.00 WIB

Minggu, 17 Oktober Everton vs Liverpool *Global Live pkl 19.00 WIB Blackpool vs Man City *TPI Live pkl 22.00 WIB

Senin, 18 Oktober Blackburn vs Sunderland Dirk Kuyt (kanan) cedera, Fernando Torres prima. -Reuters-

Berita Baik The Reds LONDON (Waspada): Kabar baik menghampiri Liverpool, Jumat (15/10), tepat menjelang derbi melawan Everton besok malam di Liga Premier. Sebab, mesin golnya Fernando Torres dinyatakan siap tampil lagi di Goodison Park, setelah pulih dari cedera paha saat Pool dipermalukan klub promosi Blackpool 1-2, awal Oktober lalu. Istirahat selama jeda ajang internasional, membuat kondisi Torres membaik. Mantan maskot Atletico Madrid itu bahkan dipastikan fit untuk melakoni

Merseyside Derby. Bek kiri Paul Konschesky yang sempat cedera, menambah kebahagiaan The Reds. “Konchesky telah melakukan pemulihan yang sangat bagus, sama seperti Torres,” jelas manajer Roy Hodgson. “Jadi semuanya baik-baik saja. Kami bisa menyambut kembali keduanya,” tambah Hodgson, sebagaimana diberitakan AP. Berita baik lainnya, bek kawakan Jamie Carragher sudah setuju perpanjangan kontraknya selama dua tahun. Bek

berusia 32 tahun itu berarti akan membela Reds sampai Juni 2013. Kontrak baru itu juga bakal membuat Carrragher akan pensiun bersama Anfield Gank yang sudah dibelanya sejak kecil. Namun Hodgson harus kehilangan Dirk Kuyt, tandem sejati Torres di garis serang Si Merah. Kuyt mengalami cedera parah saat membela Belanda di babak kualifikasi Euro 2012, Selasa lalu, sehingga bakal absen buat waktu yang lama. Kuyt malah sempat mengaku, dirinya bakal absen hing-

ga tahun depan. Tapi Hodgson yakin, bomber berusia 30 tahun itu bisa beraksi lagi bulan depan, menyusul hasil pemeriksaan tim medis klub. “Dia memang cedera enkel serius dan ototnya juga sobek. Kami akan mengistirahatkan dia untuk beberapa laga, itu sudah pasti,” tegas Hodgson. “Tapi dokter kami menyatakan optimistis, mungkin hanya satu bulan. Bahkan jika beruntung bisa hanya tiga pekan istirahat,” tambah mantan manajer Fulham tersebut. (h01/ap/bbc)

Henry Janji Buang Hicks-Gillet

kunjungan Genoa. Ranieri kabarnya rawan kehilangan Daniele De Rossi, Mirko Vucinic, David Pizarro dan Jeremy Menez, semuanya karena cedera. Rodrigo Taddei dan Simone Perrotta juga tidak dalam kondisi fit. Sedangkan Adriano dan Julio Sergio sudah dipastikan absen. (h01/bb/fi)

Lorenzo Belum Puas PHILLIP ISLANDS, Australia (Waspada): Jorge Lorenzo (foto) menjadi pembalap tercepat pada sesi latihan pertama MotoGP Australia di Sirkuit Phillip Island, Jumat (15/10), yang sempat tertunda karena hujan deras. Trek yang digenangi air pada pagi hari membuat sesi latihan pertama tertunda hampir dua jam. Meski hujan mereda, kondisi trek tetap kurang bersahabat dan angin kencang ditambah suhu udara rendah menjadikan sesi pelatihan pembuka terasa berat. Namun Lorenzo yang juga andalan Fiat Yamaha berhasil mencatat waktu 1 menit 41,146 detik disusul Casey Stoner dari Ducati Marlboro dengan selisih 0,334 detik. Pembalap tuan rumah itu tampil kencang di awal sesi dan sempat unggul empat detik di depan Lorenzo selama beberapa menit. Rekan setim Stoner, Nicky Hayden, melengkapi posisi tiga besar di mana dua pembalap Gresini Honda menempati posisi keempat dan kelima. Pada penampilan perdananya usai cedera, Dani Pedrosa hanya mampu melahap delapan lap. Pembalap Tech 3 Yamaha asal Amerika Serikat, Ben Spies, bahkan hanya tampil selama tiga putaran. Lorenzo memang telah berhasil menobatkan diri sebagai juara dunia MotoGP musim ini. Meski begitu, pembalap Spanyol itu mengaku belum puas dan ingin terus meraih kemenangan guna mencatatkan rekor baru. Target pertamanya adalah melewati rekor rekan setim yang mulai musim depan akan menjadi rivalnya,Valentino Rossi, dalam hal pengumpulan poin terbanyak dalam semusim. Saat ini, rekor poin terbanyak tersebut masih dipegang The Doctor (373 poin) pada musim 2008. Sementara ini Lorenzo telah mengoleksi 313 poin. Dengan tersisa 75 poin untuk diperebutkan di sisa tiga seri, jawara baru MotoGP itu berpeluang melewati rekor Rossi dengan mengumpulkan 388 poin di akhir musim andai memenangi seri di Australia, Portugal dan Valencia. Selain itu, Lorenzo berpeluang menyamai rekor Rossi lainnya dalam urusan naik podium terbanyak dalam semusim. Rekor 16 podium raihan Rossi pada musim 2003, 2005 dan 2008 ingin dilewati Lorenzo yang sudah menggenggam 13 podium dari 15 seri. (ap/h09)

WASPADA Sabtu 16 Oktober 2010

LONDON (Waspada): Calon pemilik baru Liverpool John W Henry (foto), berjanji membuang George Gillet dan Tom Hicks dari jajaran pemegang saham Si Merah. “Kami punya kontrak yang menjanjikan. Akan terus berjuang melawan usaha HicksGillet untuk bertahan di klub,” tekad Henry lewat akun Twitter, seperti dilansir Team Talk, Jumat (15/10). Henry melalui perusahannya New England Sports Ventures (NESV) jadi kandidat terkuat, setelah permohonan GilletHicks ditolak Pengadilan Tinggi London, yang membolehkan penjualan The Reds. Hicks coba mencegah pembelian NESV dengan mendaftarkan Mill Financial sebagai pihak yang membayar utang mereka di The Royal Bank of

Scotland. Kedua pemilik asal Amerika Serikat itu berutang £280 juta. Belum ada keputusan apakah pendaftaran Mill Financial akan disetujui. “(Itu) jadi usaha terakhir mereka untuk mempertahankan rezim,” janji Henry. Beberapa media Inggris memprediksi, Henry jadi pemilik baru mulai Sabtu (16/10) ini. Kemarin, Henry bahkan sudah berani muncul di markas latihan Liverpool. Kuatnya prospek Henry juga telah membuat miliarder Singapura Peter Lim membatalkan penawaran untuk membeli The Pool sebesar 320 juta pound. “Tentu saja keputusan saya ini sudah bulat,” tutur Lim. “Sebab dewan kepengurusan Liverpool lebih memilih untuk menjual kepada New

England Sports Ventures (NESV ) dengan mengesampingkan semua penawaran dari pihak lain, terlepas dari manfaat penawaran mereka,” katanya lagi. PT London memang telah memutuskan untuk melanjutkan proses penjualan Si Merah dengan nilai 300 juta pound kepada NESV, yang juga memiliki tim bisbol Boston Red Sox. Lim yang memiliki kekayaan melalui perantara perdagangan bursa efek, mengaku tidak menerima balasan positif dari kubu Liverpool. “Jaminan telah saya berikan kepada mereka untuk mendatangkan pemain baru, kemudian memenuhi pembayaran semua hutang bank dan komitmen jangka panjang guna membangun klub untuk menjadi lebih kuat,” papar Lim.

AP

“Namun dewan klub dan RBS memilih untuk bungkam dan tidak berupaya mendiskusikan penawaran ini. Bahkan wakil saya menawarkan pertemuan tadi malam, juga diabaikan meskipun NESV diundang untuk menghadiri pertemuan tersebut,” katanya lagi. (h01/tt/rtr)

Rennes Perlu Tambahan Pasukan Reuters

Hasil Free Practice I Jorge Lorenzo Casey Stoner Nicky Hayden Marco Simoncelli Marco Melandri Andrea Dovizioso Valentino Rossi Colin Edwards Randy de Puniet Loris Capirossi Mika Kallio Hiroshi Aoyama Hector Barbera Alvaro Bautista Aleix Espargaro Dani Pedrosa Ben Spies

(Spanyol/Fiat Yamaha) (Australia/Ducati Marlboro) (AS/Ducati Marlboro) (Italia/Gresini Honda) (Italia/Gresini Honda) (Italia/Repsol Honda) (Italia/Yamaha) (AS/Tech 3 Yamaha) (Prancis/LCR Honda) (Italia/Rizla Suzuki) (Finlandia/Pramac Ducati) (Jepang/Interwetten Honda) (Spanyol/Aspar Ducati) (Spanyol/Suzuki) (Spanyol/Pramac Ducati) (Spanyol/Repsol Honda) (AS/Tech 3 Yamaha)

1:41.146 +0.334 detik 0.485 0.735 0.836 1.125 1.480 1.867 2.330 2.838 3.033 3.558 4.549 5.014 6.981 10.064 17.467

PARIS (Waspada): Untuk kali pertama dalam kurun waktu 40 tahun terakhir, Stade Rennes berhasil menempati urutan teratas Ligue 1 Prancis. Mereka pun berniat untuk terus mempertahankan ritme kemenangannya pada pekan kesembilan dengan bertandang ke markas Racing Lens, Minggu

Sabtu, 16 Oktober Brest vs Arles-Avignon Marseille vs AS Nancy Caen vs AS Monaco Montpellier vs Sochaux Auxerre vs Bordeaux Toulouse vs Paris SG

Minggu, 17 Oktober Racing Lens vs Rennes Lorient vs Valenciennes OGL Nice vs St-Etienne Olympique Lyon vs Lille

(17/1). Tetapi, pelatih Rennes Frederic Antonetti (foto) merasa timnya masih memerlukan tambahan pasukan pasca melego Asamoah Gyan, Jimmy Briand, Ismael Bangoura dan Moussa Sow. Terutama di garis serang, karena Rennes hanya memiliki Victor Hugo Montano sebagai satu-satunya bomber berkelas yang dibeli dari Montpellier, Agustus lalu. “Untuk bermain 38 partai hanya dengan mengandalkan seorang penyerang tunggal, sungguh tidak mungkin untuk dilanjutkan,” ucap Antonetti.

Montano sendiri terpaksa absen hingga November mendatang, karena cedera hamstring. “Di lini depan kami tidak memiliki penyerang yang sebanding,” katanya lagi melalui AP. Manajer umum Pierre Dreossi sepakat dengan Antonetti. “Kami memang membutuhkannya, tapi kami berada di puncak bukan karena keberuntungan,” beber Dreossi. “Kami mampu mendulang 18 angka dari delapan laga. Hasil ini memperlihatkan kinerja keras sebuah tim dalam dua bulan terakhir,” tambahnya. (h01/bb/afp)

AFP

Sport

WASPADA Sabtu 16 Oktober 2010

Divisi Utama Lebih Pas Untuk Gaston Cs

Taufik Hidayat tampil atraktif ketika menyingkirkan pebulutangkis China Du Pengyu. -Antara-

Taufik Top SAMARINDA (Waspada): Unggulan teratas tunggal putra Taufik Hidayat mulus menembus semifinal Indonesia Terbuka Grand Prix Gold 2010, setelah tampil top saat mengatasi pemain China Du Pengyu 21-15, 21-14. Didukung penonton yang memadati Stadion Palaran, Samarinda, Jumat (15/10), Taufik sangat meyakinkan dalam pertandingan yang berlangsung selama 43 menit tersebut. Sempat beberapa kali ketinggalan, Taufik menghasilkan enam smes dibanding lawannya yang hanya satu sebelum memenangi game pertama. Pemain peringkat lima dunia itu semakin paten saat lawannya yang menjadi unggulan ketujuh, sempat meminta medical break untukmerawatkakinyayanglecet dalam posisi tertinggal 12-16. “Dari awal saya sudah yakin bisa menang. Tadi kendalanya hanya terburu-buru sehingga banyak mati sendiri, saat netting juga sering ragu-ragu,” tutur Taufik. Pengyu pernah mengalahkan Taufik di China Super Series 2008. Pada semifinal, Sabtu (16/10) ini, Taufik akan mela-

wan Andre Kurniawan yang mengungguli pemain Pelatnas Pratama Ary Trisnanto 21-15, 21-15. “Saya menang di liga (LBI 2007), tetapi dulu pernah kalah di Kanada,” jelas Taufik, mengenai rekor pertemuannya dengan Andre yang juga pernah menghuni asrama Cipayung. Semifinal lainnya mempertemukan unggulan lima Dionysius Hayom Rumbaka dengan pemain Malaysia Daren Liew. Hayom maju dengan menyisihkan mantan pemain Pelatnas Tommy Sugiarto 2119, 14-21, 21-13, sedangkan Daren menang 21-12, 11-21, 2115 atas Alamsyah Yunus. Febe bertahan Untuk tunggal putri, satusatunya pemain Indonesia yang tersisa, Maria Febe Kusumastuti, mempertahankan harapan dengan maju ke semi-

final turnamen berhadiah 120.000 dolar AS itu. Febe mengalahkan pemain China Zhou Hui 21-17, 21-13. Pada semifinal, dia menghadapi lawan berat Ratchanok Inthanon, setelah juara dunia junior dan peraih medali emas Youth Olympic Games itu menyisihkan unggulan ketiga Tai Tzu Ying 21-18, 21-18. “Menghadapi Ratchanok, jangan mengikuti irama permainan dia. Bermain lawan dia harus cepat,” ucap Febe, yang kalah dari pemain Thailand itu pada turnamen Vietnam Challange. Di ganda campuran, pasangan Indonesia Tontowi Ahmad dan Liliyana Natsir juga melaju ke babak empat besar. Unggulan keenam itu menyisihkan ganda Malaysia Ong Jian Guo/Chong Sook Chin 21-18, 22-20. Ganda putri Greysia Polii dan Meiliana Jauhari juga menuai prestasi bagus. Unggulan pertama itu menghentikan perlawanan sesama pasangan Indonesia Gebby Ristiyani Imawan/Tiara Rosalia Nuraidah 21-12, 21-12. (h01/ant)

9 Tim Ikuti Kejurda Basket Sumut MEDAN (Waspada): Sembilan tim akan bersaing pada Kejuaraan Daerah (Kejurda) Persatuan Basket Seluruh Indonesia (Perbasi) Sumut di GOR Pradipa, Simpang Kantor Medan mulai Sabtu (16/10). Sembilan tim itu terdiri dari enam tim putra dan tiga tim putri. Tim putra diwakili Medan, Deli Serdang, Langkat, Serdang Bedagai, Asahan dan Padangsidempuan, sedangkan putri mempertemukan Medan, Binjai dan Deli Serdang

“Kejurda kali ini sekaligus menjaring pemain handal memperkuat tim basket Sumut dalam menghadapi Pekan Olahraga Wilayah (Porwil) Sumatera 2011 mendatang,” jelas Ketua Panpel Kejurda Darsen Song di Medan, kemarin. Untuk itu, lanjutnya, usia pemain dibatasi maksimal 20 tahun atau kelahiran 1990. Dikatakan, hal itu mengingat pada Porwil mendatang, pemain yang dibenarkan tampil adalah maksimal 21 tahun dan mak-

simal 22 tahun untuk PON 2012. Sebelumnya, Ketua Umum Pengprov Perbasi Sumut Mathias Huangdinata SH mengatakan, selain Kejurda KU 20, Perbasi Sumut juga segera menggelar Kejurda KU 16 dan 18 pada November mendatang, termasuk Kompetisi Divisi I. “Pada akhir November nanti, Perbasi Sumut juga dipercaya PB Perbasi Pusat menggelar Kejuaraan Nasional Liga Basket Mahasiswa,” pungkasnya. (m42)

Penghargaan Atlet Pelajar Berprestasi MEDAN (Waspada): Walikota Medan Drs H Rahudman Harahap menyerahkan penghargaan kepada atlet dan insan olahraga berprestasi di Gedung Olahraga Pesantren Ar-Raudhatul Hasanah Medan, Jumat (15/ 10). Acara yang digagas Dinas Pemuda dan Olahraga Kota Medan dalam rangka Hari Olahraga Nasional, dihadiri Kadisdiknas, Kemeneg Agama, Direktur Pesantren Drs Rasyidin Bina, Ketua KONI Medan, Pimpinan Pesantren, Pengurus Cabang Olahraga se Kota Medan dan camat. Di hadapan sekitar 600 atlet pelajar, Rahudman Harahap mengatakan, penyerahan penghargaan sebagai motivasi bagi para atlet dan insan olahraga untuk dapat terus mengasah keterampilannya. Dia pun mengungkapkan kekagumannya terhadap fasilitas olahraga Ar-Raudhatul Hasanah. “Mudah-mudahan acara ini dapat menjadi stimulus dan gerbang menuju kerjasama antara pihak pemerintah dan kalangan pesantren dalam pem-

A11

MEDAN (Waspada): Jadwal kompetisi Divisi Utama Liga Indonesia 2010/2011 dipastikan bergulir 30 Oktober mendatang. Sementara itu, skuad PSMS Medan yang awalnya akan dipersiapkan untuk Divisi Utama belum memulai persiapan. Tim yang diasuh Suharto ini masih berkutat dengan proses seleksi. Meski telah menyelesaikan seleksi tahap pertama dengan meluluskan 25 pemain, seleksi dilanjutkan dengan seleksi tahap II mulai Sabtu (16/ 10) ini. Jika dikaitkan dengan target menuju Liga Super, sangat riskan memulai dengan tim yang belum siap. Waktu dua minggu ke depan untuk mempersiapkan diri tak dipungkiri merupakan waktu yang sangat singkat. Selayaknya PSMS mendaftarkan tim yang telah ada. Tim yang diasuh Zulkarnain Pasaribu dengan kapten Harry Syahputra tentu lebih siap. Dengan persiapan lebih kurang enam bulan, skuad yang rencananya diikutsertakan di Liga Primer Indonesia (LPI) tinggal tahap pematangan. Menurut

Pengurus PSMS, Julius Raja, sebenarnya belum ada keputusan tim yang akan diikutsertakan di LPI atau Divisi Utama. “Kita (pengurus-red) belum menggelar rapat penentuan. Apakah tim asuhan Bang Zul untuk LPI atau Divisi Utama. Semuanya harus melalui persetujuan Ketua Umum,” ujar pria akrab disapa King ini di Mess Kebun Bunga, Jumat (15/10). LPI sendiri belum ada kepastian jadwal. Selain itu, kompetisi yang digagas pengusaha nasional Arifin Panigoro itu masih dalam tahap meraba alias belum ada ketentuan mengenai degradasi dan promosi. Artinya, tidak ada masalah kalau PSMS menurunkan tim yang minim persiapan. Meskipun begitu, Suharto yang ditunjuk menangani skuad baru tetap optimis. Baginya, waktu yang singkat tidak menjadi alasan tim sulit berbicara banyak. “Memang waktu sangat singkat, tapi kita akan memaksimalkannya. Pemain yang diseleksi juga banyak yang berpotensi,” ujar mantan Pelatih PSAD tersebut. (m33)

Berharap Porkot 2010 Lebih Baik MEDAN (Waspada): Gelaran ajang multi event Pekan Olahraga Kota (Porkot) Medan II 2010 yang berlangsung 1118 Desember mendatang oleh KONI Kota Medan disebut sebagai salah satu motentum kebangkitan. Atas sukses tahun lalu, Ketua Umum KONI Medan berharap event tahun ini yang juga melibatkan 21 kecamatan harus lebih baik. Hal itu dikatakan Ketua KONI Medan Drs H Zulhifzi Lubis di hadapan unsur pengurus cabang olahraga dan koordinator KONI kecamatan dalam rapat pematangan di aula KONI Sumut, Kamis (14/10) lalu. Menurut Zulhifzi, Porkot yang digelar setahun sekali ini merupakan wujud kepedulian pihaknya terhadap kemajuan olahraga di kota Medan. Artinya wadah ini dapat kita jadikan sebagai momentum pergerakan pembinaan menuju prestasi

tertinggi. “Nantinya seluruh atlet masing-masing cabor maupun masyarakat Medan yang memenuhi persyaratan dapat mengikuti pesta olahraga setahun sekali ini. Artinya, hajatan ini kita gelar bukan semata untuk atlet, tapi memang pesta akbar masyarakat Medan ini kita laksanakan untuk seluruh generasi muda yang memiliki persyaratan,” tambah Zulhifzi. Ketua Panitia Porkot Drs Eddy Sibarani memaparkan, pendaftaran event ini dibuka pada 14-30 Oktober ini. Dari data yang dihimpun, sebanyak empat kecamatan telah mengambil formulir berkas keikutsertaannya. Khusus pendaftaran, KONI telah mengarahkan Pengcab masing-masing cabor untuk menerima langsung pendaftaran sesuai kecamatan yang ada. (h09)

TC 42 Karateka Inkanas Sergai SEIRAMPAH (Waspada): 42 Karateka binaan Pengurus Cabang Institut Karate-Do Nasional Kab Serdang Bedagai mengikuti Training Center (TC) dalam rangka menghadapi Kejurda Inkanas Sumut, 30-31 Oktober mendatang di Gelanggang Remaja Jalan Sutomo Ujung, Medan. Ketua Umum Inkanas Sergai Ir M Taufik Batubara didampingi Sekretaris Edi Saputra, Humas Anwar Effendi, pelatih pembimbing Simpai Ridho, Joko Lubis dan MP Marbun disela-sela TC, Jumat (15/10) mengatakan, persiapan memiliki sasaran meraih prestasi di ber-

bagai kelas Kejurda. “42 Karateka ini merupakan hasil seleksi dari 5 dojo binaan Inkanas Sergai, yakni Dojo SMP Negeri 3 Perbaungan, SMP Negeri I Perbaungan, SMP Negeri I Sei Rampah, SMP Negeri I Serbajadi dan SMP Negeri I Kotarih,” tutur Taufik. Kelas yang akan diikuti Sergai adalah Pra pemula, Pemula, Kadet serta Junior putra dan putri. “Kami berharap dari beberapa kelas nantinya akan meraih prestasi. Untuk itu kami juga mengharapkan dukungan dan doa dari seluruh masyarakat Sergai,” tambah Simpai Ridho, Joko dan MP Marbun. (ces)

Waspada/dede

Walikota Medan Drs H Rahudman Harahap didampingi Direktur Pesantren Drs Rasyidin Bina, Jumat (15/10), menyalami para atlet pelajar yang berprestasi. binaan atlet-atlet yang akan mengharumkan nama Kota Medan,” harap Harahap. Penunjukan Pesantren ArRaudhatul Hasanah sebagai panitia pelaksana, menurut Rahudman, mempertegas bahwa pesantren yang menerapkan sistem asrama dengan segala fasilitas olahraga yang dimiliki ternyata mampu mencetak bibit-bibit unggul. Sedangkan Direktur Pesantren Drs Rasyidin Bina menga-

Problem Catur Hitam melangkah, mematikan lawannya empat langkah, bukan lima.

Jawaban di halaman A2.

takan, pemberian penghargaan oleh Walikota Medan diperuntukkan bagi seluruh atlet pelajar, baik yang mengikuti Popdasu, Pospedasu dan event lainnya. “Ar-Raudhatul Hasanah mewakili 90 persen atlet Kota Medan yang meraih juara umum pada Pospedasu IV di Pandan Tapanuli Tengah serta mewakili hampir 50 persen kontingen Sumatera Utara pada Pospenas V di Surabaya,” jelas Rasyidin. (m43/m42)

TTS TOPIK

MUSIK & FILEM

Cedera Landa Ayam Kinantan MEDAN (Waspada): Kondisi lapangan yang tidak memadai membuat sebagian pemain PSMS Medan mengalami cedera. Hal ini jugalah menjadi penyebab batalnya ujicoba melawan PSGL Gayo Lues yang direncanakan digelar di Stadion Teladan, Jumat (15/10). “Ya, banyak pemain kita mengalami cedera karena kondisi lapangan selama latihan sangat keras, sehingga ujicoba melawan PSGL terpaksa dibatalkan,” ujar Asisten Pelatih PSMS Suyono. Enam pemain Ayam Kinantan memang mengalami cedera, termasuk tiga penyerang andalan. Mereka adalah Kurniawan Dwi Yulianto, Rinaldo, Zulkarnain, Novi Hendrawan, Azwan

Kompetisi Divisi I Grup I MEDAN (Waspada): Tim Madina Medan Jaya (MMJ) lolos ke putaran kedua Kompetisi PSSI Divisi I tahun 2010. Kepastian tim besutan duet pelatih Suharto MJ dan Edy Syahputra ini didapat setelah mengalahkan Persidi Idi 2-1 dalam putaran pertama penyisihan grup IV di Stadion UNRI Pekan Baru, Riau, Jumat (15/10). Disebutkan, anak-anak MMJ memuncaki klasemen grup setelah membukukan nilai tujuh dari dua kemenangan masing masing atas PSAB 1-0 dan Persidi 2-1 serta bermain imbang 1-1 lawan Aceh Utara FC. Pesaing lainnya adalah Persas Sabang yang membukukan nilai lima dari sekali menang

Selain itu, Stadion Teladan yang semula direncanakan menjadi lokasi laga ujicoba tengah dipakai PSSI menggelar kompetisi Piala Mennegpora U16. Akibatnya, PSMS kembali memakai Stadion Kebun Bunga sebagai alternatif tempat latihan. Padahal, kondisi lapangan tersebut belum memadai karena belum selesai direnovasi. Pelatih Zulkarnaen Pasaribu sendiri tidak mau mengambil resiko dengan kondisi lapangan Stadion Kebun Bunga. Bang Zul hanya menggelar latihan ringan dengan mengasah akurasi tendangan pemain dan latihan games. Harry Syahputra cs akan kembali latihan di Kebun Bunga, Sabtu (16/10) ini. (m20)

Klasemen Grup I

atas PSAB 2-0, mengimbangi Aceh Utara 1-1 dan seri melawan Persidi 0-0. Kedua tim, MMJ dan Persas, akan bertemu di laga terakhir penyisihan grup pada Minggu (17/10) besok, namun hasilnya sudah tidak mempengaruhi langkah MMJ. “Minimal MMJ menduduki runner-up grup dan itu sudah cukup untuk lolos. Namun, kami tetap mengincar juara grup,” kata Asisten Pelatih MMJ Edy Syahputra usai pertandingan. Melawan Persidi, anak anak MMJ tampil dengan semangat tinggi. Sejak kick off, Joko Susilo cs langsung menekan pertahanan Persidi. Usaha mereka berhasil ketika Romi Agustiawan membawa MMJ unggul 1-0 di

Madina MJ Persas Sabang Aceh Utara Persidi Idi PSAB

3 3 3 3 2

210 120 030 021 002

4-2 3-1 3-3 2-3 0-3

7 5 3 2 0

menit ke-17. Persidi menyamakan kedudukan lewat kaki Muslim di menit 29 sebelum Joko Susilo menjadi pahlawan MMJ dengan mencetak gol kemenangan di menit 65. “Kita bersyukur bisa lolos dari kepungan tim-tim asal Aceh,” ujarnya. Putaran pertama kompetisi Divisi I Liga Indonesia 2010 diikuti 52 tim yang terbagi atas 12 grup di mana dua peringkat teratas setiap grup lolos ke putaran kedua. (m20)

Peringatan Haornas Di Simalungun Meriah

hirkan pemain-pemain bertalenta hebat. Di antaranya Mahruzar Nasution pernah memperkuat Persija Jakarta, Nurhadi dan Subandi direkrut Harimau Tapanuli, kiper Irfansyah mantan PSMS dan Barito Putra Banjarmasin, Petrus Barus dan lainnya. “Kini dengan dukungan finansial yang cukup, Biranta FC bertekad bangkit serta berupaya keras menjadi tim sepakbola solid dan diperhitungkan,” tekad Yose yang juga membina grup band SAGA. Menanggapi target, Yose bertekad untuk menampilkan permainan terbaik sebagai upaya meraih prestasi di kompetisi PSSI Medan. (m25) Mendatar

Menurun

1. Penyanyi dangdut yang dicap cari popularitas karena membuka aib masa lalunya dengan seorang dai kondang. 7. Penyanyi istri Bambang Soeharto yang mengaku sudah berhenti menyanyi. 8. _____ Pelangi, novel Andrea Hirata tahun 2005 yang difilemkan tahun 2008. 11. Pialanya Academy Awards. 13. Nama panggilan penyanyi Peterpan yang belum juga diadili. 14. Alat musik tradisional Indone sia terbuat dari bambu dan dibunyikan dengan cara digoyang. 17. Judul filem Hollywood tentang gladiator masa kerajaan Roma (Filem keluaran tahun 1960, 2004 dan 2010 berjudul sama). 18. Penyanyi hit Sadis yang dikabarkan akan melanjutkan pendidikan di Singapura, Februari 2011. 21. Tarian rakyat Argentina yang kemudian jadi dansa dan irama musik untuk mengiringi tari tersebut. 23. Teknik perfileman atau pembuatan filem. 24. Putra penyanyi dangdut Rhoma Irama yang juga penyanyi dangdut. 25. Instrumen perkusi Jawa dan Bali.

Lubis dan kiper Syahbani. Pemain belakang Rahmat juga belum sembut total ditambah striker asing Gaston Castano harus pergi ke Jakarta untuk urusan administrasi. “Kalaupun kita paksakan menggelar pertandingan ujicoba, hanya enam pemain yang kondisinya fit dan ini tentunya sangat beresiko,” tambah Suyono. Selama ini, skuad Ayam Kinantan memakai Stadion Teladan sebagai tempat latihan. Seperti diketahui, permukaan lapangan stadion tersebut tidak rata sehingga sangat beresiko terhadap pemain. Pada musim kemarau lalu, kondisi lapangan pun semakin keras.

Madina MJ Tembus Putaran Dua

SIMALUNGUN (Waspada): Sejarah perjalanan bangsa Indonesia membuktikan bahwa olahraga tidak hanya sebagai sarana peningkatan pola hidup sehat dan prestasi, tetapi sekaligus sebagai media perjuangan dan pemersatu bangsa. Demikian Menteri Negara Pemuda dan Olahraga (Mennegpora) Andi Malaranggeng dalam sambutan tertulisnya yang dibacakan Bupati Simalungun diwakili Plt Sekretaris Daerah Ir Mahrum Sipayung MS pada apel peringatan Hari Olahraga Nasional (Haornas) 2010 di halaman kantor bupati Pamatang Raya, Jumat (15/10). Peringatan Haornas di Simalungun sendiri berlangsung meriah setelah sebelumnya diawali senam kesegaran jasmani dan gerak jalan sehat. Kedua kegiatan ini diikuti sekitar 700an massa yang terdiri dari para pejabat dan PNS di lingkungan

Biranta FC Bertekad Bangkit MEDAN (Waspada): Biranta FC sebagai wadah pembinaan pemain muda berbakat, terus melakukan latihan intensif di lapangan Pasar 3 Mariendal 1, Kecamatan Patumbak, Deli Serdang. “Sekitar 30 pemain muda potensial mengikuti latihan rutin tiga kali seminggu. Mereka digembleng pelatih Setujuono, mantan winger PSDS era 1980an, sebagai persiapan mengikuti kompetisi antarklub Pengcab PSSI Medan,” kata Ketua Umum Biranta FC Ir Yose Rizal, Jumat (15/10. Didampingi Wakil Ketua Umum Syahrul serta Manajer Tim M Yacob, Direktur PT Jorindo Agung Medan itu mengaku, Biranta FC di era 1980-an pernah membina dan mela-

Waspada/M Hamdani Wibowo

Skuad PSMS Medan yang dilatih Zulkarnain Pasaribu dinilai lebih pantas tampil di Divisi Utama daripada Liga Primer Indonesia.

1. _______ Schwarzenneger, aktor filem Hollywood yang juga gubernur Kalifornia. 2. Yuni _____ (37 tahun), penyanyi yang kecantol Raffi Ahmad (23 tahun). 3. Rintihan ______ Perawan, judul filem yang dibintangi artis porno Amerika, mulai diputar di bioskopbioskop. 4. Action (Indonesia). 5. Ibukota Prancis acap disebut dalam judul filem-filem Hollywood. 6. Alat musik dimainkan dengan memetik dawai. 9. Penyanyi terkenal yang dikabarkan jatuh miskin tapi dibantah kakaknya, Yuni Shara. 10. Mengeluarkan filem atau album lagu. 12. Penyanyi Indonesia, juri Indonesian Idol, hadiri konferensi pers nominasi American Music Awards di Los Angeles, AS, 12 Oktober 2010. 15. Aa ____ pemilik padepokan yang terjun ke dunia musik religi. 16. Alangkah ______ Negeri Ini, judul filem garapan Deddy Mizwar, mewakili Indonesia ke ajang Academy Awards. 19. Penggemar (dari bahasa Inggris populer). 20. Instrumen string kategori kordofoni. 22. Lagu (Inggris).

Waspada/Hasuna Damanik

Sekdakab Simalungun Mahrum Sipayung didampingi Kadispora Simalungun H Zonni Waldy menyerahkan hadiah kepada pemenang lucky draw, Jumat (15/10). Pemkab Simalungun plus pelajar dan atlet setempat. Setelah senam dan jalan sehat juga diadakan undian lucky

Sudoku

draw. Hadiah utama berupa 1 unit kulkas sumbangan PT Askes Cab Pematangsiantar diraih Kapolsek Raya. (a15)

10x10

Isi kotak kosong dengan angka 0 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 5x2 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

9 4 7 1 6 5 7 2 0 9 8 2 5 9 1 2 6 6 7 3 0 5

8 4

8 6 5 1 5 4 0 2 6 0 1 3

0 6 1 7 2 6 7 1 3 4 7 0 5 1 8 4 e7

Sport

A12

WASPADA Sabtu 16 Oktober 2010

Peluang Revans Federer AP

Alonso Ragu Peluang Red Bull MARANELLO, Italia (Waspada): Juara dunia dua kali Fernando Alonso (foto) tidak menepis anggapan Red Bull Racing merupakan favorit utama peraih gelar juara dunia musim ini. Akan tetapi, driver andalan Ferrari ini mengaku bila tim yang bermarkas di Milton Keynes ini belum tentu keluar sebagai juara di akhir musim. Melalui duet Sebastian Vettel dan Mark Webber, tim berlogo banteng merah ini tampil cepat dan sementara memuncaki klasemen sementara pembalap sekaligus konstruktor. Meski sependapat, Alonso masih yakin peluangnya untuk menjadi juara dunia. Pembalap Spanyol ini bahkan meragukan kapasitas Red Bull tampil dominan pada tiga seri tersisa di Korea,

AP

Brazil dan Abu Dhabi. “Yang paling penting sekarang adalah situasi di klasemen masih memberikan peluang.

Saya harus melakukan yang terbaik karena masih ada tiga balapan lagi,� tandasnya, Jumat (15/10). (m33/kez)

SHANGHAI, China (Waspada): Roger Federer (foto) menapaki semifinal Shanghai Masters dan berpeluang membalas kekalahan dari petenis Novak Djokovic. Di perempatfinal Jumat (15/10), unggulan ketiga asal Swiss ini dengan mudah melewati hadangan petenis Swedia Robin Soderling 6-1, 6-1. Keberhasilannya menyingkirkan unggulan kelima itu membuat Federer bertemu salah satu musuh bebuyutannya, yakni Djokovic di semifinal Sabtu (16/10) ini. Djokovic, unggulan kedua, juga tak menemui hambatan berarti untuk lolos ke babak empat besar, setelah menang 6-2, 6-3 atas petenis Spanyol Guillermo Garcia-Lopez. Federer, baru mengenyam satu kekalahan sejak pertama kali bertemu Soderling pada Rogers Masters 2004, tampil impresif. Di set pembuka, mantan pemain nomor satu dunia ini terus menekan lawan dari baseline dan depan net. Alhasil, peraih 16 gelar grand slam tersebut hanya kehilangan satu game di set pembuka. Memasuki set kedua, Federer semakin di atas angin. Passing shot yang menakjubkan

serta crosscourt andalannya membuat Soderling frustrasi meladeniya. Usai meraih poin di game pembuka, FedEx melakukan dua kali break serta menuai poin saat memegang servis untuk menambah keunggulannya. Dengan demikian, Federer yang kini berada di peringkat ketiga ATP berhasil menambah

rekor kemenangannya atas Soderling. Dari total 15 pertemuan, Federer unggul 14-1. Sementara itu, Andy Murray terus melanjutkan kegemilangannya. Petenis nomor empat dunia ini melenggang ke semifinal usai menyingkirkan favorit Prancis Jo-Wilfried Tsonga 6-2, 6-2 hanya dalam kurun waktu 60 menit. Sebelum meraih tiket final, Murray harus menuntaskan perlawanan petenis Argentina Juan Monaco yang mengakhiri laju Juergen Melzer (Austria) 6-7, 7-5, 6-2. (m33/ap)

Sumatera Utara

WASPADA Sabtu 16 Oktober 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:13 12:27 12:14 12:21 12:21 12:17 12:14 12:10 12:16 12:16

‘Ashar 15:29 15:44 15:30 15:38 15:38 15:31 15:30 15:25 15:32 15:33

Magrib 18:15 18:28 18:16 18:22 18:22 18:21 18:16 18:12 18:19 18:18

‘Isya

Imsak

Shubuh Syuruq

Kota

19:24 19:36 19:25 19:31 19:31 19:29 19:25 19:21 19:27 19:26

04:44 04:58 04:45 04:53 04:52 04:47 04:45 04:40 04:47 04:47

04:54 05:08 04:55 05:03 05:02 04:57 04:55 04:50 04:57 04:57

L.Seumawe 12:19 L. Pakam 12:12 Sei Rampah12:12 Meulaboh 12:23 P.Sidimpuan12:11 P. Siantar 12:12 Balige 12:12 R. Prapat 12:08 Sabang 12:26 Pandan 12:13

06:09 06:23 06:10 06:18 06:17 06:12 06:09 06:05 06:12 06:12

Zhuhur ‘Ashar 15:37 15:29 15:28 15:40 15:25 15:27 15:27 15:23 15:44 15:27

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:21 18:15 18:14 18:25 18:14 18:14 18:14 18:11 18:27 18:16

19:29 19:23 19:22 19:34 19:23 19:23 19:23 19:20 19:36 19:25

04:51 05:43 04:43 04:55 04:41 04:42 04:42 04:39 04:58 04:43

05:01 04:53 04:53 05:05 04:51 04:52 04:52 04:49 05:08 04:53

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:13 12:14 12:24 12:17 12:14 12:20 12:09 12:19 12:12 12:11

18:16 18:17 18:25 18:20 18:16 18:22 18:11 18:21 18:15 18:14

19:24 19:25 19:34 19:28 19:25 19:31 19:20 19:30 19:24 19:22

04:43 04:45 04:56 04:47 04:45 04:52 04:39 04:50 04:42 04:42

04:53 04:55 05:06 04:57 04:55 05:02 04:49 05:00 04:52 04:52

Panyabungan 12:10 Teluk Dalam12:17 Salak 12:15 Limapuluh 12:10 Parapat 12:12 GunungTua 12:09 Sibuhuan 12:09 Lhoksukon 12:19 D.Sanggul 12:13 Kotapinang 12:07 AekKanopan 12:09

06:16 06:08 06:07 06:19 06:05 06:07 06:07 06:03 06:23 06:08

15:27 15:30 15:41 15:32 15:30 15:37 15:24 15:35 15:27 15:27

06:07 06:10 06:21 06:12 06:10 06:17 06:04 06:15 06:07 06:07

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:23 15:30 15:30 15:26 15:27 15:24 15:23 15:36 15:28 15:22 15:24

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:13 18:20 18:17 18:12 18:15 18:13 18:12 18:20 18:16 18:10 18:12

19:22 19:29 19:26 19:21 19:23 19:21 19:21 19:29 19:24 19:19 19:21

04:39 04:46 04:45 04:41 04:43 04:39 04:39 04:50 04:44 04:38 04:40

04:49 04:56 04:55 04:51 04:53 04:49 04:49 05:00 04:53 04:48 04:50

Dua Pasangan Selingkuh Dijaring Polres Binjai

KURANG NYAMAN: Sejumlah pelajar terlihat berlari menyeberang di dua ruas jalan Jalinsum, Kel.Kampung Syahmad, Lubukpakam, Kabupaten Deliserdang. Kondisi ini sangat rawan terlebih di siang hari volume kendaraan yang melintas cukup tingggi. Situasi ini memungkinkan pihak terkait membuat jembatan penyebarangan di lokasi ini. Ada beberapa jembatan penyeberangan yang terbilang mubazir akibat letaknya tidak sesuai lokasi kebutuhan para pejalan kaki, terutama bagi siswa yang pulang sekolah menggunakan jasa angkutan umum dari arah Medan Perbaungan. Foto direkam, Jumat (15/10).

BINJAI (Waspada) : Operasi Kasih Sayang yang dilancarkan aparat Polres Binjai, Jumat (15/10) kembali menjaring dua pasangan selingkuh di Rumkit (Rumah Kitik-kitik) Pantai Kenanga, Kecamatan Binjai Selatan. Mereka yang bukan suami istri tersebut digiring ke komando bersama pasangannya dan dimintai keterangan di ruangan unit PPA sekaligus diberikan pembinaan kepada pasangan yang masuh duduk di bangku sekolah agar tidak lagi keluyuran bersama pasangannya pada jam belajar. Pasangan yang masih sekolah itu, wanita duduk di bangku SMP dan pria SMA, sementara untuk pasangan lainnya petugas mengatakan, dari pada ke rumah kitik-kitik ini lebih baik cepat menikah. Kedua pasangan selingkuh itu,WG, 23, warga Dusun Bangun, Desa Telagah, Kec. Sei Bingai dengan pasangan selingkuhnya L br S, 21, warga Desa Rumah Galuh, Kec. Sei Bingai, sementara pelajar yang terjaring S, 15, pelajar kelas III SMP di Kec. Selesai dan pasangan prianya F, 17, pelajar SMA di Selesai, kedua-duanya merupakan warga Kec. Selesai. “Padahal Rumkit Pantai Kenanga di Binjai Selatan ini, Rabu (13/10) lalu, sudah digerebek polisi dan berhasil menjaring pasangan selingkuh yang bukan suami istri 6 pasang,” papar Kapolres Binjai AKBP Rina Sari Ginting melalui Kasat Reskrim AKP Ronni Bonic didampingi Kanit PPA Ipda Arnawati. (a04)

Dosen USU Tewas Gantung Diri LUBUKPAKAM (Waspada): Ir Kasmal Arifin Lubis, 51, berprofesi sebagai dosen Fakultas Pertanian USU Medan, warga Jl, Kesaktian Pancasila, Dusun III, Desa Bakaran Batu, Lubukpakam, ditemukan tewas tergantung di kamar tidurnya, Kamis(14/10) sekira pukul 19:15. Korban pertama sekali ditemukan keponakannya, Rusdiansyah, 31, yang saat itu hendak menyalakan lampu kamar tidurnya, langsung kaget melihat pamannya itu tewas tergantung. Korban ditemukan tidak mengenakan baju, hanya memakai celana panjang warna abu-abu, sedangkan kondisi kamar berantakan, di bawah kakinya terdapat kursi kayu yang diduga alat untuk naik dan leher terjerat tali tambang jenis nilon yang tergantung dibroti asbes kamar tidur yang biasanya dibuat sebagai tempat ayunan bayi. Sumber yang dihimpun, akhir-akhir ini korban sering cekcok dengan istri pertamanya akibat orangketiga, sehingga istri dan 5 anaknya meninggalkan korban sendirian di rumah tersebut. Untuk mengetahui motif secara pasti, pihak kepolisian masih melakukan penyelidikan, sedangkan keluarga korban sepakat untuk tidak dilakukan visum, petugas hanya melakukan identifikasi di TKP. (a06)

Keluarga Korban Pencabulan Kecewa Tuntutan JPU BINJAI (Waspada) : Pihak keluarga korban kasus pencabulan anak di bawah umur mengaku kecewa etrhadap tuntutan Jaksa Penuntut Umum (JPU) yang menuntut pelakunya hanya 30 bulan penjara. Sebab dinilainya tuntutan tidak sesuai dengan ketentuan UU No.23/2002 tentang perlindungan anak. Hal itu dikemukakan kuasa hukum korban, Jerman Purba SH dan Ramlan Pasaribu, SH, advokat dari Komisi Perlindungan Anak Indonesia Daerah (KPAID) Sumut didampinggi orangtua korban Ngatiman, 56, penduduk Tandem Hulu kepada wartawan, Kamis (14/10) usai mengikuti sidang di PN Binjai. Menurut Jerman Purba, tuntutan JPU Sarona idalam persidangan tidak sesuai dengan ketentuan isi dari UU No.23/2002 dan JPU terkesan memihak terdakwa AS. “Padahal pencabulan anak di bawah umur merusak masa depan korban dan pemerintah melahirkan UU perlindungan anak agar pelaku dihukum berat agar jera atas perbuatannya,“ katanya Dalam dakwaan di persidangan tersangka dijerat sesuai pasal 81/UU/23/2002 tentang perlindungan anak dengan ancaman maksimal 15 tahun penjara. Ngatiman mengakui, kasus yang menimpa anak kandungnya itu, sebenarnya sudah berlarut dan butuh perjuangan panjang. Ternyata sudah satu tahun lebih baru diproses di persidangan. Sampai ibu korban meninggal dunia akibat trauma atas kejadian perkosaan putrinya. (a03)

Bupati DS Beri Tali Kasih 320 Calhaj LUBUKPAKAM (Waspada) : Bupati Deliserdang Drs H Amri Tambunan selaku Koordinator Penyelenggaraan haji daerah menutup pelaksanaan bimbingan manasik haji bagi 320 jamaah calon haji asal Deliserdang sekaligus penepungtawaran dan pemberian bingkisan tali kasih kepada jamaah calon haji (Calhaj) di Aula Kantor Kementerian Agama Kabupaten Deliserdang di Lubukpakam, Selasa (12/10). Penutupan manasik itu dihadiri Ketua TP PKK Ny Hj Anita Amri Tambunan, Asisten I Setdakab HM Iqbal Nasution, Kaban Kesbang H Eddy Azwar, Ketua MUI H Lukmanul Hakim Siregar, Ketua IPHI H Erwin Nurdin Pelos, Camat Lubukpakam diwakili Sekcam Batara Rival Harahapdan Muspika serta sejumlah pejabat Pemkab Deliserdang. Kepala Kementerian Agama Deliserdang HM Adlin Damanik menjelaskan, pelaksanaan bimbingan manasik haji berlangsung sejak 10 hingga 12 Oktober 2010 berlangsung aman, lancar dan tertib tanpa hambatan. Jumlah jamaah calon haji dari Deliserdang seluruhnya 320 orang tergabung dalam kloterVII dan masuk Asrama Haji Pangkalan Masyhur Medan pada 17 Oktober selanjutnya pada 18 Oktober 2010 pukul 14:00 diberangkatkan ke tanah suci melaui Embarkasi BandaraPolonia Medan.DirencanakanjamaahhajiasalDeliserdang kembali ke tanah air pada 28 November 2010. (a05)

Seminar Pendidikan Dan MTQN Antar PT Didukung BINJAI (Waspada): Walikota Binjai HM Idaham mendukung pelaksanaan seminar pendidikan dan MTQN serta festival nasyid antar Perguruan Tinggi (PT) negeri dan swasta se Sumatera Utara di Kota Binjai. Hal itu dikemukannya ketika menerima pengurus Yayasan Al Islahiyah dan Ketua Sekolah Tinggi Agama Islam (STAI) Syech H Abd. Halim Hasan Al Islahiyah Drs H Yundiser dan HM Fauzi, Rabu (13/10). Ketua STAIS H Yundiser menjelaskan, STAIS H Abd.Halim Hasan Al Islahiyah Binjai dipercayakan sebagai tuan rumah pelaksanaan MTQN dan festival nasyid antar perguruan tinggi negeri dan swasta yang dijadwalkan sekitar Februari atau Maret 2011. Menurut Yundiser didampingi pengurus Yayasan HM Fauzi dan dosen STAI Islahiyah Binjai HM Yusuf, pelaksanaan MTQ dan Festifal Nasyid ini pertamakali diselenggarakan di luar Medan dan STAIS Islahiyah diberikan kepercayaan sebagai tuan rumah. (a03)

06:04 06:11 06:10 06:06 06:07 06:04 06:03 06:15 06:08 06:02 06:04

Waspada/Hotma Darwis Pasaribu

Pencemaran Sei Padang Dikecam Timbulkan Kerusakan Lingkungan T. TINGGI (Waspada): Dugaan pencemaran air Sei Padang yang dilakukan Pabrik Kelapa Sawit Kebun Pabatu PTPN IV, menimbulkan reaksi keras dari masyarakat di Kota Tebingtinggi dan Kab. Serdang Bedagai. Umumnya, masyarakat menilai perusahaan perkebunan itu hanya memikirkan keuntungan, tanpa peduli kerusakan lingkungan yang dirasakan masyarakat setempat. KetuaForumDaerahAliran Sungai (DAS) Padang Usman Effendi Sitorus, Jumat (15/10) menilaitindakanpembuangan limbah yang dilakukan PKS Kebun Pabatu, merupakan kejahatanlingkunganyangtidak bisa ditolerir. “Manajemen perusahaan itu harus diterapkan ketentuan pidana UU No.32 Tahun 2009, karena terbukti membuang limbah ke Sungai Padang. Kita dorong masyarakat mengadukan manajemen kebun itu ke pihak berwajib,” tutur anggota DPRD Sergai itu. SejumlahwargaKp.Beteng

DusunVI, Desa Bah Damar, Kec. Tebing Syahbandar, Kab. Sergai menyatakan, pembua-ngan limbah selama ini merugi-kan lingkungan mereka. Bebera-pa tahun belakangan, kata Kasi-ran, 65, air sungai sudah tak bisa lagi digunakan untuk minum dan mandi. Sedangkan habitat air sepertiikandanudang,sejaklama sudah menghilang. “Kalau baunya selalu kami cium tiap ada pembuangan,” ujar Jufri, warga lainnya. Kerugian akibat limbah itu, nyatanyatakadatimbalbalik.Kantor administrasi PKS Kebun Pabatu berjarak 300 meter dari dusun itu tak pernah menunjukkan kepedulian pada warga. Di Kota Tebingtinggi, tiga anggota Komisi III DPRD yakni Alensudin Purba, Hendra Gunawan dan Murli Purba meninjau sejumlahtitikaliranSungaiPadang dan memantau kondisi terkini pasca pencemaran. Warga yang tinggal di pinggiran sungai mengatakan kepada anggota dewan, kondisi air mulai normal sejak pagi. Sedangkan malam sebelumnya, keadaannya masih menghitam. Alensudin Purba meminta Pemko Tebingtinggi menyurati manajemen PKS Kebun Pabatu, atau bila perlu ke direksi PTPN IV agar menekan hingga titik terendah pencemaran Sungai Padang. “Manajemen Kebun Paba-

tu harus tahu air Sungai Padang ini diperlukan masyarakat Tebingtinggi,” tegas alumni Fak. Pertanian USU itu. Hendra Gunawan menyontohkan bagaimana puluhan ribu warga kota tergantung dengan pasokan air bersih dari PDAM Tirta Bulian yang airnya bersumberdariSungaiPadang.Sedangkan Murli Purba mendorong warga yang dirugikan akibat limbah PKS untuk mengajukan class action terhadap pihak perkebunan. Humas PKS Kebun Pabatu Rahmat Suhairi mengatakan, pembuangan limbah itu berasal

dari aliran parit yang sudah tidak digunakan lagi. Karena tingginya volume hujan belakangan, air limbah melimpah ke parit dan mengalir ke sungai. Ditambah, saat ini sedang dilakukan pembersihan saluran limbah. Namun, dia mengelak parit pembungan yang tak digunakan lagi itu, sebagai saluran kamuflase pabrik yang sewaktuwaktu digunakan untuk pembuangan limbah, jika aktiVitas pabrik melebihi beban. Diakuihinggakini,PKSKebun Pabatu belum memiliki Land Aplication sebagai area penam-

pungan limbah pabrik. PKS baru memiliki water treatment yang berfungsi menam-pung lim-bah pabrik dan diolah sebagai pupuk kebun pembibitan. Berdasarkan Kepmen LH No.51/Men LH/10/1995, kadar maksimal Baku Mutu Limbah Cair Industri Minyak Sawit adalah BOD 250/mg/L, COD 500/mg/L, TSS 300/mg/L, Minyak dan Lemak 30/mg/ L, Amonia Total (sbg NH-N) 20/mg/L. Sedangkan limbah maksimum 6 M3/ton produksi. (a08)

Limbah PT SP Dituding Cemari Sungai RANTAUPRAPAT (Waspada): Limbah cair berwarna hitam yang diduga berasal dari Pabrik Minyak Kelapa Sawit (PMKS) PT SP dituding mencemari sungai di Desa Sei Bomban, Kecamatan Bilah Hilir, Labuhanbatu. Saat ini, alur sungai Sei Bomban dan Sei Gelundang yang mengalir ke Sungai Bilah tidak lagi sejernih seperti dulu. Warga yang bermukim di sekitar titi panjang, Negeri Lama, Kec. Bilah Hilir, Kamis (14/10) di Negeri Lama mengaku, sudah bertahun-tahunkondisiairsungai itu tercemar limbah. Semakin hari, alur sungai yang dilintasi

limbah cair tersebut semakin berwarna kehitaman dan berbau. “Setahu kami, sejak berdirinya PMKS PT SP yang letaknya beberapakilometerdarikampung kami, sungai yang ada berwarna kehitaman dan baunya tak enak. Keadaan ini sudah berjalan beberapa tahun ini, tetapi tetap begini terus dan tidak ada perubahan,” ujar Sofyan. Warga lainnya menambahkan, belakangan diketahui sejumlah anak sekolah dasar menderitapenyakitgatal-gatal.Mereka mensinyalir bibit penyakit bersumber dari limbah cair yang diduga belum ramah lingkungan.

“Kamikhawatirkalaudibiarkan terus limbah dibuang ke sungai banyak warga yang terkena penyakit gatal-gatal,” harap warga. Sekretaris Badan Lingkungan Hidup (LH) L.Batu Ir Adlin Tanjung, Kamis (14/10) membenarkanadanyalaporan warga. Pihaknya telah menurunkan Kabid Pengawasan ke lokasi dan mengambil limbahnya. “Limbahnya masih dalam tahap pemeriksaan laboratorium dan hingga kini belum diketahui hasilnya,” kata Adlin. (a27)

Rp89 M Kenaikan P-APBD DS 2010 Disepakati LUBUKPAKAM (Waspada): Bupati Deliserdang Drs H Amri Tambunan bersama pimpinan DPRD Deliserdang sepakat menandatangani P-APBD (perubahan anggaran pendapatan dan belanja daerah) Kabupaten Deliserdang Tahun Anggaran 2010 setelah melalui pembahasan dokumen Kebijakan Umum Anggaran (KUA) sebagai dasar penyusunan PPAS (prioritas plafon anggaran sementara). Penandatanganan kesepakatan bersama oleh Bupati Deliserdang AmriTambunan sebagai pihak pertama dengan pimpinan

DPRD Deliserdang terdiri dari KetuaHjFatmawatyTakrim,Wakil Ketua H Wagirin Arman, Ruben Tarigan dan H Dwi Andi Saputra Lubis sebagai pihak kedua di Aula Cendana Kantor Bupati Deliserdang di Lubukpakam, Kamis (14/ 10) siang. Amri Tambunan menjelaskan, perubahan anggaran merupakanasumsidaridasarkebijakan peningkatan penerimaan daerah dariPAD(pendapatanaslidaerah) tahun2010sertaadanyakenaikan danaperimbangandandanabagi hasil bukan pajak (bagi hasil cukai tembakau).

Kemudian perubahan pada lain-lainpendapatandaerahyang sah seperti pengalokasian dana penguatan infrastruktur dan prasarana daerah (DPIPD) dalam perubahan APBN tahun 2010 kepada Pemkab Deliserdang yang digunakan untuk jalan, jembatan dan air minum, sesuai surat Menterikeuangan No.381/MK.7/2010. Adanya pengalokasian berupa dana percepatan pembangunan infrastruktur pendidikan (DPPIP) tahun 2010 sesuai surat MenterikeuanganNo.380/MK.7/ 2010 dan dana tambahan penghasilan guru PNSD tahun 2010

dan dana tunjangan profesi guru PNSD tahun 2010 sesuai surat Menteri keuangan No S.376/ MK.7/2010. Sejalan dengan itu, adanya perubahan kebijakan belanja daerah yang terjadi pada belanja tidak langsung dan belanja langsung. Di antaranya, pemberian tambahan penghasilan bagi guru yang belum bersertifikasi pada 2009 dan 2010 serta tunjangan profesi kepada mereka yang sudah bersertifikasi tahun 2010. Perubahan belanja pada Dinas Kesehatan dan Dinas Perindustrian dan Perdagangan untuk

sosialisasi bahaya rokok dan penertiban cukai rokok sesuai peraturan Menteri keuangan nomor 115/PMK.07/2010. Selain itu adanya program kegiatan yang tak mungkin dilaksanakan akibat adanya berbagai kendala akan diantisipasi dengan melakukan pergeseran antar program/kegiatan, antar unit kerja dan antar jenis belanja serta adanya program yang mendesak. Total keseluruhan plafon anggaran pada P-APBD DeliserdangTA 2010 diestimasi sebelum perubahan Rp1.320.132.146.200 menjadi Rp1.409.834.108.800.naik Rp89.701.962.600. (a05)

Tinjau Ulang Proyek Jalan Lingkar P. BRANDAN (Waspada): Tokoh Eksponen ‘66 DR H Achmad Zar kepada Waspada mengatakan,apayangdiharapkan masyarakat Teluk – Aru ini sudah diwujudkan jangan ada kejanggalandimasadepananak cucu kita merasa dirugikan. Tapi kita mintakan juga kesediaan Gubsu H Syamsul Arifin, SE dan Bupati Langkat NgogesaSitepumeninjauulang kembali Proyek Jalan Lingkar (PJL) di P. Brandan, Langkat sebelum diaspal hotmix serta peresmian nanti ujarnya, Rabu (6/10). Dikatakan, proyek jalan lingkar yang menghubungi dua Kecamatan Babalan dan Sei Lepan, Langkat sepanjang 5 km dari Securai – Alur Dua, dibangunnya jalan ini agar dapat mengurangi kepadatan lalu lintas dan sebagian kendaraan harus melalui jalan provinsi. Proyek yang menelan biaya ratusan miliar ini pagu dana APBN dan APBD. (c02)

Ketua FSU Sumut Doakan Calhaj BINJAI (Waspada) : Damai Negeriku, Damai Hatiku serta mendoakan calon jamaah haji Sumut asal Binjai dapat menunaikan ibadah dan menjadi haji mabrur serta sehat walafiat selama menunaikan ibadah di tanah suci. Pesan dan harapan itu disampaikan Ketua Forum Silaturahmi Ummat (FSU) Sumut Ir Suseno Arto WP ketika menyerahkan tali kasih kepada kaum duafa, anak-anak yatim dan abang-abang becak di Binjai, Jumat (15/10) di kediamannya di Jalan Pemidukan, Berngam Binjai. Acara sederhana namun khidmat itu dihadiri H Tengku Indra Bungsu, Ustadz Ibnu Haq, Harun Jupri, Riswan Rika, Azrul Pasaribu, Timin Ginting, Maljumadi dan tokoh masyarakat lainnya. KetuaYayasan Putra Binjai HT Indra Bungsu selaku Dewan Penasehat FSU mengatakan, misi dari acara ini membangun semangat peduli dan berbagi untuk saudara-saudara kita yang tidak mampu, hingga dapat mempererat jalinan silaturrahmi . (a03)

Letkol Mar Bambang Hadi Suseno

Prajurit Marinir Harus Berbaur Bangun Daerah TERJUN ke dunia militer bagi Letkol Mar Bambang Hadi Suseno merupakan pilihan hidup untuk mengabdi kepada bangsa dan negara. Meski tantangan tugas semakin berat dan kompleks, namun baginya bila dilaksanakan dengan ikhlas akan terasa ringan.

Perwiramenengahyangtelah 11 bulan menjabat sebagai Danyon Infantri-8 Marinir Tangkahan Lagan menggantikan Letkol Mar Umar Farouq itu dikenal supel bersosialisasi dengan masyarakat. Takhanyawartawanmenjadi teman sekaligus mitranya, tapi sejumlah pemuka agama, tokoh adat,pemudadanparapemimpin informal mampu ia rangkul. Ia

merasa, TNI akan menjadi lebih kuat dan disegani bila manunggal dengan rakayat. Meski sepintas tutur katanya lembut, humanis dan murah senyum,namunlulusanAkademi Angkatan Laut angkatan 39 tahun 1993 itu dikenal tegas menanamkan disiplin kepada kalangan prajurit korps baret ungu yang dipimpinnya. Pamen yang masih berusia kepala tiga dan berasal dari keluarga sederhana ini baru menerima anugerah kenaikan pangkat. Dia memiliki riwayat pendidikan di antaranya Pasilog Yonif-6,WapasiopsYonif-6, Dankima Lanmar Jakarta, Pasprograr Denma mako Kormar, Pabandaya Ops Sops Pasmar II, dan Wadan Yonif-9. Sementara riwayat pendidikan di militer, pada 1994 mengikutiDikpasis,enamtahunkemudian mengikuti Diklapa, tahun 2002 turut dalam pendidikan SalapaInfTNI-AD,setahunsetelah itu mengikuti Dikbek Matra laut,

dan terakhir Seskoal Angkatan 47 tahun 2009. Sebagai wujud rasa syukur atas kenaikan pangkat, Danyon mengundang pemuka agama, tokoh masyarakat, tokoh adat, KNPI, dan unsur pemerintah seTelukaru, Kamis (14/10). Acara sederhana yang berlangsung di lapangan tembak ini bertujuan menjalin silaturahmi sekaligus memanjatkan doa agar korps marinir yang dipimpinnya tetap dalam lindungan Tuhan Yang Maha Kuasa. Danyonmengatakan,sebagai manusia biasa ia dan segenap prajurit tak luput dari kesalahan. Karena itu, ia berharap semua pihak memberikan saran dan kritik untuk perbaikan ke depan. “Tanpa masyarakat, marinir ini tidak akan ada artinya,” ujar Bambang. Ketua KNPI Langkat Syamsul Bahri Harahap, pada silaturahim itu mengingatkan agar prajurit marinir berbaur dan ikut terlibat dalam kegiatan di tengah masya-

rakat.Marinirharusdapatmemahami kebiasaan di masyarakat sehingga dapat terjalin hubungan yang harmonis. Sutomo, selaku Pimpinan DaerahMuhammadiyahLangkat mengatakan,adaempatpilaryang harus diperhatikan dalam menciptakan kehidupan yang damai dan jauh dari permusuhan. Keempat pilar itu yang pertama, taaruf, artinya saling kenalmengenal kebiasaan di masyarakat.Kedua,tapahumatausaling memahami satu dengan yang lainnya.Ketiga,taaun,yaknisaling tolong-menolong dalam berbuat kebajikan dan keempat, takaful yaitu saling percaya mempercaya. “Kalau prinsip ini dipegang, Insya Allah kita akan hidup berdampingan dengan damai,” ujarnya. Letkol Bambang Hadi menyatakan,kritikanyangdisampaikan akan menjadi masukan berharga dengan harapan ke depan marnir menjadi prajurit yang profesional dan semakin dicintai

Waspada/Asrirrais

TANK: Usai acara silaturahim, Kamis (14/10) di lapangan tembak, Danyon Infantri-8 Marinir Tangkahan Lagan, Letkol Mar Bambang Hadi Suseno, bersama tokoh masyarakat menaiki tank ampibi mengelilingi batalyon. masyarakat. Usai acara silaturahim, Danyon memberikan kesempatan kepada para tokoh

masyarakat mengikuti latihan menembak sekaligus menaiki kendaraan tank ampibi. (a02)

B2 Kios Liar Dibangun Di Pasar Suprapto TANJUNGBALAI (Waspada) : Sekitar empat belas unit kios liar dibangun di Pasar Suprapto, Kota Tanjungbalai. Kios-kios tersebut diduga bermasalah karena biaya pembangunannya tidak dianggarkan melalui APBD. Hal ini terjadi karena terdapat kepentingan pihakpihak yang ingin mengambil keuntungan. Sekretaris Dinas Kebersihan dan PasarTanjungbalai, Nefri Siregar mengatakan, kios-kios tersebut dibangun berdasarkan rekomendasi Walikota Tanjungbalai Sutrisno Hadi, karena desakan tim Adipura, Jumat (15/10). Sejumlah pedagang secara sukarela bersedia membangun dengan dana pribadi. “Kita hanya menyediakan lahan dan segala urusan terkait pembangunan kios diserahkan kepada pedagang,” jelas Nefir. Akan tetapi, ucap Nefri, pedagang diwajibkan menandatangani surat pernyataan berisi kesepakatan untuk bersedia mengembalikan kios-kios tersebut, jika suatu saat pemerintah memintanya. Ingkar Janji Sementara sejumlah pedagang pakaian jadi lantai II mengatakan, Dinas Kebersihan dan Pasar dinilai ingkar janji, sebab hingga saat ini penjual pakaian di lantai I belum juga dipindahkan. Padahal keberadaan mereka melanggar peraturan. “Janjinya dipindahkan setelah lebaran, namun sampai sekarang mereka masih menggelar dagangannya di bawah,” ucap pedagang yang tidak ingin disebut namanya. Menanggapi hal itu, Nefri mengatakan, akhir Oktober 2010, pihaknya berupaya merelokasi pedagang pakaian di lantai I ke lantai II. “Sudah sering kami peringati, namun mereka tidak mengindahkan. Untuk itu kami akan berupaya bekerjasama Sat Pol PP untuk menertibkannya,” jelas Nefri. (crs)

Kantor Primkoppol Di Atas Saluran Air TANJUNGBALAI (Waspada) : Kantor Primer Koperasi Kepolisian (Primkoppol) Polres Tanjungbalai, dibangun di atas saluran air di Jalan Saidi Muli, Kec. Tanjungbalai Selatan. Pantauan Waspada, Kamis (14/10) selain di atas saluran air, bangunan itu posisinya tepat di persimpangan Jalan Saidi Muli dan Jenderal Sudirman. Kondisi itu dikhawatirkan menimbulkan laka lantas, sebab lokasinya padat arus lalulintas. DalamPerdaKotaTanjungbalaiNo.8Tahun2004tentangketertiban umum, pasal 8 ayat 1 menyebutkan, setiap orang atau badan dilarang mendirikan bangunan di atas tanah milik negara atau pemerintah kota, fasilitas sosial atau fasilitas umum milik pemerintah kecuali atas izin kepala daerah atau pejabat yang ditunjuk. Kepala Kantor Perizinan Terpadu Kota Tanjungbalai, Walman Girsang, mengungkapkan, belum menerima surat pengajuan izin dari instansi mana pun menyangkut izin mendirikan bangunan itu.“KemungkinankitatidakakanmengeluarkanIMBuntukbangunan itu, sebab didirikan di atas saluran air dan memakan badan jalan. Ini jelas menyalahi peraturan,” jelas Walman. Kapolres Tanjungbalai AKBP Puja Laksana dikonfirmasi melalui Bagian Humas Ipda P Sihombing, membenarkan bangunan itu milik Polres Tanjungbalai. Kata Sihombing, bangunan rencananya akan dimanfaatkan sebagai kantor Primkoppol. (a37/crs)

Bunuh Kekasih Karena Cemburu PANAI HILIR (Waspada) : Polsek Panai Hilir meringkus pelaku pembunuhan sadis terhadap seorang wanita muda yang ditemukan para pelajar sudah membusuk di kolam ikan SMPN I Sei Sanggul Berombang, Jumat (15/10). Kapolres Labuhanbatu AKBP H Roberts Kennedy melalui Kasat Reskrim AKP M Topik mengatakan, pelaku yang seorang nelayan tega membunuh pacarnya setelah bertengkar akibat dibakar api cemburu. Korban Habibah, 23, warga Dusun Dua, Desa Sei Sanggul, Kec. Panai Hilir Kab. Labuhanbatu sudah dua tahun menjalin asmara dengan tersangka Sy, 26, nelayan warga Dusun Tiga Sei Sanggul. Korban yang sudah sudah menyerahkan seluruh cintanya kepada tersangka terbakar api cemburu. Dia mendapat khabar bahwa lelaki pujaannya sudah bertunangan dengan wanita lain. Selasa (12/10) sekira pukul 17:30 korban minta jumpa pada sang kekasih di dekat kolam SMPN I Sei Sanggul. Sebab jarak rumah korban dengan lokasi pacaran hanya sekira 100 meter. Malam itu sepasang kekasih itu berjumpa. Korban menanyakan kekasihnya itu kenapa menjalin cinta wanita lain. Sepertinya habis manis sepah dibuang.Tersangkatidakmaukalahdenganucapanyangmenyudutkan dirinya. Perang mulutpun tak terelakkan. Emosi tersangka tak tertahan. Korban dihajar dan dicekik. Tubuh korban yang tidak berdaya itu kemudian diseret dan diceburkan ke dalam kolam ikan. “Takut diketahui membunuh, tersangka menusuk mayat dengan bambu dan ditancapkan ke dalam lumpur dan menutupi dengan ranting pohon sehingga mayat tidak nampak,“ papar kasat. Pada Kamis (14/10), sekira pukul 15:00, mayat korban mengapung di kolam dengan kondisi tubuh sudah rusak dan bau, sehingga saat itu pelajar yang sedang di sekolah melintasi kawasan itu melaporkan temuan mayat ke Polsek. Kapolsek Panai Hilir AKP Saad Nasutin mengatakan, setelah dilakukan penyidikan diketahui pacar korban sudah melaut menuju arah perairan Kualuh Ledong. Petugaspun melakukan pengejaran. Sekira pukul 10:00 hari ini tersangka sudah diamankan ke Polsek untuk diproses lebih lanjut. (a26)

Spesialis Dan Penadah Ranmor Diringkus RANTAUPRAPAT (Waspada) : Dua pencuri spesialis sepeda motor (curanmor) dan lima penadah beserta 8 sepeda motor hasil curian digelandang ke Mapolres Labuhanbatu. Hal itu dikatakan Kapolres L.Batu AKBP H Roberts Kennedy melalui Kasat Reskrim AKP HM Taufik melalui telefon, Jumat (15/ 10). Menurut Kasat, pengungkapan kasus curanmor yang cukup meresahkan masyarakat dan melonjak grafik kejahatan curanmor sejak lebaran.”Polres menerima laporan kehilangan sepeda motor sebanyak 20 kasus. Semua TKP berada di Rantauprapat,” ungkap Kasat. Penyidikan yang memakan waktu cukup lama akhirnya terungkap dengan diciduknya dua pelaku yang selama ini beraksi di sekitar Kota Rantauprapat. Kedua pelaku yaitu Dl alias Inan, 23, dan DMAS, 20, spesialis ranmor warga Aek Siranda Rantauprapat. Dari hasil pengembangan dan informasi dari tersangka, maka dalam tempo 24 jam petugas mengamankan8unitranmorhasilkejahatannyadenganlimapenadah. “Sepeda motor yang diamankan petugas disesuaikan dengan LP di Polres dan TKP semua berada di Rantauprapat,” papar Kasat. Adapun lima penadah yang nekad membeli sepeda motor hasil curian yakni Iwan Rifai Alam, 22, warga Jalan Ampera Aeknabara, Desinar Ritonga, 37, warga Jalan Baru Rantauprapat, Oloan Dedy Rambe, 33, warga Jalan H Adam Malik R.Prapat, Budianto, 28, warga JalanBalaiDesaR.PrapatdanSuprianto,27,wargaJalanSetiaAeknabara. (a26)

204 Calhaj Batubara Berangkat Dalam 2 Kloter LIMAPULUH (Waspada): 204 Calon jamaah haji asal Kabupaten Batubara yang berangkat ke tanah suci Makkah ditepungtawari jajaran staf Pemkab Batubara, Kamis (14/10). Menurut data di Kementerian Agama Asahan, para calon jamaah haji itu akan diberangkatkan tergabung dalam dua kloter melalui Bandara Polonia Medan.Termasuk di antaranya Bupati Batubara OK Arya Zulkarnain dan Khadijah Arya yang menurut jadwal berangkat dalam kloter terakhir. Bupati Batubara OK Arya memohon doa restu dari segenap masyarakat Batubara untuk tabah dan diberikan kesehatan dalam menjalankan setiap rukun haji dan selamat pulang kembali ketanah air. ‘’Mari kita doakan di tanah suci nantinya kabupaten yang diperjuangkan ini cepat maju dan berkembang,’’ ujar OK Arya. (a11)

Sumatera Utara

WASPADA Sabtu 16 Oktober 2010

Tabung Gas 3 Kg Meledak

4 Rumah Di Asahan Terbakar SEIKEPAYANG, Asahan (Waspada): Sebanyak 4 rumah petak di Dusun I, Desa Sijawi-jawi, Kec. Seikepayang Barat, Kab. Asahan, musnah terbakar, Jumat (15/10). Kebakaran diduga akibat ledakan tabung gas 3 kilogram dari salah satu rumah warga.Tidak ada korban jiwa dalam peristiwa itu, namun kerugian ditaksir mencapai ratusan juta rupiah. Petugas pemadam kebakaran kesulitan memadamkan api, karena lokasi kejadian berada di jalan yang sempit. Ketika mobil pemadam tiba di lokasi, api sudah mulai padam berkat upaya masyarakat. Api dipadamkan warga dengan air yang diambil dari aliran Sungai Asahan. Selain mobil pemadam kebakaran, pasukan Komunitas Siaga Bencana (Kogana)Tanjungbalai Asahan di bawah komando Ahmadin Sambas, turut membantu memadamkan api. Kapolsek Seikepayang AKP H Pardosi melalui Kanit Reskrim Aiptu E Zega ditemui Waspada di lokasi kejadian membenarkan kebakaran diduga akibat ledakan tabung gas 3 Kg di rumah pasangan suami istri Herman dan Hera. Tabung gas ukuran 3 Kg itu, langsung diamankan ke Mapolsek Seikepayanguntukpengusutanlebihlanjut.Zegajugamembenarkan tidakadakorbanjiwadalamkejadianitu,namunkerugiandiperkirakan puluhan juta rupiah. Informasi dihimpun, 4 rumah sewa yang musnah terbakar ditempati keluarga Herman alias Eman, Ibrahim alias Boim, Dedi Syahputra, dan Syahdan. Sementara rumah ditempati Syahrial dan Budi, terpaksa dirusak untuk mengantisipasi agar api tidak menjalar lebih luas. Sejumlahsaksimatamenjelaskan,kejadianbegitucepat,sehingga para penghuni rumah tidak sempat menyelamatkan barang berharga. “Tidak ada yang bisa kami selamatkan, kecuali pakaian di badan,” kata istri Syahrial, Ratna. Malah Ratna sempat meraung-raung karena saat kejadian dia sedang pengajian, sedangkan anaknya yang baru lahir ditinggal di ayunan rumah. Ratna menyangka anaknya menjadi korban kobaran api, ternyata telah diselamatkan oleh orang tua Ratna. Camat Seikepayang Barat Asmuni Sinaga didampingi Kades Sei Serindan Agussalim Sinaga mengatakan, belum mengetahui pasti penyebab kebakaran. (a37/crs)

Waspada/Rasuddin Sihotang

TERBAKAR: Sebanyak 4 rumah petak di Dusun I, Desa Sijawi-jawi, Kec. Seikepayang Barat, Kab. Asahan, musnah terbakar akibat ledakan tabung gas 3 kilogram, Jumat (15/10).

Soal Pemilukada, Golkar Labusel Bantah Intervensi PTPN 3 MEDAN (Waspada) : Jajaran pengurus DPD II Golkar Labuhanbatu Selatan (Labusel) membantah telah melakukan intervensi pihak PTPN 3 untuk pemenangan pasangan H Sudarwanto dan dr Weldy Ritonga dalam Pemilukada Labusel 27 September 2010. “Secara lembaga Golkar tidak mengintervensi PTPN 3 memenangkan calon nomor urut tiga yang diusung Partai Golkar di Pemilukada Labusel,” ujar Ketua DPD II Golkar Labusel Malady Hasibuan seusai berkoordinasi dengan pengurus DPD I Golkar

Sumut, terkait persoalan tersebut, Rabu (13/10). Ketua didampingi Syahril Siregar (Sekretaris Korda), Ir H Hefrin Harahap (Wakil Ketua), M Romadon Nasution (Ketua Depicab Soksi Labusel), Rahmadi (Ketua DPC MKGR), Fajaruddin HdanDesnandusSinulinggaserta Syamsul Rizal Pulungan (pengurus DPD Golkar Labusel). PengurusGolkarLabuselmenyayangkan adanya segelintir oknum yang menyebarluaskan isuadanyaintervensiGolkarkePTPN 3untukmemenangkanpasangan calon nomor urut tiga itu.

Di sisi lain, tidak menjadi persoalan kalau memang adanya dukungansecarapribaditerhadap calon Golkar itu. Soalnya, calon wakil bupati yang diusung dr Weldy Ritonga merupakan‘Anak Kebun’ memang dikenal sebagai karyawan PTPN 3. “Kalauadanyadukungandari para karyawan, itu memang yang diharapkan. Karena, para karyawan lebih mengenal sosok dr Weldy sebagai anak kebon yang tidak lain karyawan PTPN 3,” kata Hasibuan. Sebagai bukti tidak adanya intervensi, tambah Rizal Pulungan, ada beberapa TPS di

Belasan Siswa Terjaring Operasi Kasih Sayang perkebunan, suara pasangan ini kalah. “Harusnya, kalau ada intervensi di TPS kebun, pasti menang. Kenyataan ada beberapa TPS yang kalah,” ungkap Rizal. Terlepas dari persoalan itu, Golkar berharap dan optimis dalam Pemilukada putaran II nanti, pasangan H Sudarwanto dan drWeldy Ritonga mendapat dukungan dan suara maksimal dari warga Labusel. Bahkan pasangan yang diusung Golkar memang pantas memimpin Labusel ke depan. Soalnya,satuberasaldaribirokrasi sedangkanWeldy “Anak Kebun”. (m32)

TANJUNGBALAI (Waspada) : Enambelas siswa terjaring operasi kasih sayang saat jam belajar tengah berlangsung. Kepala Dinas Pendidikan Tanjungbalai Hj Delima, melalui PPTK Azhar dikonfirmasi Waspada mengatakan, sebagian besar siswa yang terjaring ditemukan asyik bermain di warnet yang menyediakan game online, di sekitar Jalan Anwar Idris dan Jalan Sudirman, Kota Tanjungbalai. Namun sebagian lagi tengah berkeliaran dan nongkrong di pinggir jalan, Kamis (14/10) pukul 09:00. Menurut Azhar, para pelajar kemudian digiring ke kantor untuk diberikan bimbingan dan arahan, serta membuat surat pernyataan agar tidak mengulang kembali. Selanjutnya mereka diserahkan kepada kepala sekolah masing-masing. Dikatakan Azhar, operasi merupakan program rutin Dinas Pendidikan untuk menekan angka siswa yang bolos sekolah saat jam belajar. Dalam kegiatan itu Dinas Pendidikan dibantu petugas dari Polres Tanjungbalai, Sat Pol PP, Kesbang Linmas, Depag, dan Pemuda Mitra Kamtibmas (PMK). (crs)

Golkar Dukung Pemungutan Suara Ulang

Menyaru Pembeli, Polisi Ringkus Pengedar SS

TANJUNGBALAI (Waspada): DPD Partai Golkar KotaTanjungbalai,mendukungkeputusanKPU yang menetapkan pemungutan suaraulangPemilukadadi17kelurahan pada 13 November 2010. “ Partai Golkar Tanjungbalai mendukung sepenuhnya keputusan KPU tentang penetapan jadwal pemungutan suara ulang di17kelurahan.KPUmenetapkan jadwal itu tentunya melalui kordinasi dengan pihak terkait sesuai dengan amanah amar putusan sela Mahkamah Konstitusi,” kata Sekretaris DPD Partai GolkarTanjungbalai, Faisal Fahmi, di dampingi Wakil Sekretaris Azwin S Damanik dan Wakil Ketua Muhammad Nur kepada Waspada, Jumat (15/10). Menyangkut sejumlah suara di DPRD yang menginginkan pemungutan suara ulang pada Desember 2010, Faisal menuturkan, hal itu harus dihormati dan dihargai setinggi-tingginya. “ Kawan-kawandiDPRDmungkin punya pertimbangan lain, salah satunya bisa saja agar pemungutan suara ulang di 17 kelurahan berjalan baik, maksudnya tidak lagi terjadi pelanggaran seperti Pemilukada 26 Agustus 2010

TANJUNGBALAI (Waspada) : Petugas Sat Narkoba Polres Tanjungbalai ringkus tiga pengedar shabu-shabu saat menyamar sebagai pembeli. Tersangka, BK alias A, 51, dan A alias O, 37, warga Jalan Bacang dan Jalan Salak, Lingk II, KelTanjungbalai Kota II, KecTanjungbalai Selatan, serta As alias AK, 32 warga Jalan H Maksum Pane, Kel Karya, Kec Tanjungbalai Selatan, Kota Tanjungbalai, diringkus di rumah BK, saat memberikan shabu-shabu pesanan petugas, Selasa (12/10) sekira pukul 23:30. Daritanganketigatersangka,diamankanbarangbukti,narkotika jenis shabu-shabu seberat 0,7 gram, satu set bong, satu buah mancis (korek api gas), gunting kecil, satu unit telefon genggam jenis Nokia, serta sepeda motor yang diduga digunakan untuk menjemput barang haram. Kapolres Tanjungbalai AKBP Puja Laksana, melalui Kasat Narkoba, AKP D Pinem didampingi Kabag Humas Ipda P Sihombing, membenarkan dan saat ini ketiga tersangka diperiksa intensif di Mapolres Tanjungbalai untuk keperluan pengembangan. (crs)

lalu,” jelas Faisal. Dia menegaskan, Partai Golkar yakin pemungutan suara ulangdi17kelurahanberlangsung aman, tertib dan bersih. Alasannya, Panwas Kota Tanjungbalai sudah bekerja maksimal. “ Kalau soal keamanan, Polres juga sudah terbukti sukses mengamankan Pemilukada lalu, apalagi untuk pemungutan suara ulang 13 November2010mendatang,saya yakin Polres lebih siap lagi,” kata Faisal. Hanya saja, Faisal mengaku lucu jika dana pemungutan suara ulang belum jelas alokasianya. “ Luculah, KPU Tanjungbalai sudah memutuskan jadwal pemungutan suara ulang namun sumber dananya tidak jelas. Saya rasa hal itu mustahil,” ujar Faisal. Money Politics Faisal menambahkan, pelanggaran UU Pemilu, seperti money politics, mencederai demokrasi Pemilukada Tanjungbalai 26 Agustus 2010 lalu, sehingga bermuara kepada keputusan sela MKyangmenetapkanpemungutan suara ulang di 17 kelurahan. Jadi kata Faisal, pihaknya bersosialisasi kepada masyarakat agar peristiwa serupa yang meru-

gikan rakyat tidak terulang kembali. “ Kita sampaikan kepada warga, pelanggaran Pemilukada merugikan kita sendiri,” ujar Faisal. Dan, mengenai dugaan money politics di LP Pulo Simardan yang tujuannya memenangkan pasangan calon didukung Partai Golkar, Faisal mengaku tidak tahu menahu masalah itu. “ Pelaku money politics di LP itu bukan bagian dari kita, dan kita

tidak tahu hal itu, motifnya tidak jelas, apakah merasa terpanggil untuk memenangkan pasangan calon nomor urut 1,” kata Faisal. Kendati demikian, Faisal mengaku,tindakanpelaku,secara moral merugikan pasangan Thamrin-Rolel. “ Kita hormati proses hukumnya, dan Golkar tidak pernah menghambat, tapi mendorong supaya proses hukum terus berjalan hingga tuntas,” pungkas Faisal. (a37)

Aksi Premanisme Diselidiki KISARAN (Waspada): Adanya dugaan sekelompok orang yang menghalangi aksi unjukrasa mahasiswa di DPRD membuat Polres Asahan bereaksi dengan melakukan penyelidikan. Hal itu disampaikan Kapolres Asahan AKBP J Didiek Dwi Priantono melalui Kabag Perencanaan Kompol Zulfikar saat menerima pengunjukrasa, Kamis (14/10) di Polres Asahan. Dia menyatakan hingga detik ini mereka masih menyelidiki kasus itu, karena pekan lalu, tepatnya Kamis (7/10) para mahasiswa telah membuat laporan tentang pelecehan saat berunjukrasa di gedung DPRD. “Tanpa diminta kasus itu tetap kami selidiki, jadi tidak perlu berunjukrasa di Polres, karena pintu kami selalu terbuka untuk menerima dan melayani masyarakat,” ungkap Zukfikar. Salah satu dari pendemo menyatakan, dugaan premanisme itu yang ada di balik pimpinan DPRD Asahan dan hal itu merupakan tindakan yang mencoreng wajah demokrasi di Asahan, karena dianggap menghalangi warga saat berunjukrasa dan hal itu harus mendapat perhatian serius.(csap)

PDIP Siap Menangkan Siti-Hakim TANJUNGBALAI (Waspada): PDI Perjuangan siap memenangkan pasangan CalonWalikota dan Calon Wakil Walikota Tanjungbalai Siti Mariani dan Hakim Tjoa Kian Lie, pada pemungutan suara ulang PemilukadaTanjungbalai di 17 Kelurahan pada13 November 2010 mendatang. “ DPP, DPD Sumut dan DPC sertaseluruhPACPDIPerjuangan di KotaTanjungbalai,siap memenangkan pasangan nomor urut 7 itu” tegasWakil Ketua DPD PDI PerjuanganSumutSyahrulEfendi Siregar saat peresmian Posko Pemenangan Bersama Siti-Hakim (Bersih) di Jalan Khairil Anwar, Kel. Matahalasan, Kec. Tanjungbalai Utara, Kota Tanjungbalai, Kamis (14/10) sore. Menurut Syahrul, seluruh kader dan tim pemenangan merapatkan barisan untuk berjuang mengambil hati rakyat dalam pemungutan suara ulang di 17 kelurahan. “Kita sudah koordinasi di tingkat cabang sampai ranting memutuskan memenangkan pasangan Siti-Hakim, bukan pasangan calon lain. Ini merupakan harga mati,” tegas Syahrul. Syahrul yang jugaWakil Ketua Bidang Dakwah Baitul Muslimin

Indonesia Sumut menegaskan, seluruhkadersiapmengamankan surat keputusan DPP PDIP tentang pemenangan pasangan Hj Siti Mariani dan Hakim Tjoa Kian Lie. CalonWalikota Tanjungbalai Siti Mariani dan Hakim Tjoa Kian Lie menjelaskan, sesuai amar putusan MK yang memberi kesempatan kepada seluruh calon, pasangannya menyatakan kesiapan bertarung bersih, tanpa kecurangan seperti money politics. “Kita ingin pesta demokrasi ini jujur dan bersih, serta tidak mengulang kembali pelanggaran lalu,” tutur Siti Mariani. Siti berharap, seluruh pihak terkait bersikap netral, khususnya KPU Tanjungbalai yang sampai saat ini terlihat masih menarik ulur soal penetapan tanggal pemungutan suara ulang. “Pemungutansuaraulanginimerupakan bukti adanya campur tangan pihak terkait,” ucap Siti. Demikian juga kepada Panwaslu, pemungutan suara ulang ini merupakan keteledoran dari panwas yang tidak bekerja secara maksimal, sehingga rakyat Tanjungbalai merasa dirugikan. Mengenai sosialisasi prapemungutan suara ulang, Calon WakilWalikota Hakim Tjoa Kian

Lima Pejabat Eselon III Asahan Mutasi KISARAN (Waspada): Sedikitnya Lima pejabat eselon II Pemkab Asahan dimutasikan ke tempat yang baru, hal itu dilakukan untuk peningkatan karir dan prestasi, dengan dilandasi loyalitas tinggi yang selalu diawasi, Kamis (14/10). Empat pejabat itu, Drs Muhili Lubis sebelumnya hanya seorang pegawai pada Badan Pemberdayaan Perempuan dan KB, kini diangkatmenjadiPjCamatBuntuPane,sedangkanKabidPengadaan dan Mutasi Pegawai Badan Pegawai Daerah, diduduki Muhammad Irwan Nasution, SE, menggeser Sutiono, S.Sos yang dipindah menjadi Kabid Pemberhentian dan Pensiun Pegawai. Kedudukan itu sebelumnya dijabat Ali Bahrum, namun kini dia dimutasi menjadi Kabid Energi Ketenaga Listrikan, Dinas Pertambangan dan Energi, padahal posisi itu sebelumnya dipegang Drs Temazisokhi Halawa yang sekarang hanya menjadi pegawai di dinas itu.(csap)

Tutup Karaoke M2 RANTAUAPRAPAT(Waspada) : Keteangan warga Labuhanbatu yang sedang membangun dan penuh dengan unsur religius, kembali diusik dengan keberadaan karaoke M2 yanga berada di Jalan Ambacang, Rantauprapat, Selain meresahkan warga, karaoke tersebut dalam operasionalnya tutup hingga dinihari dan terkadang tutup sampai jam 09:00, karaoke M2 tersebut tidak menyediakan musik-musik karaoke, namun menyediakan fasilitas House Musik yang sangat mengganggu masyarakat sekitar. Pemilik karaoke tersebut diduga kebal hukum diwilayah Polres Labuhanbatu, sehingga tidak heran karaoke M2 ini tidak terjamah oleh raziayang dilakukan kepolisian dan Satpol PP. “Kami berharap agar karaoke M2 di likungan kami ini segera ditutup untuk dapat memajukan Labuhanbatu yang religius dan bermartabat,” kata seorang warga. (c01) Waspada/Ist

Pasangan CalonWalikota dan CalonWakilWalikota Tanjungbalai Siti Mariani dan Hakim Tjoa Kian Lie.

Cabut SK Panitia Pantai

Lie meminta KPU memberikan kesempatan kepada para pasangan calon. “Tim sukses kita pernah diundang KPU, namun tidak menghasilkan keputusan, karena yang dibahas hanya penetapan tanggal, bukan sosialisasi,” ucap Hakim. Ditambahkannya, sampai saat ini masyarakat KotaTanjungbalai menyangka pemungutan suara ulang merupakan Pemi-

MESJIDLAMA (Waspada) : Gerakan Masyarakat Menuju Kesejahteraan Batubara (Gemkara) Desa Mesjidlama Talawi meminta Kades Mesjidlama R mencabut kembali SK pengangkatan SB sebagai ketua ke panitiaan Pantai Bunga Laut Indah untuk menghindarkan kericuhan di lapangan. Surat Gemkara Mesjidlama ditandatangani Ketua Abu Bakar LS, Sekretaris M Ali Nafiah tertanggal 14 Oktober 2010 ditujukan kepada Bupati Batubara OK Arya Zulkarnain selaku Ketua Umum Gemkara Batubara. Dia menyatakan, akibat keluarnya SK Kades tanggal 3 Maret 2010 (Ketua Samsul Bahri) tentang pengelolaan Pantai Bunga Laut Indah menimbulkan keresahan di masyarakat karena Kades tidak menjunjung azas musyawarah dan mufakat dalam mengambil keputusan. (a30)

lukadaputarankedua.“Kamipikir sosialisasi sebelum pemilihan perlu diadakan agar masyarakat mengetahui duduk masalahnya,” ucap Hakim. Kepada aparat keamanan, Hakim meminta agar arif dan bijaksana dalam menyikapi laporan-laporan kecurangan serta menindaklanjuti pelanggaran teresebut untuk menciptakan suasana kondusif. (a37/crs)

Sumatera Utara

WASPADA Sabtu 16 Oktober 2010

Pengedar Shabu Dibui KABANJAHE (Waspada): Tim Sat Narkoba PolresTanah Karo meringkus pengedar shabu-shabu sebanyak seperempat gram dan uang hasil penjualan sebanyak Rp500 ribu. Polisi mengamankan RS, 26, penduduk Pokok Nangka Medan di salah satu SPBU di Kabanjahe, Kamis (14/10). Tersangka RS memang telahlamadiintaipetugasyang sudah lama mendapat laporan di lokasi SPBU Kabanjahe ada orang yang dicurigai sebagai pengedar shabu-shabu. Dalam drama penangkapan tersangka RS, petugas mencoba menelefon untuk memesan shabu-shabu pada RS dan tersangka yang tidak curiga langsung menerima tawaran itu. Saat transaksi petugas yang menyamar langsung mengamankan RS beserta barang bukti shabu shabu. Kapolres Tanah Karo AKBP Ig Agung Prastyoko melalui Kasat Narkoba AKP Azhar membenarkan timnya telah mengamankan pengedar shabu- shabu asal Medan itu. (cmm/a17)

Montir Tewas P. SIANTAR (Waspada): Seorang montir mobil Ardiansyah, 22, warga Kelurahan Sinaksak, Kecamatan Tapian Dolok, tewas di kolong satu mobil dump truk sesudahsepedamotordikendarainya diduga terjatuh disenggol mobil dump truk dan menggilas korban. Keterangan dihimpun menyebutkan, sepeda motor Honda Supra X BK 3766 WI dikendarai korban terjatuh sesudah terjadi senggolan dengan satu unit mobil dump truk BK 8818 XT yang pengemudinya belum diketahui identitasnya dan disambut mobil dump truk hingga korban tewas di Km 5,5 jurusan Pematangsiantar-Medan, KelurahanTambun Nabolon, Kecamatan Siantar Martoba. Senggolanituterjadiketika korbanberangkatdaribengkel tempatnya bekerja di Jalan Senangin dan hendak pulang ke rumahnya di Kelurahan Sinaksak, Kecamatan Tapian Dolok. Kapolresta Pematangsiantar melalui Kasubbag Humas Iptu Altur Pasaribu, Jumat (15/10) menyebutkan, kejadian itu masih dalam penyelidikandanmobildump truk beserta sepeda motor korban sudah diamankan. (a14)

Kebersihan Siantar Barat Disorot P. SIANTAR (Waspada): WakilWalikotaPematangsiantar Koni Ismail Siregar menginstruksikan agar kebersihan tetap ditingkatkan untuk Kota Pematangsiantar, khususnya di Kecamatan Siantar Barat. Wakil Walikota menginstruksikan itu dalam arahan dan bimbingannya saat apel kebersihan di hadapan perangkat kecamatan dan kelurahan serta petugas kebersihan Kecamatan Siantar Barat di halaman kantor Badan Kepegawaian Pendidikan dan Pelatihan Pemko Pematangsiantar, Kamis (14/10). Demikian informasi dari Kabag Humas dan Protokoler Pemko Pematangsiantar Julham Situmorang, Jumat (15/10). WakilWalikota menegaskan,petugaskebersihanharus bekerja ekstra dengan istilah tiada hari libur kecuali hari besar yang mengharuskan libur. (a14)

Pramuka Bentuk Karakter LUBUK PAKAM (Waspada) : Bupati Deliserdang Drs H Amri Tambunan selaku Ketua Majelis Pembimbing Cabang (Kamabicab) GerakanPramukaDeliserdangmenegaskanperananpendidikan kepramukaan sangat penting dijadikan sebagai wadah pembentukan karakter bagi kaum muda sebagai bagian dari komponen bangsa yang sangat rentan terhadap pelbagai perubahan yang terjadi pada tata nilai dan budaya bangsa. Penegasan itu disampaikan H Amri Tambunan pada peringatan Hari Pramuka Ke 49Tahun 2010 tingkat Deliserdang di LapanganTaman Pramuka Deliserdang di Lubuk Pakam, Senin (11/10) sore. Hadir para peringatan itu Waka Mabicab/Wabup Deliserdang Kak H Zainuddin Mars,Ketua DPRD Hj Fatmawaty Takrim, Kapolres DS AKBP Pranyoto SIK beserta unsur Muspida. (a05)

Calhaj Sidimpuan Tetap Dikutip Dana Transportasi P. SIDIMPUAN (Waspada): Calon haji Kota Padangsidimpuan dikutip uang transportasi sebesar Rp 294.000 per orang. Padahal anggaran untuk transportasi Calhaj dengan total Rp 120 juta telah ditampung pada APBD tahun anggaran 2010. “Kami membayar uang transportasi PadangsidimpuanMedan pulang pergi sebesar Rp 294 ribu per orang. Panitia mengatakan anggaran untuk menyewa bus pariwisata belum ada dari Pemko,” ujar seorang Calhaj, Jumat (15/10). Menurut sumber, pembayaran Rp 294 per orang ini merupakan kesepakatan bersama para Calhaj dengan Kantor Kementerian Agama Kota Padangsidimpuan, pada pertemuan di MAN 2 kemarin. Hal ini dilakukan karena bantuan dari pemerintah tidak ada. Ditanyaapakahdiamengeta-

hui jika anggaran trasportasi Calhaj sudah ditampung di APBD 2010. Calhaj tersebut mengetahuinya setelah membaca berita di media, dimana Kabag Kersa Pemko Padangsidmpuan menyebut ada dana pembinaan dan pemberangkatan Calhaj. Ketua Fraksi Demokrat DPRD Padangsidimpuan, H Khoiruddin Nasution, menyesalkan adanya pungutan transportasi yang dibebankan kepada para calon tamu Allah. Meskipun itu merupakan kesepakatan, tapi dia menyatakan itu sebagai hal yang keterluan. “Ini sudah sangat keterlaluan. Pada APBD TA 2010 sudah jelasjelas ditampung dana trasportasi Calhaj sebesar Rp 120 juta, jadi kenapa tidak disalurkan. Pemko Padangsidimpuan kemanakan uang itu, padahal itu untuk urusan keagamaan,” katanya. Dalam waktu dekat pihaknya akan segera memanggil Pemko Padangsidimpuanuntukdimintai keterangan perihal dugaan pungutan liar bagi Calhaj ini. Karena sudah sungguh naif, anggaran

untuk urusan keagamaanpun tak disalurkan. Hal senada diutarakan anggota Fraksi Karya Bersatu DPRDPadangsidimpuan,Sopian Harahap. Menurutnya kejadian ini sudah sangat memalukan sekali, di APBD TA 2010 ditampung dana Rp 340 juta untuk pembinaandanpemberangkatan Calhaj, tapi tak disalurkan. “Sangat memalukan, dan saya nilai ini sebagai bentuk pembodohan publik. Sudah nyatanyata dana trasportasi Calhaj ditampung di APBD, tapi kenapa Calhaj masih dimintai uang. Kemudian manasik akbar juga tidak ada, dikemanakan dana pembinaan Calhaj itu,” tanyanya. Sopian meminta Pemko Padangsidimpuan untuk segera mengembalikan uang pungutan tersebut. Kemudian kucurkan dana trasportasi yang anggarannya telah diplot di APBD 2010. Setelah itu gunakan dana pembinaan haji kepada yang semestinya dan jangan ‘sembunyikan’’. Untuk diketahui, masalah pungutan bagi Calhaj ini meru-

pakan bentuk upaya kedua Pemko Padangsidimpuan untuk melakukandugaanpembodohan bagi para Calhaj dan masyarakat pada umumnya. Sebelum ini Pemko berencana tidak melakukan Manasik Akbar. Rencana itu kemudian mendapat kritikan keras dari DPRD Kota Padangsidimpuan khususnya Fraksi Demokrat dan Fraksi Karya Bersatu. Anggota dewan kemudian menytakan kesiapan diri menggalang dan mengeluarkan uang pribadi agar manasik Akbar itu terlaksana. Pemerintahan Kota Padangsidimpuan dibawah kepemimpinan Walikota Zulkarnain Nasution, dibantuWakilWalikota Maragunung Harahap, dan Sekretaris Daerah, Sarmadhan Hasibuan, kian disoroti kinerjanya karena kepemimpinan yang dianggap negatif. Seperti anggaran pembinaan dan transfortasi haji senilai Rp 340jutayangditampungdiBagian Kesejahteraan Rakyat, terkesan berusaha ‘disembunyikan’ atau ‘tidak dicairkan’. (a20)

173 Calon Jamaah Haji Sergai Berangkat 1 November SEI RAMPAH (Waspada): Bupati Sergai HT Erry Nuradi didampingiWakil Bupati H Soekirman, Dandim 0204/DS Letkol Inf Heryanto Syahputra SIP,Wakil Ketua DPRD MY Basrun menepung tawari 173 calon jamaah haji(calhaj)asalKabupatenSergai di halaman kantor Bupati di Sei Rampah, Kamis (14/10). Acara diawali pembacaan ayat suci Al Quran oleh HM Adi, SAg dan ceramah seputar perjalanan haji oleh mubaligh Al Ustadz Drs H Mahmuddin, MA, turut dihadiri yang mewakili Kapolres Sergai, mewakili Kajari Sei Rampah,Wakil Ketua TP PKK Ny Hj Marliah Soekirman, Ketua DWP Ny Hj Imas Haris Fadillah, pejabat Pemkab Sergai dan ratusan keluarga para jamaah yang akan menunaikan ibadah haji tahun ini. Calhaj Sergai yang masuk kelompok terbang 18 embarkasi bandara Polonia bergabung dengan calhaj asal Kota Tanjung Balai176orang,sebagianasalKota Medan, Kabupaten Asahan, dan akan berangkat ke tanah suci Makkah pada 1 November 2010 dan masuk asrama haji di Medan 31 Oktober 2010. Ke-173 calhaj Sergai itu terdiri dari 72 pria dan 101 wanita, sementara jemaah yang tertua adalahSaminginbinHarjoPawiro 80 tahun dari Desa Celawan Kec. Pantai Cermin dan jamaah yang termuda Nawid bin Jumirin 28 tahundariDesaUjungRambung, Kec. Pantai Cermin. Bupati Sergai HT Erry Nuradi kepada para calon jamaah yang mendapatkan kesempatan menunaikan ibadah haji tahun 2010 iniberharapdapatmemanfaatkan

Waspada/Eddi Gultom

SYAL : Bupati Sergai HT Erry Nuradi didampingi Wabup H Soekirman memakaikan syal khusus kepada dua perwakilan calon jamaah haji asal Kabupaten Sergai pada acara tepung tawar di halaman kantor Bupati di Sei Rampah, Kamis (14/10). rahmat yang diterima sebaik mungkin, melaksanakan semua ibadahsesuaiaturandanprioritasnya mulai dari rukun, wajib dan sunnat. Menurut Bupati, jumlah warga Kabupaten Sergai yang mendapatkesempatanmenunaikan rukun Islam kelima tersebut setiaptahunterusbertambahdan calhaj tahun 2010 meningkat 41 orangdibandingpadamusimhaji tahun 2009 sebanyak 132 orang. Diantara para calon jamaah haji asal Kabupaten Sergai yang berangkat menunaikan ibadah pada musim haji tahun 2010 ini yakni Wakil Ketua DPRD Sergai Drs Sayuti Nur MPd, anggota DPRD Sergai H Usman Sitorus, SAg, Ketua Al-Washliyah Sergai H Ibrahim Khalil, SPdI, Ketua

sungai masih terdapat mortirmortir peninggalan zaman penjajahan. ’’Meskipun tidak dapat dipastikan aktif, namun masyarakat tetap berharap antisipasi dan kesiagaan petugas untuk mencegah dari hal-hal yang tidak diinginisepertimeledaktiba-tiba,’’ kata Arfan, warga setempat. Kamissiangkemarin,seorang operator alat berat untuk pembangunan fondasi jembatan, kembali menemukan empat mortir berukuran 30 centimeter berdiameter 10 centimeter dalam keadaan berkarat di dasar sungai. Tim Jihandak Brimob Poldasuyangkelokasikemudianmembawanya ke markas di Medan untuk pengembangan lebih lanjut.Sebelumnya21September 2010 satu mortir juga ditemukan dalam keadaan berkarat oleh Zainal Abidin, pria yang sama . (a38)

Kampanye Abdi Karo Disambut Antusias KABANJAHE (Waspada): Kampanye Calon Bupati dan CalonWakil Bupati Karo periode 2010-2015 Kol (Purn) Abednego Sembiring dan Ir Sanusi Surbakti (Abdi Karo) selama empat hari berturut-turut sejak Minggu (10/ 10) hingga Rabu (13/10) di sejumlahkecamatandiKabupatenKaro berjalan aman, tertib dan lancar. Kampanyeyangdigelarpasangan Abdi Karo berlangsung dalamsituasiyangkondusif,meski massa yang berkampanye melibatkan puluhan kendaraan roda empat,namuntidakmengganggu arus lalulintas di sejumlah tempat yang dilalui. Berdasarkan pantauan pada kampanye, Senin (11/10) di Kabanjahe, pasangan Abdi Karo menggelar kampanye simpatik untuk menarik perhatian kepada warga agar memilih pasangan nomor urut 5 itu melalui jalur perseorangan.

Kritikan Fraksi DPRD Sebagai Motivasi LIMAPULUH (Waspada) : Sisa Lebih Perhitungan Anggaran (Silpa)Tahun 2009 sebesar Rp76,1 miliar mencapai Rp38,9 miliar atau 104,45 persendisebabkanSKPDselakupenggunaanggaran telah melakukan efisiensi selama anggaran berlangsung dan setiap penggunaan anggaran Pemkab selalu mengedepankan prinsip kehatihatian, tepat guna dan tepat hasil. ‘’Prinsip yang dicapai dalam penggunaan anggaran memberikan manfaat yang besar bagi masyarakatbaikuntukpeningkatankesejahteraan dalam memberikan pelayanan dasar secara maksimal,”tuturBupatiBatubaraOKAryaZulkarnain menjawab pemandangan umum fraksi atas LKPJ 2009 dalam Sidang Paripurna DPRD Batubara, Jumat (15/10). Terkait pertanyaan F PPP mengenai hasil penilaianBPKterhadapLKPDTahun2009tentang opini LKPD, kata OK baru diketahui saat penyampaianlaporanaudityangditerimaDPRDBatubara sesuai surat No. 404/S/XIIIV/MDN/2010. Tentang RPJMD, RPJPD dan RTRW tahunan belummenampakanpeningkatanyangsignifikan dan belum adanya rancangan tersebut. RPJMD dan RPJPD telah selesai dilaksanakan. Program pembangunan infrastruktur berupa jalan dan jembatan standard kualifikasi telah dilaksanakan sesuai spesifikasi teknis yang

ditetapkan di dalam kontrak. ‘’Kritikan maupun saran disampaikan membuat kami tergerak dan termotivasi untuk mempercepat pelaksanaan pembangunan di Batubara,’’ ujarnya. Nota Keuangan P APBD 2010 SidangparipurnayangdipimpinKetuaDPRD Batubara Selamat Arifin itu juga mengagendakan penyampaian nota pengantar Bupati Batubara tentangRanperdaP-APBD2010yangdisampaikan Bupati OK Arya Zulkarnain. P-APBD 2010 urusan wajib pemerintahan memperoleh alokasi dana sebesar Rp 264,5 miliar mengalami kenaikan sebesar Rp 50,7 miliar atau sekitar 300,3 persen. Menurut bupati, konsekuensi dari kenaikan pendapatan daerah Pemkab telah memproyeksikan belanja daerah meliputi belanja langsung dan belanja tidak langsung. Belanja daerah mengalami perubahan sebesar Rp 127,01 m menjadi Rp570,2 m dari jumlah anggaransebesarRp443,2miliarataunaiksebesar 28,65 persen. ‘’Kenaikan belanja daerah ini sebagian besar dialokasikan pada program wajib belajar pendidikan dasar sembilan tahun, pendidikannonformal.Sedangkansisanyadialokasikan pada belanja langsung meliputi proyek pembangunan dan penyesuaian pembayaran gaji dan tunjangan PNS,’’ tuturnya. (a11)

Pemerkosa Mahasiswi Ditangkap P. SIANTAR (Waspada): Sya, 19, dan AH, 19, keduanya warga Huta Susu, Kelurahan Kerasaan I, Kecamatan Pematang Bandar, Kabupaten Simalungun tersangka pemerkosa seorang mahasiswi ditangkap pihak Polsek Perdagangan Polres Simalungun. Kapolres Simalungun AKBP Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, Jumat (15/10) menyebutkan, SyadanAHditangkapdisatubengkeldiKelurahan Perdagangan, Kecamatan Bandar, Simalungun, Kamis (14/10) sore. Penangkapan terhadap Sya dan AH dilakukan sesudah korban A, 18, mahasiswi, warga Emplasmen Dolok Sinumbah, Nagori Dolok Sinumbah, Kecamatan Hutabayu Raja, Simalungun mengadukan kasus yang dialaminya ke Polsek Perdagangan, Senin (11/10) atas dugaan perkosaanyangdilakukanSyadanAHterhadapnya. Namun, saat pihak Polsek Perdagangan melakukan pemeriksaan, AH mengaku menyetubuhi korban atas dasar suka sama suka, sedang Syamemaksamenyetubuhikorban,karenakorban tidak mau disetubuhi Sya. AH menyebutkan mereka bertiga sudah lama berteman. Miliki Ganja Sementara itu, seorang remaja, JS, 17, alias

Ucok, warga Kelurahan Perdagangan II, Kecamatan Bandar, Simalungun ditangkap petugas Polsek Perdagangan Polres Simalungun dalam kasuspenganiayaan,namunbelakanganternyata pelaku justru memiliki ganja. Keterangan dihimpun, Jumat (15/10) menyebutkan, JS diketahui memiliki daun ganja ketika isisakucelananyadikeluarkandiMapolsekPerdagangan, Rabu (13/10) pukul 23:30. JSdiketahuimemilikidaunganjakeringketika pihak Polsek Perdagangan melakukan penangkapan terhadapnya karena ada yang mengadukannya tentang kasus dugaan penganiayaan. Saatdilakukanpemeriksaan,JSdiperintahkan mengeluarkan seluruh isi kantongnya. Ketika isi kantong celananya dikeluarkan, ternyata ada satu bungkus kecil yang sangat mencurigakan. Ketika bungkusan itu dibuka, ternyata isinya daun ganja seberat lebih kurang 0,3 gram. “Temuan itu selanjutnya dilaporkan pihak Polsek Perdagangan ke Sat Narkoba Polres Simalungun. Sesudah dilakukan pemeriksaan, Sat Narkoba menyita barang bukti daun ganja dari JS dan menjebloskan JS ke dalam ruang tahanan Sat Narkoba,” ujar Kapolres Simalungun AKBP Marzuki melalui Kasubbag Humas Iptu Sulaiman Simanjuntak, Jumat (15/10) (a14)

Pembangunan RSU Pangururan Rp28 M Diragukan

Polres Langkat-Brimob Koordinasi Cari Mortir STABAT (Waspada): Kasat Reskrim Polres Langkat mengaku sedang berkoordinasi dengan Tim Jihandak Brimob Poldasu terkait telah dua kali ditemukan mortir di dasar Sungai Batangserangan. ’’Kami sedang berkoordinasi, kemungkinan tim akan turun dalamwaktuyangbelumditentukan untuk mencari lebih banyak mortir yang terpendam di dasar Sungai Batangserangan di Desa Payabakung, Tanjungpura,’’ kata AKP Wahyudi, Jumat (15/10). Menurut dia, koordinasi juga dilakukan bersama pengelola proyek pembangunan Jembatan Payabakung, sebab dua kali ditemukannyamortirtersebutkarena adanya pengerjaan fondasi bangunan jembatan yang kini sedang berlangsung. Sementara masyarakat setempat juga meyakini di dasar

B3

Hal yang sama juga digelar kampanye simpatik di Berastagi dan Kecamatan Merdeka dengan mengerahkan 35 kendaraan bermotor dan mengerahkan 150 orang. Mereka bergerak dari titik kumpul di Abdi Karo Center di JalanVeteran Kabanjahe. Kemudian bergerak menuju gedung Korpri di Jalan Jamin Ginting, Berastagi dan Kecamatan Merdeka dan menuju ke Pusat Pasar Berastagi. Di Pusat Pasar Berastagi, pasangan ini disambut antusias para pedagang yang sedang menjajakan dagangannya. Selanjutnya kampanye simpatik, Rabu (13/10) di Kecamatan Simpang Empat dan Naman Teran diikuti 150 massa simpatisan. Mereka mengerahkan 35 kendaraan bermotor dan dilanjutkan kampanyesimpatikdiKecamatan Tiga Panah dan Kec.Merek. (cmm/a17)

MPC Pemuda Pancasila Sergai Syaiful Azhar, dan beberapa warga berprestasi yang mem-

bawa nama baik Sergai yang mendapat bantuan ONH dari Pemkab Sergai. (a07)

SAMOSIR (Waspada) : Pembangunan RSU Hadrianus Sinaga Pangururan senilai Rp28 miliar yang bersumber dari DIPA Depkes RI saat ini terkesanlamban.Pasalnyaberdasarkanpantauan, jumlah tenaga kerja yang dipakai sebanyak 120 orang berasal dari Pulau Jawa, sementara anggaran pembangunannya cukup besar. Sebelumnya konsultan Arkonin Jakarta kepada Waspada mengatakan, idealnya pekerja yang dibutuhkan dengan anggaran sebesar itu yakni berkisar 200-300 orang. Saat hendak ditemui, Manager Proyek dari PT Adhi Karya Tbk (Persero) Putu, Selasa (11/

10) terkait Jamsostek karyawan pekerja proyek pembangunan RSU Hadrianus Sinaga tidak berada di lokasi proyek. Salah seorangWakil Manager PT Adhi Karya Marga Sitorus mengatakan, Putu lagi di Jakarta dan karyawan proyek dimasukkan ke Jamsostek Cabang Siantar. Saat ini pelaksanaan pembangunan RSU Hadrianus Sinaga masih sebatas memasang cor dan besi. Dikhawatirkan kualitas pembangunan RSU Hadrianus diragukan karena saat ini pemasangantiangbesisudahberdiri,namunbesicincin belum melekat di tiang rangka besi. (c10)

Aceh

B4

WASPADA Sabtu 16 Oktober 2010

Usai Bersyahadat, Pasangan Muda Asal Sumut Dinikahkan Di Masjid

Konsultan Kaji RSUD Jadi BLU LHOKSEUMAWE (Waspada): Konsultan Badan Layanan Umum (BLU) bersama tim Dinas Kesehatan Provinsi Aceh mengunjungi Rumah Sakit Umum Daerah (RSUD) Cut Meutia. Rumah sakit itu dipersiapkan untuk meningkatkan pelayanan kepada masyarakat melalui perubahan status menjadi BLU. Direktur Rumah Sakit Umum Daerah Cut Meutia, Dr T Muhayatsyah kepada Waspada, Jumat (15/10) menjelaskan, BLU lebih mandiri dalam memberi pelayanan kepada masyarakat. Kunjungan konsultan dari Jakarta bersama tim Dinkes provinsi ke Lhokseumawe sehari sebelumnya, untuk memberikan penjelasan tentang peningkatan statu rumah sakit daerah. Konsultan yang juga Direktur Utama RSUD Karawang, Dr.Hanna Permana Subanegara MARS melakukan pertemuan langsung dengan tim dari RSUD. Untuk melangkah menjadi BLU, rumah sakit Cut Meutia perlu melalukan beberapa persiapan. Diantaranya, dukungan pemerintah daerah, stakeholder dan staf rumah sakit sendiri. Dengan perubahan status RSUD menjadi BLU akan memberikan kesempatan kepada manajemen rumah sakit untuk mengelola pelayanan secara professional. Sehingga masyarakat bisa mendapatkan penanganan medis lebih baik melalui BLU.(b17)

BIREUEN (Waspada): Agus Supriadi bin Sugiman, 27, asal Kampung Baru, Medan dengan pasangannya Veronica Simajuntak Antonius, 26, warga Lingkungan Kelurahan Perdamaean, Medan, Sumatera Utara, Jumat (15/10) mengucapkan dua kalimah syahadat di Masjid Agung, Bireuen. Pensyahadatan keduanya dituntun Tgk Imum Syiek Masjid Agung Tgk H M Ishaq, alias Abon, lalu dinikahkan secara Islam di masjid itu oleh Kepala Kantor KUA Kota Juang DRS Tgk Zulkifli. Keterangan dihimpun Waspada kemarin, pasangan itu awalnya pernah menikah di Medan di sebuah tempat ibadah agama lain, namun pasangan pria tidak mengetahui kalau dia selama ini beragama Islam telah dinikahkan oleh keluarga pasangan wanita secara non muslim. Padahal dia telah mengajak pasangan wanitanya untuk menikah secara Islam. “Saat itu dia (pasangan laki-laki-red) mengira kalau dirinya saat itu akan dipertemukan dengan para marga si wanita, namun rupanya dia dinikahkan dengan pasangannya secara non muslim di sebuah tempat ibadah,” kata Ridwan warga Kommes, Kota Juang, kabupaten setempat, abang ipar Agus Supriadi yang dibenarkannya. Merasa janggal dan baru diketahui kemudian dia telah dinikahkan bukan dengan secara Islam, Agus Supriadi, menghubungi Ridwan abang iparnya itu dan menceritakannya kronologis yang dialaminya, lalu minta kepada Ridwan untuk menjembataninya serta memasilitasinya untuk datang ke Aceh dan minta dia dengan pasangan wanitanya disyahadatkan dan dinikahkan secara Islam. (amh)

Walikota Sabang: Fungsi Kehumasan Harus Lancar SABANG (Waspada): Walikota Sabang mengatakan, fungsi kehumasan harus berjalan sesuai dengan tuntutan perkembangan zaman. Sebagai Publik Relation, harus mampu memberikan pelayanan informasi kepada masyarakat dengan cepat, akurat dan aktual. Demikian pula sebaiknya, perkembangan informasi yang berkembang dalam masyarakat harus segera direspon, kata Walikota Sabang diwakili Kepala Dinas Perhubungan, Komunikasi dan Informatika Kota Sabang Derryansyah Kandou, SE pada acara pembukaan pertemuan Bakohumas Kota Sabang di Aula Dishubkominfo Sabang, Jumat (15/10). Kepala Bidang Pelayanan Media Informasi dan Komunikasi Dishubkominfo Sabang selaku Panitia Pelaksana, T. Zakaria Al Bahri dalam laporannya mengatakan, jumlah peserta 50 orang terdiri dari unsur humas diinstansi pemerintah, BMUN, BUMD, unsur pers dan LSM.(b29)

Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:20

11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta

13:25

12:20 AK 306 Kuala Lumpur *

FireFly

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

‘Selamatkan Islam Ya Allah…’ Waspada/Abdul Mukthi

Pasangan muda asal Sumut saat ijab kabul di Masjid Agung Bireuen.

Polisi Tangkap Penyebar SMS Fitnah Irwandi Yusuf BANDA ACEH (Waspada): Aparat Polresta Banda Aceh menangkap seorang pria yang yang diduga pelaku penyebar luas SMS (Short Massage Service) berisi fitnah dan pencemaran nama baik Gubernur Aceh IrwandiYusuf. Pria berinisial HA, warga Gampong Lambheu, Kec. Darul Imarah, Aceh Besar itu ditangkap di rumahnya, Kamis (14/10) siang. Menjawab pertanyaan wartawan usai menjenguk pelaku yang sedang menjalani pemeriksaan di Ruang Satreskrim Polresta Banda Aceh Kamis petang, Gubernur IrwandiYusuf mengatakan, SMS yang telah mencemarkan nama baiknya itu telah beredar sejak seminggu lalu. “Dalam SMS itu disebutkan saya telah meniduri perempuan lain termasuk istri teman sendiri. Pelaku juga menuduh saya melakukan korupsi,” kata Irwandi yang petang itu mengenakan stelan jas warna gelap dan kemeja warna putih. Menurut Irwandi, pengirim SMS menggunakan nomor handphone yang berbeda-beda. “Dia juga mengirim pesan berisi seruan kepada warga Pidie dan Pidie Jaya agar menghentikan mobil saya saat melintas di daerah itu. Selain itu menyerukan agar membunuh dan memba-

kar mobil saya. Dia mengatakan kalau saya menekan PNS di jajaran Pemerintahan Aceh,” sebutnya mengutip SMS yang diduga disebarkan pelaku. Irwandi juga menyebutkan, selain kepada sejumlah tokoh Aceh yang ada di Aceh, pelaku juga mengirimkan SMS bernada fitnah dan pencemaran nama baik dirinya itu kepada sejumlah tokoh Aceh di luar Aceh, termasuk sejumlah ulama. “SMS juga dikirim kepada mantan Gubernur Aceh Abdullah Puteh, Taf Haikal dan sejumlah tokoh lain,” sambung Irwandi yang mengaku melacak keberadaan pelaku terpaksa bergadang dua malam dengan fasilitas canggih. “Hasilnya saya dan staf berhasil mengetahui setelah memancing dengan mengirim SMS: ‘Apakah Anda Teman Gub? Pelaku langsung membalas dengan menyebutkan kata-kata yang tidak pantas untuk saya,” jelas Irwandi didampingi Kapolresta Banda Aceh Kombes Pol Drs Armensyah Thay. Setelah mengetahui keberadaan pelaku, Irwandi langsung melapor ke polisi untuk ditindaklanjuti. “Saya belum tahu motifnya. Bisa jadi pelakunya akan bertambah lagi,” ungkap Irwandi seraya me-

nambahkan, pelaku sempat merusak barang bukti berupa handphone yang digunakan untuk mengirim pesan singkat itu. “Namun karena pesannya sudah ada, jadi tidak ada masalah lagi,” pungkas Irwandi. Sementara, Kapolresta Banda Aceh Kombes Pol Armensyah Thay yang ditemui di tempat yang sama mengatakan, pihaknya akan terus menyelidiki motif pesan fitnah dan pencemaran nama Gubernur Aceh itu. Sedangkan HA sendiri yang ditemui Waspada di ruang pemeriksaan Satreskrim Polresta Banda Aceh menyatakan, dirinya tidak pernah melakukan hal yang dituduhkan terhadap dirinya itu. “Saya adalah orang yang teraniaya sejak di BPKS, yang dilakukan oleh orang-orang gubernur.Akudianggapsebagaiorangyang berbahaya yang harus disingkirkan dari BPKS,” kata HA, mantan pegawai Badan Pengelola Kawasan Sabang (BPKS). HA mengaku, dirinya mengetahui hal itu karena pernah dipanggil Ruslan, kepala BPKS beberapa waktu lalu dan menceritakan kalau dia diminta gubernur memberhentikan HA dari BPKS karena telah menghina pribadi gubernur melalui jejaring sosial facebook.(b09/gto)

AKHIR-akhir ini Provinsi Aceh telah digoyang dan diguncang aliran sesat yang disebarkan oleh kaum yahudi. Anehnya, aliran sesat yang diberi nama Millata Abraham berhasil mengajak segelintir umat Islam masuk dan mengikuti ajaran sesat itu dalam beberapa bulan terakhir. Padahal, semua orang tahu, umat Islam di Aceh, paling susah untuk disesatkan. Faktor apa yang membuat segelintir umat Islam di Aceh lemah? Menurut Drs. Tengku. Ikhwansyah, MA, Khatib Jumat (15/10) di Masjid Baiturrahman Kota Lhokseumawe di hadapan para jamaah mengatakan, ada tiga faktor yang membuat umat Islam di Aceh menjadi lemah: Pertama faktor ekonomi. Pemerintah belum mampu menciptakan kemakmuran bagi rakyatnya. Masyarakat yang miskin sangat mudah menerima sesuatu hal yang baru ditambah diiming-imingi uang. Banyak umat Islam di Aceh yang kaya raya, miliki uang miliaran rupiah di ATM, dan bahkan ada diantara mereka telah naik haji hingga puluhan kali. Namun, dominan mereka tega melihat fakir-miskin hidup kelaparan. Seharusnya, jatah naik haji 10 kali, dikurangi menjadi lima, dan jatah lima lainnya dalam bentuk uang disumbangkan kepada masyarakat miskin. “Cara seperti ini dijamin mampu menyatukan umat Islam. Umat Islam yang bersatu akan kokoh dan tidak akan mudah diterpa aliran sesat apa pun,” kata Drs. Ikwansyah. Yang kedua, faktor intelijen luar negeri yang telah berhasil menyusup ke tengah-tengah umat Islam. Faktor ini masih menjadi dugaan. Para intelijen ini berhasil memanfaatkan kesempatan dan kelemahan umat Islam di Indonesia. Indonesia merupakan negara satu-satunya di dunia ini yang memiliki jumlah penduduk beragama Islam terbesar di dunia. Indonesia pun dikenal dengan sumber daya alam (SDA). Ketiga, faktor pendidikan. Pendidikan memiliki peran penting menjaga umat dari kesesatan. Betapa tidak, umat islam dengan pendidikan yang rendah menjadi target utama para penyebar aliran sesat. Pendidikan formal di Sekolah Dasar (SD), SMP, dan SMA bahkan perguruan tinggi belum cukup kuat untuk menjaga umat islam dari kesesatan, jika belum dibarengi dengan ilmu pengetahuan agama. “Anak-anak harus diberikan pemahaman agama yang kuat. SD, SMP dan SMA tidak akan mampu menjamin anak-anak anda dari kesesatan. Antarkan anak-anak anda ke pesantren agar umat Islam di Aceh tak bernasib sama dengan Islam di Kardova, Spanyol. Jangan sampai, Serambi Mekah jadi Serambi Itali. Nauzubillah…Selamatkan Islam Ya Allah…” ucap Drs. Tengku Ikhwansyah, MA. Maimun Asnawi, SH.I

Aceh Terbuka Untuk Investasi PEMERINTAH Aceh memberi peluang investasi bagi siapa saja yang mau menanamkan modalnya di provinsi itu. Peluang itu diberikan untuk meningkatkan iklim investasi di Bumi Serambi Mekkah. “Peluang ini banyak dilirik investor dari berbagai negara. Bahkan tidak sedikit yang mendatangi kesepakatan bersama dengan pemerintah Aceh,” kata Gubernur Aceh Irwandi Yusuf. Menggaet investasi merupakan upaya pemerintah Aceh mengejar ketertinggalannya. Konflik yang melanda dalam

rentang waktu 1976 hingga 2005, telah memperburuk perekonomian masyarakat. Kini, Pemerintah Aceh sedang giat-giatnya membangun. Sumber daya alam Aceh membutuhkan sentuhan investasi. Banyak potensi sumber daya itu belum dikelola optimal. “Karena itu, pembangunan di Provinsi Aceh harus didukung berbagai pihak, termasuk masyarakat internasional. Investasi merupakan langkah mengoptimalkan sumber daya alam tersebut,” kata Irwandi. Membangun Aceh dengan

Gubernur Minta Media Dukung Pembangunan Aceh GUBERNUR Irwandi Yusuf meminta dukungan media dan para jurnalis untuk bersamasama membangun Aceh. Selaku gubernur dia juga akan membenahi aparatur pemerintah terutama Polisi Syariah agar tidak ada lagi kabar buruk tentang penerapan syariat dan dukungan masyarakat Aceh pada isu-isu gender. “Dicambuk di hadapan dua tiga orang itu juga sudah umum namanya, mengapa harus di hadapan orang banyak,” kata

Irwandi belum lama ini usai menghadiri rapat persiapan Aceh Investment Sumit yang direncanakan berlangsung pertengahan November 2010 mendatang. Menurut gubernur, Aceh akan semakin terpuruk dengan pemberitaan buruk soal penerapan syariat, meski Irwandi maklum dengan pekerjaan wartawan yang harus menyampaikan kabar apa adanya kepada publik. Namun Gubernur Aceh itu

berharap media juga mendukung pembangunan Aceh, terutama membangun kabar baik tentang investasi pada sektor pariwisata serta investasi tambang dan industri. Contoh kecil kabar baik itu kata Irwandi, adalah kunjungan George Soros ke Sabang beberapa waktu lalu. Kabar pelaku bisnis dan keuangan dunia itu berkunjung ke Aceh itu membawa dampak besar dengan banyaknya kunjungan wisatawan manca negara ke Aceh.

Pemerintah Aceh dan Negara Bagian Pulau Penang Malaysia menjalin kerjasama dalam bidang Parawisata, Langkah tersebut dilakukan untuk memajukan Industri Pariwisata kedua wilayah. Tampak Gubernur Irwandi Yusuf menyaksikan proses penandatanganan kesepakatan kerjasama tersebut. Foto Badan Investasi dan Promosi Aceh.

mengandalkan anggaran pemerintah tentu membutuhkan waktu lama. Dan ini pun belum tentu mampu membangkitkan perekonomian masyarakat. Iklim investasi yang sehat akan memberi dampak positif bagi masyarakat. Lapangan kerja terbuka lebar, usaha kecil dan menengah (UKM) juga akan berkembang. Interaksi antara investasi dan UKM tidak bisa dipisahkan. Kedua sektor ini saling mendukung. Karena itulah pemerintah Aceh berupaya menarik sebanyak mungkin investor, baik asing maupun dalam negeri. “Banyak potensi investasi yang bisa dikembangkan. Potensi ini semakin diminati investor. Apalagi, kondisi di Provinsi Aceh, semakin kondusif,” sebut Gubernur. Data Badan Investasi dan Promosi Aceh sampai Agustus 2010 menyebutkan ada 71

perusahaan investasi sudah mendapat surat persetujuan untuk menanamkan modalnya di Provinsi Aceh. Tak hanya itu, tidak kurang dari 10 negara besar di dunia sudah berkomitmen menanamkan investasinya di Aceh. Di antaranya Malaysia, Korea, China dan India, serta beberapa negara di Eropa. Diperkirakan nilai investasi itu mencapai 1,908 miliar dolar Amerika Serikat. Ini angka yang fantastis untuk sebuah provinsi yang baru bangkit dari keterpurukan akibat konflik dan bencana tsunami 26 Desember 2004. “Jika tidak ada halangan, pemerintah Aceh akan mendapat kewenangan bisa mengeluarkan perizinan kerja sama dengan pihak luar negeri. Jadi, proses kerja samanya bisa langsung dilakukan antara pemerintah Aceh atau pengusaha di Aceh dengan investor asing,” sebut Gubernur.

Foto Badan Investasi dan Promosi Aceh

Gubernur Pemerintah Aceh, Irwandi Yusuf bersama Ketua Menteri Pulau Penang, Malaysia Lim Guan Eng memberi penjelasan media Malaysia terkait kerjasama antara Aceh dan Pulau Penang.

Membangun Ekonomi Aceh Dengan Investasi PEMERINTAH Aceh terus berupaya menumbuhkan ekonomi dengan menggaet investasi, baik dalam maupun luar negeri. Upaya itu dilakukan dengan memfokuskan pengembangan ekonomi berkelanjutan serta menciptakan iklim bisnis yang mendukung dan kompetitif. Sektor-sektor investasi Aceh yang ada saat ini layak jual dan menjanjikan memberi keuntungan besar. Sektor yang menjadi fokus pengembangan, yakni pariwisata, perhubungan, perdagangan dan pertanian. Mengapa pembangunan ekonomi Aceh harus dikembangkan? Secara tradisi, Aceh memiliki kekuatan pada sektor pertanian, perdagangan dan jasa, yang menyediakan banyak lapangan kerja serta memiliki daya saing tinggi. Fokusnya, mata pemerintah Aceh melirik sektor nonminyak dan gas tak lain kecenderungan menurunnya peranan minyak dan gas sebagai sumber keuangan. Kejayaan Aceh dari hasil bumi berupa minyak dan gas kian memudar seiring akan berakhirnya kontrak kerja. Bahwa harus diakui, selama ini Aceh terkendala dengan ren-

dahnya kemampuan sumber daya manusia, minimnya teknologi, terbatasnya ketersediaan infrastruktur dan masih rendahnya kualitas pelayanan jasa. Di awal kepemimpinannya, Gubernur Aceh Irwandi Yusuf pernah berujar iklim investasi di Aceh tidak bisa berkembang dengan baik karena minimnya sarana dan prasarana pendukung, seperti pelabuhan dan jalur transportasi dan ketersedian listrik. Sumber daya listrik menjadi penghambat investasi karena pasokannya masih tergantung dari provinsi lain, “Pada akhir 2012 pemenuhan listrik akan dipenuhi.” kata Kepala Aceh Badan Promosi dan Investasi Aceh, Anwar Muhammad. Begitupun empat investor sudah memastikan diri akan menanamkan modalnya di Provinsi Aceh, “Dua dari empat investor dari luar negeri dan mereka akan bekerja sama dengan perusahaan lokal dan memulai investasi pada tahun 2010,” katanya. Investor itu, salah satunya perusahaan dari China yang bergerak di bidang perikanan yaitu penangkapan ikan di perairan Aceh Besar dan Sabang.

Perusahaan juga memastikan akan mendirikan industri pengolahan ikan. Ikan olahan itu, selain dipasarkan di dalam negeri, produk tersebut juga dijadikan barang ekspor. Selain perusahaan China, sebuah perusahaan yang berpusat di Mumbai, India “ABG Grup” yang beroperasi di beberapa negara bagian India dalam pertemuan pada April 2010, dua direktur ABG Grup yakni Direktur ABG Shipyard Ltd dan ABG Cement Ltd menyampaikan minatnya untuk berinvestasi di Indonesia khususnya di Provinsi Aceh. Nilai Investasi dua perusahan ini senilai Rp4 triliun meliputi penyedian listrik atau membangun pembangkit listrik, pembangunan pelabuhan serta pembangunan pabrik semen. Sementara investor dari Korea akan mengimplementasikan program kerjasama investasi untuk mengembangkan Kota Sabang meliputi pembangunan pelabuhan Sabang untuk industri dan perdagangan dengan melengkapi pelabuhan itu dengan berbagai fasilitas pendukung. Selain itu, investor Korea

juga akan membangun fasilitas pariwisata seperti resort termasuk fasilitas hiburan untuk menunjang industri pariwisata. Hal lain yang dibangun adalah berbagai fasilitas untuk menunjang kawasan pertumbuhan pada sektor perikanan, selain itu juga akan dibangun fasilitas teknologi komunikasi. Berbicara soal investasi di Aceh, maupun Indonesia bukanlah hal mudah, seperti membalikkan telapak tangan. Banyak masalah klasik masih menghambat iklim investasi tersebut. Lingkungan bisnis yang sehat diperlukan tidak hanya untuk menarik penanam modal dari dalam dan luar negeri, tetapi juga agar perusahan yang sudah ada tetap memilih lokasi di Aceh. “Investasi di negara kita masih berkutat dengan masalahmasalah klasik, meliputi infrastruktur, birokrasi, iklim usaha dan perpajakan,” kata Ketua Dewan Pertimbangan KADIN Indonesia Suryo Bambang Sulisto. Masalah-masalah itu harus dibenahi, sehingga tidak menjadi penghambat iklim investasi, mengingat potensinya cukup menjanjikan. Apalagi masih ba-

Anwar Muhammad nyak potensi sumber daya alam di Aceh yang belum tergarap. Selain masalah klasik, terhambatnya investasi juga disebabkan faktor infrastruktur yang belum memadai. Oleh karena itu, pemerintah harus memprioritaskan pembangunan infrastruktur yang menjadi penunjang utama investasi. Begitu juga jaminan lainnya, pemerintah juga harus mampu memberikan kepastian hukum bagi investor untuk menjamin agar modal yang ditanamkan tidak terbuang percuma. Kini, pemerintah Aceh terus membidik berbagai peluang invetasi tersebut, hingga Aceh menjadi pintu utama perdagangan global di ujung barat Indonesia. (adv)

Agenda

WASPADA Sabtu 16 Oktober 2010

07.30 Disney Clubhouse 08.30 Weekend Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Film Keluarga 15.00 Cek & Ricek 16.00 Bedah Rumah 17.00 Seputar Indonesia 17.30 Who Wants To Be Millionaire 18.00 Putri Yang Ditukar 19.30 Kemilau Cinta Kamila 21.15 Kemilau Mandiri Fiesta 22.15 BOM : Kiss Of Dragon 02.00 Seputar Indonesia Malam

CATATAN

07.30 Inbox 09.30 Hot Shot 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV 14.00 SCTV FTV 14.30 Status Selebritis 15.00 Get Married The Series 16.00 SCTV FTV 17.00 Liputan 6 Petang 17.30 Uya Emang Kuya 18.00 Islam KTP 19.00 Taxi 20.30 Cinta Fitri 22.00 20 Wajah Indonesia 01.00 Liputan 6 Malam

07.00 Layar Pagi 08.30 Santapan Nusantara 09.30 Layar Spesial 11.00 Jendela 11.30 Sidik Kasus 12.00 Layar Kemilau 13.30 Layar Special 15.00 Cerita Sore 16.30 Lintas 5 17.00 Zona Juara 18.00 Animasi Spesial 19.30 Upin & Ipin 20.30 Sinema Utama 22.00 Cerita Pilihan 23.00 Sinema Malam 01.00 Layar Tengah Malam

07.00 Curious George 08.00 Peroro The Little Pinguin 09.00 Hidup Sehat Dengan Ekstrak Herbal 10.30 Forum Kita 11.00 Cantik 12.00 Klik! 15.00 Topik Petang 15.30 Mantap 17.00 Wayang On Stage 18.30 Super Family 21.00 Penghuni Terakhir 22.00 The Partners 00.00 Topik Malam 00.30 Makmur

07.00 The Price Is Right 08.00 The Chef Indonesia 09.00 Bango Cita Rasa Nusantara 09.30 KiSS Plus 10.00 Arti Sahabat 12.00 Indonesia Got Talent 13.00 Happy Song 14.00 Beningnya Cinta 15.00 Fokus 16.30 He Is Beautiful 17.00 Arti Sahabat 18.00The Price Is Right Celebrity 19.00 Indonesia Got Talent 20.00 Gila Gilaan 21.00 Gebyar BCA 22.00 Miss USA 2010 00.00 Sinema Malam

07:05 Editorial Media Indonesia 08:05 Agung Sedayu 09:05 Indonesia Now 09:30 Fashion Galery 10:30 Metro Xin Wen 11:05 OprahWinfrey Show 13:05 Spirit Football 13:30 Expedition 15:05 Provocative Proactive 16:05 Supernanny 16.30 Distroyed In Seconds 17:05 Metro Hari Ini 18.30 Metro Highlights 19.05 Metro Files 20.05 Exposed 21.05 Top Nine News 21.30 The Best Five Film Eagle Award 20052009 22.05 World Cinema 23.30 Metro Sports

B7 07.30 Kuliner Pilihan 08.00 Gula Gula 08.30 Koper dan Ransel 09.00 Ceriwis 10.00 Ala Chef 10.30 Benu Buloe 12.30 Ngulik 13.00 Peppy The Xplorer 13.30 Belajar Indonesia 14.00 The Camp 14.30 Kenari 15.00 Hidup Kedua 15.30 Sahabat JP 16.00 Gaul Bareng Bule 17.00 Reportase Investigasi 18.15 Termehek-Mehek 19.00 IMB bersama Supermi 22.00 Bioskop TRANS TV 24.00 Bioskop TRANS TV

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Goliath Band Kian Berkibar MELANSIR album secara penuh, ternyata membawa berkah tersendiri bagi Goliath band. Kini, band dipunggawai Ary (vokal), Rizal dan Dara (gitar), Ardy (kibor), Izwa (bas) dan Gie (drum) ini, kian eksis dan berkibar di blantika musik nasional. Buktinya, sukses melambungkan dua singel sebelumnya yakni Masih Disini Masih Denganmu (MD2) dan Cinta Monyet, kini band asal Sukabumi – Jawa Barat ini meluncurkan single hits Tinggal Seribu. “Strategi melansir album secara full atau penuh membawa berkah tersendiri bagi kami sebagai band pendatang baru. Goliath selalu siap bersaing di industri musik nasional dengan terus-menerus berkibar dan menarik perhatian penikmat musik pop lewat singel-singel andalan yang diluncurkan secara bertahap,” papar Ary, pentolan Goliath band kepada Waspada di Score – Citos Jakarta Selatan, baru-baru ini. Ditemui selepas pelun-

BURSA

PERABOT

curan singel ketiga dikemas dalam konsep fun party bernuansa Bajak Laut, vokalis produktif bernama panjang Ary Irawan Gendrayana ini menambahkan, pergeseran cara penjualan lagu atau album rekaman dari konvensional menjadi virtual dengan mengunduh atau download dan bentuk Ring Back Tone (RBT), tak mengharuskan sebuah band melansir album secara penuh. “Tapi, mengadu keberuntungan di kancah musik industri tanpa didukung album secara penuh, terlalu banyak resikonya. Karenanya, sebelum menem-bus dapur rekaman dan bergabung dengan Falcon musik - kami berenam sepa-kat mematangkan karya musik kami dalam format album penuh, bukan mini album atau singel. Hasilnya, karir bermusik kami mulai menuai buah manis. Baik berupa materi maupun popularitas,” terang frontman band bentukan 7 Februari 2009 yang sudah memiliki 70 ribu

BURSA

PELUANG BISNIS

SPESIALIS REPERASI KURSI

Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto) TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

BURSA

MATERIAL ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

R

GALVANIS

EUROMESH

R

BAJA U-50

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Ingin Promosikan Produk Anda Harian

MBAK ALIN HUB. 0813.7739.9508

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

ATI BERSEDIA DIPANGGIL HUB. 0821.6623.7957

Ingin Promosikan Produk Anda

Harian

PIJAT LULUR MBAK WINA

WASPADA Media yang Tepat

PUSAT PENGOBATAN SPESIAL ALAT VITAL

BPK. HARYONO

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

(Untuk reumatik & asam urat)

untuk Iklan Anda

Pengobatan Alat Vital H. Suhendar

Pengobatan Alat Vital H. Suhendar

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

Untuk keluhan dan pengaduan silahkan hubungi langsung:

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan

DITANGANI LANGSUNG

Mahar Rp. 500 ribu

ASLI DARI BANTEN

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Hub: (061) 7365429 - 7362887

Video Musik Michael Jackson Diluncur Dalam Bentuk DVD

Michael Jackson/rtr

Seluruh hasil rekaman video musik Michael Jackson akan diluncurkan dalam bentuk DVD

untuk pertama kali, termasuk video singelnya yang dirilis pada 2003 “One More Chance”. Reuters melaporkan label Epic/Legacy Recordings, Rabu (13/10), menyatakan ketiga set DVD mengenai 40 video mencakup karir penyanyi itu sebagai artis solo. DVD tersebut, diberi nama “Michael Jackson`s Vision”, akan diluncurkan pada 22 November. Rangkaian itu meliputi versi penuh video musik Thriller, video disutradarai Martin Scorsese Bad, Black and White dan karya yang lebih tak jelas termasuk kolaborasi penyanyi pop tersebut jarang terlihat Ghosts, dengan efek khusus tokoh legendaris Stan Winston. Peluncuran video itu adalah produk mutakhir akan disahkan label rekaman Michael Jackson. Kegiatan tersebut adalah kelanjutan dari gladi konser 2009 untuk film This is it, album musik Michael yang direncanakan tapi belum diluncurkan, dan tayangan tur Cirque du Soleil. Michael Jackson (50) meninggal secara mendadak di Los Angeles pada Juni 2009. Dokter pribadinya, Dr Conrad Murray sedang menunggu hasil pengadilan dengan dakwaan secara sengaja menghilangkan nyawa orang. (ant)

Mayangsari Stop Jadi Penyanyi

Mayangsari Dalam menjalani bisnisnya itu, tak sendiri. Ia bekerjasama dengan artis Ussy Sulistyawati. (vvn)

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB

Kiki Amalia Hubungan cinta antara pesinetron Kiki Amalia dan kiper tim nasional Indonesia, Markus Horison atau Markus Haris Maulana akan berlabuh ke pelaminan. Kiki mengaku sudah mantap untuk menikah dengan pria pilihan hatinya tersebut. “Saat menerima lamarannya, aku sempat (salat) istikharah dulu. Jadi benar-benar mantapkan hati. Kemudian aku selalu mimpi

jalan sama dia. Sekarang sudah nggak sabar nih,” kata Kiki saat ditemui usai fitting gaun pengantinya di bilangan Tebet, Jakarta Selatan. Kiki mengaku ia sudah kenal lama dengan Markus. Namun, perkenalan itu sempat terputus karena kesibukan masing-masing. Tetapi, beberapa waktu lalu keduanya kembali bertemu melalui twitter. Sejak saat itu, keduanya menjadi lebih dekat lagi. Mereka memutuskan untuk serius. Kiki juga menegaskan kepada Markus jika dirinya bukan lagi mencari pacar tetapi suami. Markus tak gentar dengan penegasan dari artis yang kini juga sibuk menjadi presenter itu. “Dia malah bilang, ‘aku siap, kapan aku bisa bertemu keluarga kamu’? Kemudian habis lebaran, dia melamar Kiki di hadapan keluarga. Sebenarnya nggak menyangka, ini cowok berani banget,” ucapnya sambil tertawa bahagia. Rencananya, pernikahan akan digelar November mendatang. Kiki akan menggelar acara pernikahan di Jakarta. Ia mengaku tak akan menggelar pesta yang mewah. “Undangan cuma 250 saja. Semua teman dekat aku undang,” ujarnya.(vvn)

Milla Jovovich Mimpi Jadi Ninja JL. KLAMBIR V NO. 152 KP. LALANG MEDAN

NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

KLINIK PENGOBATAN ALAT VITAL DARI BANTEN DI TANGANI LANGSUNG BPK. ZAENAL

(izin Kejaksaan No. B.170/DSP5/12/2009) Cara terapi pengobatan di totok dibagian syarafsyarafnya dan diberikan ramuan/ jamu, mengobati segala keluhan pria/ wanita MENGOBATI PRIA Tambah besar: 4, 5, 5.5, 6 Tambah panjang: 14, 15, 16, 17, 18, 19, 20 Impotensi Ejakulasi dini, Kurang ereksi Tahan lama/ Tidak punya keturunan Hernia, Penyakit Gula Pengobatan ini Alami 100% tanpa efek samping, bebas untuk semua Agama, Tanpa pantangan (reaksi ditempat) Dpt Diperoleh di Sumatera - Aceh

07.30 Selamat Pagi 08.00 CAWAN 09.00 Cooking In Paradise 11.00 Wildlife On One 12.00 I Gosip Siang 13.00 Buku Harian Si Unyil 14.00 One Stop Football 15.30 Paradiso 16.00 Mancing Mania 16.30 Redaksi Sore 17.30 Guruku Selebritis 18.00 Wara Wiri Weekend 19.00 Misterl Tukul 20.45 Pas Mantab 21.45 Beauty And Azis 23.00 Clas Community 23.30 Kualifikasi MotoGP **m30/B

Kiki Amalia Mantap Menikahi Kiper Timnas

BURSA

KESEHATAN

KHUSUK & LULUR

07.00 Spongebob 08.00 Back At Banyard 09.00 Big Movies 11.00 Kitchen Beib 11.30 Ngidam 12.00 Kesempatan Kedua 13.00 Global Siang 13.30 Genie 14.00 Movie Special 15.30 Berita Global 17.00 Naruto 20..00 Big Movies 21.00 My Name Is Eko 22.00 Made In Indonesia 23.00 Big Movies 01.00 Global Malam 01.30 MTV Insomnia

Sejak memiliki anak, Mayangsari menghilang dari panggung musik tanah air. Mayang lebih sering terlihat dalam acara-acara pagelaran busana daripada di acara musik. Pelantun ‘Harus Malam Ini’ mengungkapkan sebenarnya ia tak mundur seratus persen dari dunia tarik suara. Sesekali ia masih tampil menyanyi.Tetapi, untuk kembali menekuni dunia nyanyi profesional, Mayang pikir-pikir lagi. “Saya tahu diri saja. Sekarang banyak penyanyi yang bagus. Saya lebih baik mengalah saja,” kata Mayang saat ditemui di Restoran Mayang Suki, Blok S, Jakarta Selatan. Jarang tampil menyanyi, bukan berarti wanita asal Purwokerto ini tak memiliki kegiatan. Ia memilih berbisnis restoran untuk mengisi waktunya disela-sela mengurus anak semata wayangnya, Siti Khirani Trihatmodjo. Ia menegaskan serius dengan bisnis yang dijalankannya tersebut. “Saya tidak mau mengerjakan setengah hati,” ucapnya.

KUSUK & LULUR

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

WASPADA Media yang Tepat untuk Iklan Anda

listening dengan lirik yang simple, cukup ampuh bagi kami untuk eksis dan berkibar di blantika musik nasional,” jelasnya. Lagu Tinggal Seribu diciptakan Ary untuk mengenang masa lalunya penuh keprihatinan dan perjuangan bersama lima personel Goliath lainnya ketika masih tinggal di pesisir Pantai Pelabuhan Ratu,

PELUANG USAHA

Hub. 0812 6446 8869 PAGAR EURO

Goliath Band lebih Golovers – sebutan penggemar fanatik Goliath band itu. Lirik Simpel Tentang singel terbaru, Ary menyatakan lagu tersebut masih mengede-pankan konsep enak dide-ngar dan lirik yang simple. “Untuk saat ini, kami belum saatnya menyuguhkan lagu-lagu bertema yang aneh-aneh. Toh, ramuan musik easy

beberapa tahun silam. “Lagunya unik dan lucu lantaran mengangkat tema tongpes kantong kempes alias bokek. Bayangkan, malam minggu di kantong tinggal seribu,” ungkapnya. Sejak merilis album November 2009 silam, lewat lagu-lagu ceria membawa pesan tentang nilai-nilai persahabatan, perjuangan, kejujuran serta tujuan hidup popularitas Goliath band cepat membumbung. Menyusul sukses besar lagu andalan “MD2” dengan omzet nada sambung pribadi melebihi 3,6 juta unduhan, singel kedua bertajuk “Cinta Monyet” menampilkan bintang klip artis Nikita Willy, dalam tempo tiga pekan langsung menempati Chart peringkat dua di provider Telkomsel dan Indosat per 15 Maret 2010 silam. Sempat unggul atas lagu Geregetan (Sherina), Dua Cincin (Hello) dan Biarkan Jatuh Cinta (ST 12). * (AgusT)

06.30 Kabar Pagi 08.30 Nuansa 1000 Pulau 09.00 Property Agung Podomoro 09.30 Keliling Indonesia 10.00 Backpacker 10.30 World Boxing Lucian Bute vs Jessebrinkley 12.00 Kabar Siang 13.00 Indonesia Grand Prix Gold Championship 2010 17.00 Tepi Jaman 17.30 Kabar PEtang 19.00 Catatan Seorang Jurnalis 20.00 Apa Kabar Indonesia Malam 21.00 Local Documentary 22.00 Documentary One 22.50 Liga Spanyol Atletico vs Getafe

Praktek menetap: Jl. Pelangi (± 100 meter dari Simpang UISU SM. Raja) No. 42 Medan HP. 0812.6350.4441

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777

MILLA Jovovich menjadi seorang pemburu zombie dalam empat film Resident Evil. Namun, dia mengaku saat masih kecil dirinya adalah seorang penggemar cerita fantasi dan dulu bermimpi menjadi seorang ninja. “Dulu saya seorang penggemar cerita fantasi tumbuh dan besar melihat Kung-Fu Theater dengan ayah saya setiap hari Minggu,” kata Jovovich, seperti dikutip dari Showbiz Spy. “Saya selalu bermimpi menjadi salah satu ninja yang melompat dari pohon ke pohon. Saya suka menantang diri saya sendiri, dan saya tidak melukai diri saya sendiri dengan ceroboh.” Aktris berusia 34 tahun itu mengawali kariernya sebagai model saat berusia 9 tahun. Tak lama kemudian dia mulai merambah dunia akting. Belum lama ini ibu seorang putri bernama Ever Gabo Anderson itu mengaku anaknya siap mengikuti jejaknya untuk terjun ke dunia hiburan. “Ibu saya mengatakan apel tidak jatuh jauh dari pohon. Putri saya yang berusia dua tahun Ever akan menjadi seorang aktris. Dia terus berkata, ‘Baik, kau menjadi Ever dan aku menjadi ibu,’ dan kami harus berimprovisasi dalam satu adegan bersama dengan dia memerankan saya,” kata istri sutradara Paul W.S Anderson.(ant)

Milla Jovovich/askmen.com

Aceh

WASPADA Sabtu 16 Oktober 2010

B5

Julok Juara Umum MTQ XXXI Aceh Timur

Waspada/Agusni AH

Kapolres Aceh Tamiang, AKBP Drs. Armia Fahmi dan Pasi Intel Yonif 111/KB Tualang Cut, Lettu Inf. Abu Hanifah saat melakukan bidik bersama di lapangan Yonif setempat, Kamis (14/14).

Polisi Dan TNI Bidik Bersama LANGSA ( Waspada): Dalam rangka antisipasi kemungkinan munculnya pelaku teroris di wilayah timur Provinsi Aceh, jajaran Polres Aceh Tamiang dan prajurit tentara dari Yonif 111/KB Tualang Cut melakukan latihan bidik bersama. Latihan menembak yang melibatkan 80 personel polisi dan 50-an anggota tentara itu dipusatkan di Lapangan Tembak Bataliyon Infantri tersebut berlangsung seharian penuh, Kamis (14/14). Danyonif 111/KB Tualang Cut, Letkol Inf. Muhammad Ali melalui Pasi Intelnya Lettu Inf. Abu hanifah kepada Waspada, mengatakan, latihan menembak bersama ini dilakukan selain sebagai upaya menciptakan ketangkasan dan kegesitan agar prajurit TNI lebih terpelihara kemampuannya dalam menunjang ilmunya sehingga mencapai titik sasaran tembak. Begitupun, latihan yang melibatkan 80 orang personel polisi dari jajaran Polres Aceh Tamiang ini juga sebagai upaya konkrit dalam rangka menghadang atau menghalau para teroris yang akhir-akhir ini kian ‘mengganas’ merongrong kewibawaan bangsa baik sifatnya tingkat daerah maupun nasional, secara nyata telah ikut mengancam institusi-institusi resmi Negara Indonesia. Dalam latihan bersama TNI dariYonif 111/ KB Tualang Cut, dengan polisi dari jajaran Polres AcehTamiang ini tampak turun langsung Kapolresnya AKBP. Drs. Armia Fahmi di‘ medan perang’ sedianya memanggul senjata laras

panjang turut serta mebidik titik sasaran tembakan. “Ini adalah medan latihan, dan ini harus dilakukan secara serius,” ujar Kapolres Aceh Tamiang, AKBP. Drs. Armia Fahmi. Kendati sekadar latihan, sebut Fahmi, namun keseriusan dengan penuh daya fisik dan mental sedianya memfokuskan pikirannya sehingga berdaya guna. Menurutnya, daya guna yang paling tinggi manakala seseorang mampu mengoptimalkan dirinya secara serius dalam menumpu titik sasaran pada satu tujuan itu sendiri. “Hal ini pula menjadikan segenap personel polisi dan prajurit TNI bisa bekerja sama tak hanya sebatas latihan semata, lebih dari itu polisi akan selalu meminta kerjasamanya dalam menangani bencana teroriseme di negeri kita,” demikian Armia Fahmi. Dalam kesempatan yang sama Pasi Intel Yonif 111/KB Tualang Cut, Lettu Inf. Abu Hanifah, mengatakan, bahwa pihaknya juga telah melaksanakan bakti sosial dan olahraga bersama. Bakti sosial dan olahraga bersama masyarakat Tualang Cut, Kabupaten Aceh Tamiang ini disebutkan sebagai bagian hubungan nyata dalam mempererat silaturrahmi. “Bakti sosial berbentuk pengecetan bangunan rumah-rumah ibadah, dan pembersihan saluran drainase ini dilakukan secara rutinitas dan berkesinambungan,” cetus Abu Hanifah. (b23)

JULOK, Aceh Timur (Waspada): Setelah mengumpulkan 85 poin dengan menempatkan 12 golongan juara I dan tujuh golongan juara II serta empat golongan juara III, sehingga Kafilah Julok, berhasil meraih juara umum. Sementara terbaik I diraih Kafilah Darul Aman dengab poin 45, dan terbaik II diraih Kafilah Peureulak Kota dengan poin 27, sedangkan terbaik III diraih Kafilah Ranto Selamat dengan poin 18. “Alhamdulillah semuanya berjalan lancar,” ujar Sekum Panpel XXXI Aceh Timur, Tgk. Amiruddin, S.Ag. Kepada Waspada, Jumat (15/10) di Julok, mengatakan, setelah terbaik III diraih Kafilah Ranto Selamat, kemudian disusul Birem Bayeun dengan

poin 17, Kafilah Nurussalam dengan poin 13, Kafilah Idi Rayeuk dan Madat dengan poin 12.“Kafilah yang menang kita harap ke depan dapat mempertahankan prestasinya,”kataTgk.Amiruddin. Lebih lanjut dia meminta, kafilah yang kalah agar ke depan dapat lebih meningkatkan prestasinya, sehingga apa yang telah diperoleh kafilah yang menang tidak mustahil di masa yang akan datang dapat diraih kafilah lain. “Bibit-bibit unggul Aceh Timur, ini, akan kita saring dan dilatih untuk mengikuti MTQ Provinsi di masa yang akan datang,” ujar Tgk. Amiruddin lagi. Kata dia, MTQ XXXI kali ini berjalan dengan baik, tanpa ada hambatan. Kendati demikian, sambung Tgk. Amiruddin, suksesnya kegiatan keisalaman

tersebut tidak hanya berkat kerjasama panitia seluruhnya, namun dukungan dan bantuan masyarakat Aceh Timur, siang dan malam yang amat besar, sehingga MTQ XXXI Aceh Timur, berjalan dengan sukses dan dapat dijadikan contoh kinerja ke depan. MTQ XXXI Aceh Timur, tahun ini digelar di dua titik dalam Kec. Julok, yakni arena utama di halaman Masjid Al Kubra Julok, dan Dayah Babul Khairi Julok. Seluruh kegiatan dalam 8 Cabang MTQ selesai tepat waktu sebagaimana rencana awal, yakni Jumat (15/10) sekira pukul 11:00. “Alhamdulillah semuanya berjalan lancar sebagaimana rencana,” tandas Tgk. Amiruddin, yang juga Kabag Keistimewaan Aceh. (cmad)

HM Yakub KS Sekdakab Aceh Singkil SINGKIL (Waspada): Perseteruan pendukung calon Sekdakab Aceh Singkil yang memanas sebulan terakhir, dengan mengusung isu kuat mengharapkan putra daerah menjadi pejabat defenitif telah terjawab dengan penetapan Drs HMYakub KS, MM. Gubernur Aceh, dr. Irwandi Yusuf melalui Surat Keputusannya No. Peg 821. 22/ 022/ 2010, tanggal 12 Oktober 2010, tentang pengangkatan Sekdakab Aceh Singkil menetapkan Drs HM Yakub KS, MM. SebelumnyaYakub KS menjabat Asisten Tata Praja Sekdakab dan Pelaksana Tugas Harian Sekdakab pasca jabatan orang nomor tiga Aceh Singkil lowong karena H. Ridwan Hasan, SH, M dipromosimenjadiAsistenAdmi-

nistrasi Setdaprov Aceh pertengahan September 2010 lalu. Drs. Yakub bersama tujuh pejabat Aceh Singkil yang mengikuti uji kepatutan dan kelayakan di kantor Gubernur Aceh, pekan ketiga September 2010 lalu, masing-masing Drs. Rahmi Syukur Kadis Sosial Tenaga Kerja dan Transmigrasi, Syamsul Bahri, SH Kepala Bapedalda, H. Nasjuddin, SH, MM Kadis Pengelola Keuangan dan Kekayaan Daerah (DPKKD). Lalu A. Aslym C, SH, Msi Kadis Budaya, Olahraga dan Pariwisata, H. Sajali, S.sos Sekretaris dewan, H Asmaudin, SE Kadis Pertanian dan Ketahanan Pangan dan Ir. Asmardin Kepala Badan Perencana Pembangunan Daerah (Bappeda).

Drs Yakub lulusan Institut Agama Islam Negeri (IAIN) Ar Raniry Banda Aceh, meniti karir pamong di Tapaktuan, Aceh Selatan sebagai juru penerangan kemudian hijrah ke Kabupaten Aceh Singkil yang dimekarkan 1999 lalu dari Aceh Selatan. Jabatan awal yang dipercayakan kepada Yakub adalah Kabag Organisasi dan Tata Laksana (Ortala), lalu Kabag Infokom dan dimutasi lagi menjadi Kabag Kepegawaian Sekdakab setempat. Kemudian dipromosi menjadi Kepala Badan Kepegawaian Daerah, seiring peleburan Kabag KepegawiandiSekdakabmenjadi Badan, dua tahun terakhir Drs. Yakub dipercaya sebagai Asisten Tatapraja Sekdakab (b30)

Empat Kandidat Bersaing Rebut Kursi Ketua DPW PAN Aceh kebutuhan “ logistik” peserta sepertinya tidak menjadi masalah. Sedangkan Posisi Anasbidin yang mantan Wakil Ketua DPRK Banda Aceh juga patut diperhitungkan bagi calon lainnya. Salah seorang kandidat, Edo, panggilan akrab Tarmidisnyah Abubakar menyatakan, aut put setelah Muswil ini yang perlu diperhatikan untuk pengembangan partai di masa mendatang. “Jadi bukan hanya soal siapa yang menjadi ketua,” katanya. Begitu pun, ia yakin bila Muswil berjalan normal, peluang dia menjadi orang nomor satu di partai PAN Aceh bukan suatu yang sulit untuk diperebutkan. Tiga Menteri Muswil 3 DPW PAN Aceh ini, kata Ketua Panitia , Muslim Aiyub , akan dihadiri tiga Menteri Kabinet Bersatu Jilid-II Pemerintahan SBY dari Partai PAN, yakni, Hatta Rajasa (Menko Perekonomian), Zulfikli Hasan (Menteri Kehutanan) dan Patrialis Akbar (Menteri Hukum dan HAM) yang ketiganya wakil dari PAN. Muslim Aiyub SH kepada pers, Kamis (14/ 10) menyatakan, Muswil PAN dibuka di hotel Hermes sedangkan siding-sidang dilakukan di Taman Budaya, Blower, Banda Aceh. Jumlah peserta sebanyak 332 orang terdiri 5 orang dari DPW PAN, masing-masing 2 orang dari setiap DPD dan cabang (kecamatan) satu orang. Selain itu, BM PAN, PUAN Provinsi masing masing 1 orang. (b06/b02)

GAMBA TANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.

Waspada/Jaka Rasyid

Gubernur Pemerintah Aceh, Irwandi Yusuf meminta penjelasan Kim JongTae (Korea) tentang proses pembangunan PLTB di Pantai Suak Bakong Kandang Aceh Selatan, tampak juga hadir Marlis Pohan, Deni Irmasyah, anggota DPRK Aceh Selatan, Kamis (14/10) siang.

Aceh Segera Bangun PLTB BANDA ACEH (Waspada): Pemerintah Aceh telah merestui pembangunan Pembangkit Listrik Tenaga Bayu/Angin (PLTB) dengan kapasitas 10 Mega Watt (MW) di Pantai Suak Bakong, Kandang Kluet Selatan. Gubernur Pemerintah Aceh, Irwandi Yusuf dalam pertemuan dengan investor dan pemilik teknologi dari Korea Selatan menyatakan dukungannya atas pembangunan pembangkit listrik tersebut. “Pemerintah mendukung, apalagi PLTB ini ramah lingkungan,” kata Irwandi Kamis (14/10)

siang. PLTB ini dibangun dengan mengunakanVertical SpinWind Turbine, sebuah teknologi yang baru pertama digunakan di dunia. Turbine angin ini penghasil energi listrik yang hanya membutuhkan kecepatan angin rendah. Teknologi ini amat berbeda dengan turbine angin konvensional yang membutuhkan kecepatan angin diatas 7 meter/detik. Marlis Pohan Investor PLTB itu menyebutkan, pembangunan PLTB di Pantai Kandang, Kec. Kluet Selatan, pesisir pantai

barat pulau Sumatera adalah daerah pertama dibangunnya Pembangkit Listrik Tenaga Bayu (Angin), pertama juga di Indonesia dengan memakai teknologi Vertical Spin Wind Turbine. TeknologiVertical SpinWind Turbine ini sangat ramah lingkungan dan ini sesuai visi Gubernur Aceh dengan program Aceh Green. Pembangunan PLTB Kluet ini mulai di bangun pada 1 November 2010 dan rencananya akan beroperasi pada 1 November 2011 sesuai MoU d e n g a n P T P L N Wi l a y a h Aceh.(b32)

Polisi Tangkap Pemilik 60 Batang Kayu Gelondongan

KILANG PADI BERJALAN

Sebuah kilang padi diabadikan sedang melintas Jalan Leupem Mesjid, Pidie, untuk menuju alamat pemesan jasa penggilingan padi beberapa hari lalu. Penggilingan padi portabel ini memudahkan petani, sekaligus memberikan pemasukan lumayan bagi pemiliknya. Pada puncak musim giling, pemiliknya bisa mengantongi Rp 500 ribu sehari. Pengirim Ade Mejuliadi, Sigli, Pidie, 0885267729xx

Bangun Desa Harus Dengan Memberi Pancing Bukan Ikan BLANGPIDIE (Waspada): Masyarakat diharapkan mampu memelihara dan mengembangkan setiap hasil dari pembangunan yang sudah ada serta melanjutkan pemberdayaan dari seluruh potensi yang ada. Konsep itu hasil dari sebuah perencanaan yang dilakukan dari bawah atau sering disebut dengan‘Bottom UpPlanning’, yaitu proses perencanaan yang berasal dari hasil musyawarah dengan pelibatan masyarakat yang ada di lapisan paling bawah. Pernyataan itu dikemukakan Panglima Kodam Iskandar Muda (IM), Mayjen TNI Hambali Hanafiah, dalam amanat tertulisnya yang dibacakan Kasrem 012 Teuku Umar, Letkol Inf Mundasir, yang bertindak selaku Inspektur upacara dalam rangka pembukaan TNI Manunggal Membangun Desa (TMMD) di Aceh Barat Daya (Abdya) di lapangan Padang Sikabu, Kec. Kuala Batee, Rabu (13/10). “Filosofis dari TNI Manunggal Membangun Desa itu adalah ‘Memberi Pancing, Bukan Ikan’, sehingga masyarakatlah yang akan memelihara dan mengembangkan pembangunan yang sudah ada,” tegas Pangdam IM Mayjen TNI Hambali Hanafiah, seperti dibacakan Kasrem Letkol Inf Mundasir. Acara TMMD di Abdya yang dibuka secara resmi oleh Kasrem 012/TU Letkol Inf. Mundasir di lapangan Padang Sikabu pada hari itu, ikut serta dihadiri Bupati Abdya Akmal Ibrahim, Dandim 0110 Abdya Letkol Arm E. Dwi Karyono AS, Ketua DPRK Tgk. M. Yusuf, Kapolres Abdya AKBP Drs. Subakti, Kajari Blangpidie Risal Nurul Fitri, SH, Ketua MPU Tgk. Abdurahman Badar, Sekda Drs Yufrizal S Umar dan seluruh kepala dinas dan kantor, serta seluruh muspika se-kecamatan di Abdya.(sdp)

Pemkab Aceh Timur Dorong Reformasi Dunia Usaha LANGSA (Waspada): Pemerintah Aceh Timur terus mendorong terciptanya reformasi di lingkungan usaha, sehingga dunia usaha di daerah itu dapat berjalan yang lebih baik dan kondusif. Upaya reformasi itu dilakukan dengan berbagai bentuk penyederhanaan proses pelayanan kepada para pelaku usaha, penanganan korupsi, mendorong transparansi, perbaikan infrastruktur dan sebagainya. Demikian Kepala Bappeda Kabupaten Aceh Timur, Ir. Husni Thamrin saat membuka, Lokakarya Tata Kelola Ekonomi Daerah (TKED) hasil studi indeks TKED Aceh dan Nias 2010 yang dipusatkan di Aula Bappeda setempat, Kamis(14/10). Lokakarya ini dihadiri para kepala SKPD di lingkungan Pemkab Aceh Timur, perbankan, dunia usaha, Kadin dan akademisi serta elemen lainnya. Tampil sebagai pemateri dalam lokakarya ini diantaranya ketua Kadin kabupaten Aceh Timur, Adrian yang mengulas sekilas harapan dunia usaha terhadap pemerintah daerah. (b25)

Realisasi PAD Kota Langsa Mengkhawatirkan

Muswil 23 Oktober Ini BANDA ACEH (Waspada): Empat kandidat akan bersaing ketat memperebutkan kursi Ketua DPW PAN Aceh dalam arena Muswil PAN yang akan digelar di Hermes Hotel, Banda Aceh 23-24 Oktober depan . Keempat kandidat yang menyatakan maju yakni,Tarmidinsyah Abubakar SE (Sekum DPW PAN Aceh), Anwar Muhammad (Wakil Bupati Aceh Besar), Ir Saiful Ahmad (mantan Kepala BPKS) dan Anas Bidin Nyak Syeh (Wakil Ketua DPW PAN Aceh). Muswil PAN ini dinilai sangat strategis dikaitkan dengan Pemilukada Gubernur/ Wagub Aceh 2011 mendatang. Informasi yang berkembang, sejumlah kandidat Gubernur dilaporkan ikut mendekati calon potensial. Dengan harapan, partai berlambang bunga matahari ini bisa jadi kendaraan politik menuju Aceh-1 (kursi gubernur). Soalnya, sejumlah kandidat Gubernur Aceh sampai sejauh ini belum tahu menggunakan “perahu” politik dalam suksesi kepemimpinan Aceh-1 itu. Dua nama kandidat yang namanya terus berkibar untuk menggantikan kepemimpinan Ir Azwar Abubakar yang kini duduk di DPRRI, yakni tokoh muda Aceh, Tarmidinsyah Abubakar dan Ir Saiful Ahmad, mantan Anggota DPRRI yang belum lama meninggalkan pos di BPKS itu. Selain dua nama itu, dilaporkan, posisi Anwar Muhammad terbilang tidak kecil. Sebab, dengan posisinya saat ini sebagaiWakil Bupati,

Waspada/Sudarmansyah

Kasrem 012/TU Letkol Inf Mundasir ketika membuka program TMMD ke-85 di Abdya, di lapangan Padang Sikabu, Rabu (13/10).

BIREUEN (Waspada): Polres Bireuen berhasil menangkap pemilik 60 batang kayu gelondongan setelah sehari mengamankan kayunya di kawasan Desa Ie Rhop Babak Lueng, Kec. Simpang Mamplam, Kab. Bireuen, Kamis (14/10) sore. Tersangka yang ditangkap MAI, 60, warga Dusun Buket Cerana, Desa Ie Rhop Timu, kecamatan yang sama. Keterangan yang diperoleh Jumat (15/10) dari Kapolres Bireuen AKBP H Raden Dadik Junaidi melalui Kasat Reskrim AKP Khairul Saleh, SH. SIK, pihaknya pasca mengamankan 60 ton kayu gelondongan berbentuk bulat panjangnya yang rata-rata 4,80 meter berdiameter 25 Cm di salah satu sawmill di Desa Ie Rhop Babah Lueng, saat timnya sedang menaikkan kayu ke dalam empat truk menjelang sore, tersangka ditangkap dan mengakui langsung pemilik sawmill tersebut.

Menurut Kasat Reskrim, tersangka MAI mengaku langsung 11 dari 60 batang batang kayu bulat adalah miliknya yang disuruh tebang dan disuruh turun pada orang . “Ya 11 batang adalah kayu saya suruh tebang pada orang, lalu diturunkan, saya hanya diberi uang bila ada lebih untuk berobat, lainnya tidak. Saya juga tidak tahu sawmill itu milik siapa,” katanya dan tersangka mengaku kayu-kayu itu ditebang di kebun sendiri kawasan Buket Puput di pedalaman kecamatan itu. Kasat Reskrim menyebutkan, 60 batang kayu itu belum seluruhnya dapat diangkut ke Mapolres Bireuen dari pukul 11.00 WIB siang sampai menjelang magrib. ”Masih ada belasan batang lagi di sana belum sempat diangkut dan sudah dipasang police line,” katanya. Tersangka, lanjutnya, bisa saja mengaku kayu itu ditebang di kebunnya, tetapi dalam un-

dang-undang kehutanan, setiap kayu yang ditebang di hutan harus memiliki izin dinas terkait, kecuali kayu kampung, seperti batang kelapa, pohon durian dan lainnya. Sementara kayu yangdiamankankemarinumumnya kayu campuran yang biasa tumbuh di hutan be-lantara. “Kita sedang meneliti seakurat mungkin di mana kayu-kayu itu ditebang lalu ditarik menggunakan kerbau ke sawmill,” kata Kasat Reskrim. Selain sudah ada seorang pemilik kayu yang ditahan di Mapolres Bireuen, ada beberapa pemilik lainnya sedang dicari. Polres Bireuen menduga, kayukayu bulat itu hasil penebangan liar di kawasan pedalaman Simpang Mamplam dan Samalanga. Menyangkut sawmill yang berlokasi jauh dari perkampungan penduduk juga ditengarai tanpa memiliki izin lengkap dan letaknya tidak diketahui masyarakat umum.(amh)

LANGSA (Waspada): Sebagai salah satu instrumen pos pembiayaan dalam Anggaran pendapatan Dan Belanja Kota (APBK), Pos Pendapatan Asli Daerah (PAD) sangat memainkan peran penting. Rendahnya realisasi PAD akan mempengaruhi penyusunan dan realisasi pembangunan di sebuah daerah. Kondisi ini yang sedang dialami Kota Langsa, sampai kuartal ketiga September 2010, realisasi PAD hanya Rp8.923.278.102. “Jumlah ini masih jauh di bawah dari yang ditargetkan yakni senilai Rp24.969.857.280,” demikian Kepala Dinas Pengelola Keuangan dan Aset (DPKA) Kota Langsa, Samsul Bahri.SE melalui Kabid Pendapatan, Zulhelmi kepada wartawan di ruang kerjanya, Rabu (13/10). Dia menambahkan, bila melihat dari realisasi PAD yang telah masuk maka target PAD untuk tahun ini dipastikan tidak akan tercapai. “Target PAD tahun ini tidak akan tercapai karena waktu hanya tinggal beberapa bulan lagi,” ungkapnya. Dia mengaku tidak mengetahui kendala Satuan Kerja Perangkat Daerah (SKPD) penghasil PAD, sehingga banyak target yang tidak tercapai. Pada bagian lain dia mengatakan, SKPD penyumbang terbesar PAD adalah Dinas Kependudukan dan Catatan Sipil yakni dari jumlah yang ditargetkan senilai Rp95.741.500 terealisasi senilai Rp91.969.500 atau 96,06 persen. Dinas Perindustrian, Perdagangan, Koperasi dan UKM menjadi SKPD penyumbang PAD terkecil dari target senilai Rp284.695.000 dan yang baru terealisasi senilai Rp32.965.000 atau hanya 11,58 persen. (b25)

Pelantikan Kepala Mukim November SUBULUSSALAM (Waspada): Kendati pemilihan kepala mukim Batubatu dan Pasir Belo Kec. Sultan Daulat serta Binanga dan Kuala Kepeng Kec. Rundeng, Subulussalam baru akan digelar 20 dan 24 Oktober mendatang, pelantikan delapan kepala mukim terpilih dijadwalkan serentak digelar, Kamis (11/11). Bahkan pelantikan empat kepala mukim yang telah terpilih, yakni Tenni Anakampun, Penanggalan, Umar Angkat, Belegen, H. Ismail Aso, Kombih serta seorang Kepala Mukim Longkib hampir pasti dilaksanakan sesuai jadwal itu meskipun Pemilihan Kepala Mukim di Kecamatan Sultan Daulat dan Rundeng belum terlaksana. Kepada Waspada, M. Rusdy, Kasubbag Administrasi dan Perangkat Kampong Setdako Subulussalam, Jumat (15/10) di Subulussalam mengatakan, pelantikan delapan orang Kepala Mukim yang terpilih direncanakan dilantikWalikota Subulussalam, Merah Sakti. Namun Rusdy memastikan kalau Pemilihan Kepala Mukim Batubatu dan Pasir Belo di Kec. Sultan Daulat serta Binanga dan Kuala Kepeng di Kec. Rundeng baru akan digelar, Rabu (20/10) dan Minggu (24/10). “Kalaupun pemilihan kepala mukim di empat kemukiman itu tidak berjalan sesuai jadwal, namun pelantikan empat Kepala Mukim terpilih akan dilaksanakan tanggal sebelas November mendatang,” jelas Rusdy memastikan, pelantikan terhadap Kepala Mukim terpilih tidak akan ditunda dari jadwal yang telah ditentukan.(b33)

Waspada/Khairul Boangmanalu

BUTUH PERBAIKAN: Badan jalan sekira tiga kilometer menghubungkan Desa Suka Makmur dengan Desa Mukti Makmur Kec. Simpang Kiri menuju Kota Subulussalam butuh perbaikan. Selain badan jalan penuh lubang, kondisi terparah akan terlihat di saat hujan turun.

B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM 4 CM

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA

# ISUZU 100% BARU (ASTRA) #

Panther Pick Up...DP 5 Jt atau Cicilan 3,1Jt Panther LM, LV, LS, Touring...DP 25Jt. atau Rate 0% Hub. SUPRAPTO 061-77860168 / 0813 7507 0088

TOYOTA BARU Wil. Aceh & Sumut. Pesan sekarang juga, bunga ringan. Kredit s/d 5 tahun. Info: 0812 604 81001

Informasi Pembaca

ISUZU Panther Hi-Sporty 25, Hijau ‘97, BK AC DB, PW CL, Jok Sm. Kulit, DP 20Jt. Angsuran: 2,14rb. Sisa 35x. Hub. AISYAH: 0813 7728 0512

TOYOTA Avanza Type G VVT-I Dijual. Thn. 2006 Akhir, Warna hitam, BK Medan asli, satu tangan, mesin sangat halus. Body mulus. Seperti Baru. Harga Rp. 132Juta/ Nego. Hub. 0812 6038 561

ISUZU Panther LDX Thn. 92. Biru, Mls, AC, VR, BR, Tape, cantik, H. 40Jt. Damai. Hub. 061-76411844

TOYOTA Altis Tipe G 1.8. Hitam met Th. 2003. Mulus, mewah, complit, Velg 17 Inc, Ada TV. Sensor Atrek, Hrg. 138Jt Nego Abis. Hub. 0812 4431 7686

ISUZU Panther Grand Deluxe 95 Merah metalik. P. Steering, P. W i n d o w , Ve l g R a c i n g , B K Panjang, Jok baru. BPKB 1 nama, Cat mulus, Tape CD Sony, Siap pakai. Harga 63Jt/Nego. Hub. 0812 658 818 / 77305875

TOYOTA Kijang Kapsul SX Thn. 98. W. biru, BK Medan asli, AC, Tape, V. Racing, mulus. H. 82Jt/damai. Hub. 0813 7007 5355

AUTOMOTIVE

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET

Type LS, Th. 2003. Warna Silver. Harga Rp. 53Jt. Hub. 0813 2112 8 666 “BAWA PULANG DAIHATSU BARU ANDA SEKARANG !!! Xenia Hanya DP 11 Jt-an Angsuran 2 Jt-an Terios DP 15 Jt-an ansuran 4 Jt-an Grand Max Pick Up, DP 7 Jt-an angsuran 2 Jt-an, dll. Proses Mudah dan dijemput 24 jam stand by. Pemesanan Hub. MANDA ASTRA- DAIHATSU. SM. Raja Medan. HP. 0812 6316 330 / (061) 6647 0080

PAKET AKHIR TAHUN * Xenia DP 11 Jt-an * Luxio DP 10 Jt-an * Terios DP 20Jt-an * Gran Max PU DP 7Jt-an Hub. 0812 600 6500 - 061.771 96500

XENIA..DP mulai 10 Jt-an angsuran 2,9Jtan TERIOS...DP mulai 13 Jt-an angsuran 4,1 Jtan Luxio, Sirion, Pick Up & Minibus DP hanya 10% Syarat mudah, Proses Cepat, Kredit s/d 5 tahun Hubungi: ROZAK 0812 6310 9000 - 7704 9000 “DAIHATSU BARU MILIK ANDA” New Pick Up Grand Max DP 7 Jt-an Angs. 2 Jt-an x 36 Bln. Luxio DP 11 Jt-an Angs. 4 Jt-an x 48 Bln Xenia XI VVT-i DP 13 Jt-an Angs. 3 Jt-an x 59Bln. Juga Grandmax Minibus, Sirion & Terios Ready Stock Pesan sekarang. Hub. Ahmad Arif Astra Daihatsu 0812 6005 2465 / 762 77692

PROMO HARI INI ASTRA DAIHATSU

Xenia DP mulai 11 Jt-an, Pick Up DP 7 Jt-an Terios DP mulai 15 Jt-an, Luxio DP 6 Jt-an Hub. IQBAL ASTRA 0813 6100 7907 / 66907084

# DAIHATSU 100% BARU # * Xenia DP: 11Jt Terios DP: 13Jt * Pick-Up DP: 5 Jt Luxio DP: 7 Jt Proses cepat, Data dijemput + Hadiah Hub: Kalpin 0852 7041 9000

XENIA Li Sporty Th. ‘07. 1000cc, Wrn. Hitam, mobil ctk, pajak 1 thn. 1 tangan dr baru, Rp. 108Jt. KEMBAR PONSEL Jl. SM. Raja No. 200 (dpn Sekolah Eria) 0815 33 200 220

DAIHATSU Taft GTS Th. ‘89, wrn biru, Solar, Rp. 37 Jt. KEMBAR PONSEL Jl. SM. Raja No. 200 (dpn UISU). 0815 337 336 88 / 7851 402 HONDA Accord VTI-L M/T Thn. 99 Coklat Muda Met, BK Mdn Rp. 87 Jt Hub. 0812 6594 2789 HONDA Odyssey Matic Thn. 97 Hitam. BK Mdn (mutasi) Pajak STNK Baru Rp. 89 Jt. Hub. 9132 7433 HONDA Civic Wonder Th. 84/85. Merah, BK Mdn Orisinil (terawat). Tidak kecewa. Komplit. Hub. 0852 6134 0601 / 0812 6335 8191

HONDA ACCORD PRESTICE THN. 88

Warna Hitam, mulus, siap pakai. TV, DVD, Sound System, BR/VR. Hrg. 34Jt/Nego Hub. 0812 6419 1979 0852 7006 7772

HYUNDAI Bimantara Cakra Thn. 1997, Biru metalik lengkap. Hub. 0813 7010 5676 ISUZU Panther 96 Diesel Royal BK Medan warna biru, AC, CD, VR, BR, Remote, PW, CL. Hub. 0813 6007 5306 ISUZU Panther Grand Deluxe Tahun 95/ 96. BK Medan, warna biru metalik. Harga: Rp. 56Jt/Nego. Hub. 0813 6130 1393 DIJUAL SALAH SATU 1.Isuzu Panther Challenger Thn. 95/96. AC, B. Blower, P. Window, C. Lock, Alarm, Remot. H. 47Jt. 2.Isuzu Panther Miyabi Laksana Thn. 93/94. AC, C. Lock Remot Alarm. H. 45Jt. Mobil BK Medan Mulus, cantik Rapi. Hub. IBU Hajjah 061.77572509 - 0852 6195 3098 (maaf sms TP)

KIA MOBIL

Micro Bus New Travello Pantas Buat Usaha Antar Jemput DP 20Jt & CCL 5,5Jt (Gratis Kaca Film + Alarm)

Hotline Service 0852 6128 1181

KIA Sportex 4x4 2001. Mulus, originil, BK Medan, lengkap, siap pakai. H. 70 Jt Nego. Hub. 0812 6357 9890

MITSUBISHI BARU PROMO MURAH

L300 PU Cuma DP 14Jt-an. T120 DP 10Jt-an Buruan !!! 0813 9799 0818 MITSUBISHI L300 MB Starwagon Thn. 06. Warna putih, Kondisi siap pakai. Hub. 0813 6074 6112

MITSUBISHI L300 Karoseri Sparta Thn. 06. Warna silver, ada AC. Hub. 0852 6186 6000 MITSUBISHI L300 Diesel 130X Th. 1995. Rp. 58 Nego. L.300 Pick Up Diesel Thn. 1994. 55 Nego Daihatsu Taft GT Thn. 1985 Rp. 40 Nego Hub. 0812 634 580 99 MERCEDES Benz E230 New Eyes, 97/ 98. BK Mdn Tgn-2. BK 2 Angka, 4 A. Bag, ABS, Cool Box, DP 25Jt. Angsuran: 4,1Jtx35. Hub. AISYAH: 0813 7728 0512

OPEL Blazer DOHC - 2000. Mulus, orisinil BK Medan, W. Coklat Met. AC, TV, CD, Radio, Power, Full sound, mesin bagus. H. 60Jt. Hub. 0812 6357 9890 DEALER RESMI SUZUKI MOBIL

PU 1.5 DP 12 Jt-an Angs. 2.883.000,APV DP 12 Jt-an Angs. 4.830.000,NB: Proses Mudah & Cepat Data dijemput Hub. 0812 6540 809 / (061) 7772 2121

SUZUKI SWIFT ST 2010

Warna silver orisinil seperti baru. H. 165Jt. Boleh Tukar Kijang Innova atau Kijang Kapsul Hub. 0812 6477 946 BK Baru.

SUZUKI Forsa Amenity Thn. 91 Dijual. Mobil cantik, warna biru, ban radial. Power Window, AC, Harga Rp. 31 Juta (nego). Hub. 0812 6421 6010

SUZUKI Grand Vitara 2008 bulan 9. Hitam metalic, Matic. Mulus. BK Medan. 0813 61477528

SUZUKI Katana Th. 92/91. BK Medan Kondisi masih orisinal, Cat Asli (BU). Hub. 0852 6168 1255 - 0852 6168 1255 SUZUKI Katana GX ‘97. Ungu Tua Metalic, PS, AC Dingin, Jok kulit, BK Medan, Harga Nego. Hub. 0812 602 5414 SUZUKI Vitara Thn. ‘94, W. Hitam, AC, Tape, VR, PW, CL, 4x4. Hrg. 74Jt/ Nego. BK Mdn Asli. Hub. 77852115 - 0812 63 779410

SUZUKI APV GL 2005. Warna biru met, AC, Tape, BK Mdn, Asl 1 Tangan dari baru An. Sendiri Mulus, STNK, Agustus ‘11. Harga 84Jt. Hub. 0813 7050 5264

TOYOTA BARU Ready Fortuner, Innova Rush, Avanza Yarris, Vios, Altis, Hilux (DC). Terima Tukar Tambah. Hub. 0813 7033 3221 061.77011221 (RIZAL)

TOYOTA BARU

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

TOYOTA Kijang Innova 2005, Bensin, Silver, Mobil mulus. Jl. Kasuari Gg. Baru No.6 Tel. 845 2765

TOYOTA Kijang LGX 2000, merah, Mobil mulus, Solar, Jl. Alfalah No. 21. HP. 0812 6080 2804 TOYOTA AVANZA G-1.3CC Thn. 2006, W. biru metalic, AC, D. Blower, VR, PS, PW, CL. Harga Nego. BK Medan. Hub. 081 161 5411

TOYOTA Innova G Th. ‘05, Bensin, wrn biru, metalik. Mobil Ctk, Rp. 147,5Jt. Hub. 0812 6524 3555 TOYOTA Kijang Kapsul LGX 2001 Warna Silver, body mulus, Original, mesin siap pakai. Lengkap, AC, Tape, PW, Alarm, BK Medan asli. 1 nama BPKB. Hub. 0813 6162 4975

TOYOTA Starlet Thn. ‘94, PS, PW, CL, AC, Tape, VR. W. Merah Maron. Hub. Jl. Eka Surya 17 Titi Kuning. 77591820. Hrg. 60Jt/Nego.

TOYOTA Kijang Grand Extra Thn. 95/96 BR/VR AC Double Blower PW, CL, Tape, Radio Original. Mobil mulus, Jarang pakai. BK Asli Medan. Body Leng leng. Hubungi: 0852 7571 0338 - (061) 7695 7738 - Toyota Kijang Super Thn. 1994 W. Biru - Daihatsu Espass Minibus Thn. 2004 W. Silver - Daihatsu Escada Minibus Thn. 1995 W. Merah - Suzuki Carry Adventure Minibus Thn. 1996 W. abu2 hitam - Suzuki Carry Alexander Minibus 1993 W. Biru (1,3) Hub. Jln. Helvetia Raya Pasar VII (Manunggal) Telp. 061-77256868

9 CM Rp. 126.000 10 CM Rp. 140.000

BURSA

BUTUH DANA SOLUSINYA, JAMINAN BPKB MOBILL DANA KAMI Data lengkap, Langsung cair, BPKB aman Hub. Kami: FINANCIAL SOLUSINDO . (061) 7763.1725 TUNAI HP0815.3447.0666

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

STAF ADMINISTRASI

Dengan kwalifikasi 1. Wanita 2. Umur maximal 25 tahun 3. Pendidikan minimal SMK Komputer 4. Dapat mengoperasikan komputer MS WORD terutama EXEL 5. Berpengalaman di Administrasi 6. Berpenampilan menarik 7. Dapat bekerja individu dan Team 8. Menguasai bahasa Inggris minimal Fasib 9. Dapat bekerja full time 10.Sehat jasmani dan rohani

Hindari bertransaksi melalui ATM

Lamaran dihantar langsung paling lambat tanggal 23 Oktober 2010 ke:

PT. ANDALAS SURYA JAYA

Jl. Pancing I No. 165A Martubung (Samp. Rel Kereta Api) Belawan - Medan

Lebih Jelas hubungi kami di 061- 457 6602 Terimakasih

BURSA

LOWONGAN

ANDA BUTUH DANA

BURSA

Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807

DANA CEPAT

ANDA BUTUH DANA TUNAI

Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0813 9779 1077 Maaf TP

BURSA

SEPEDA MOTOR OVER KREDIT

Mio CW Putih Mei 2010. Sdh Byr 5x, sisa 10 Bln. Rp. 533Rb/Bln. Balik DP Rp. 7Jt/Nego. Mulus. Jarang pake. Hub. RUDI 0812 6538 0841 Cepat/BU.

HONDA Supra Fit Cakram Th. 2005. Hitam - Biru. Mulus/Siap pakai. 5,6Jt/ Nego. Hub. 0882 6158 9250

BURSA

ALAT BERAT

TELAH HADIR BUCKET MURAH HITACHI, KOMATSU, KOBELCO HP. 0852 7077 2488 BURSA

RENTAL MOBIL

ELEKTRONIK DIJUAL

2 Unit AC 1 Pk Dust & 1 1/2 Pk National. 2 Unit Genset Yamakoyo 3500 Watt Hub. 0812 6416 147

AC

BARU “HARGA” SPECIAL -

PANASONIC - LG MITSUBISHI - AUX SAMSUNG - DAST GENERAL - FUJI CHANGHONG - DAIKIN SHARP PLASMA CLUSTER

SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk

TOKO SUPER ELECTRONIC Simp. Gandho

TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

BURSA

KOMUNIKASI

RIZKY PULSA

✓ Grosir

Pulsa Elektrik, Satu Chip Untuk Semua Operator

✓ Hanya Dengan Modal Rp. 50.000 Saja.

Anda Sudah Bisa Menjadi Agen Pulsa ✓ Harga Sangat Murah (Gratis Biaya Pendaftaran) / Transaksi 24 Jam ✓ Dicari Agen dan Master Dealer Untuk Seluruh Wilayah Indonesia

Harga Produk

S/AS 5: 5.200 S/AS 10:10.000 S/AS 20:19.900 S/AS 50: 49.250 S/AS 100: 97.500 Informasi Pendaftaran Hubungi:

0813 6125 9330

Jl. Bromo No. 95, Medan Website: www.rizkipulsa.net

SERVICE

AC

ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat

MAJU TEKNIK

RENTAL MOBIL MURAH Rp. 250.000/Hari Mobil: Avanza, Xenia. HP. 061.66477734, 0813 9779 1077 Maaf TP.

BURSA

ELEKTRONIK TRANSFER DVD-VCD Dari VHS, Mini DV, Hi-8, Betamax, Laserdisc, Kaset Tape. Shooting & Foto Resepsi, Ultah, Candid, Pre-Wed, Profile Kharisma Studio Jl. Mahkamah Tel. 7364845-77112200

AC

7030118 76750084 KULKAS, M. CUCI DISPENSER (BERGARANSI)

STASIUN J. SERVICE M. Cuci Dispenser - Garansi AC KULKAS,

76355562, 0813 7565 6534

TV AHLI

POLYTRON, LG, JVC SHARP, TV PROJECTION, TCL, DLL TOSHIBA SONY, di tempat & Bergaransi MASTER TV. 77621674 Siap

RIDWAN AHLI TV Prof. 0812 6303 4400

BURSA

KONSTRUKSI

WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 06177008458, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

WC 0812 60444275 WC JL. SETIA BUDI

Hub. TUMPAT / SEDOT WC/GRANSI

TUMPAT/ SEDOT

77442112

Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725

MOBIL SEDOT

PAK ADI

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

Kami Perusahaan Transport Nasional, membutuhkan:

Sebaiknya berjual beli secara langsung bertemu

Jaminan BPKB, Mobil, Sp. Motor, Betor dan Taksi semua tahun, Surat Tanah. syarat ringan, Proses Cepat. Hub. 061-7633 6525 -0812 6081 3010

FAX.4561347

DIBUTUHKAN

Pelanggan Terhormat

- Toyota Avanza Thn. 2005 W. biru Type G - Toyota Kijang LSX Thn. 1997 W. Abu2 - Diesel - Toyota Kijang Grand Extra Thn. 1993 W. Abu2 - Daihatsu Xenia Thn. 2004 W. Merah Type XI - Daihatsu Rocky Thn. 1994 W. Hitam - Suzuki Vitara Thn. 1994 W. Merah - Suzuki Baleno Thn. 1998 W. Hijau Dijual cash & credit / Tukar (+) Hub. Jl. Mustafa Depan Bulog Telp. 061-6624884

VIOS 2008 Mulus, warna silver, BK Medan, lengkap, siap pakai. H. 175Jt. Nego. 0812 6477 946 FORTUNE 2009 Lok. Medan Asli warna hitam, CD, TV, Remote, CL, PW, VR, BR, satu nama dari baru. Hub. 0813 600 75306

11 CM Rp. 165.000 12 CM Rp. 180.000

Sabtu, 16 Oktober 2010

Jl. BRAYAN MEDAN

HP.

LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. Bpk Ridho (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan

BUTUH KARYAWAN TETAP Tamatan SMU sederajat, Cukup KTP dan FOTO pasti diterima Gaji 1 Juta bersih/ bulan sebagai ATK, minggu libur, GM. SE 0852.9797.0510 MS. SE 0852.7680.3880

Hub. 0852.9773.2776

Jl. Wiliam Iskandar/ Jl. Pancing Komp. IAIN No. 12 Medan, LT. 15,15x29,1 (441m²), LB: 171 (m²), 1½ Tkt, SHM, 4 KT, 2 KM, Garasi, PLN, PDAM, Bebas banjir, Maaf khusus Muslim Hub. 0812.601.7682

Tk. pangkas Berpengalaman Rajin, Jujur (Lajang) ditempatkan di Bali TAXI BLUE BIRD

Membutuhkan 137 Pengemudi, Komisi, Bonus, Insentif, Mbl baru Syrt: 23 - 45 thn, Copy SIM/ KTP, Ijazah, Tdk bertato/ Bks Tatto Jl. Kapt. Muslim 92 Sei Kambing Medan 7637.5840 - 844.2345

LOWONGAN PEKERJAAN

TOTAL EXPRESSION COURSE Membutuhkan Staf Pengajar Untuk bidang studi B. Inggris, B. Indonesia, Matematika, Biologi, Fisika, Kimia dan Komputer Untuk ditempatkan dikelas Bimbingan belajar Persyaratan: SARJANA BERPENGALAMAN Bagi yang berminat antar lamaran ke alamat Jl. Denai No. 118 Medan Telp. (061) 7658.8141

DIBUTUHKAN SEGERA

Ass. Manager Area Sumut, Pendidikan S1, Laki/ Perempuan, Pengalaman min 2 thn bdgn Retail Kirim lamaran lengkap ke: TOKO LOVE POLY PLAZA MEDAN FAIR LT. 3 NO. 100 TELP. 4140.606

LOWONGAN KERJA PT. GRAHA CITRA SURYA bergerak dibidang Property membutuhkan lowongan kerja utk posisi sebagai MARKETING dengan syarat: - Minimal tamatan SMU sederajat - Usia minimal 21 - Berpengalaman dibidang marketing - Berpenampilan menarik - Memiliki kendaraan roda 2

Lamaran ditujukan ke:

Jl. SM. Raja No. 41 (Depan Hotel Garuda) Hub. Edy Wibowo 0813.9755.8037 Iskandarsyah 0813.7855.2468 Office (061) 333.0174

PROPERTY

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

SEGERA LAUNCHING HANYA DP 7,5 JT

Perumahan BellaVista, Siap huni Type 36, 41, 45 Jl. Tali Air, Pdg Bulan Hub. (061) 7625.1251 / 0813.6168.2288 www.donald-property.blogspot.com

RUMAH Satu unit dijual di Jl. Sei Rotan 8 Medan Baru, SHM, Harga Rp. 900 Jt/ nego, TP Hub. 0815.3473.6210

LEBARAN PAKET LEB ARAN DP RINGAN

Hadiah KACA FILM SOLAR GARD + PARKING SENSOR

KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

MINI & EFEKTIF IKLANKAN PRODUK ANDA

RUKO DIJUAL

DIBUTUHKAN 1 ORANG

Informasi Pembaca Bursa Property

BUNGA O % atau CASH BACK 13 Juta

RUKO DIJUAL

Jl. Karya No. 73 B Sei Agul L. 4x22m, 2 Tingkat Hub. 0812.6542.4646 1 unit Ruko 3½ Tkt, Uk. 4x17m², Siap huni, Lengkap keramik, Air, Listrik, Telepon di Kompleks Perum Graha Sunggal Blok H. No. 18 Jl. Sunggal Medan Hub. (061) 6964.1923 Harga jual, dibawah nilai NJOP

BURSA

CROSS

RUMAH Perak Dijual 4x22: 3 KT, RT, Dapur, 1 KM, PAM, SHM, Jl. Dazam Raya Petisah Hub. 7754.7323

RUMAH DIJUAL

RUKO DIJUAL

3 Tkt Full keramik, LT. 4,5x25m, Siap huni, Cocok untuk usaha apa saja, Jl. Besar Namorambe No. 136C di depan Perumahan Taman Citra Mandiri, Surat SHM/ IMB 0812.6052.5263 - (061) 7656.0999

RUKO DIJUAL 3 TINGKAT

Jl. Besar Kota Tembung No. 19B Hub Telp. 453.7861/ 0852.7525.0819

(Online Private)

Online Institut Indonesia - America FULL CONVERSATION dengan NATIVE SPEAKER langsung dari USA Kami menerapkan SISTEM TERBARU Online dalam mempelajari Bahasa Inggris dengan CEPAT dan TEPAT DIJAMIN 100% BISA Untuk Informasi: Ms. Nana 0878.8868.3819 Ms. Nina (021) 980.3694

BURSA

TRAVEL/ WISATA

RUMAH DIJUAL

Villa Jasari Manunggal No. C6, SHM, 3 KT, 3 KM, Jl. P. Denai/ Jl. Manunggal Medan Hub. 0819.7308.6088

RUMAH DIJUAL

UT. 10x25, UB. 8x20, 2 Lantai, 4 KT, 2 KM Jl. Jermal III/ Jl. Datuk Kabu Gg. Cendrawasih No. 33 Medan Hub. 0819.7308.6088 RUMAH DIJUAL

Uk. Tanah 8x19m, Uk. Rumah 7x16m, Sertifikat Hak Milik, KT 2, KM 1, RT, RM, Dapur, Garasi, Rumah keramik + Multi roof seng, Jl. Karya Kesuma Psr. 10 Tembung belakang Mesjid Al Farida, 50m dari Jalan besar, Harga 225 Jt/ bisa KPR, DP 20% (ada 6 unit) Hub. 0813.7668.6447

KUALA SIMPANG

Dijual Ruko 2 Tingkat, Lokasi dalam kota, Cocok untuk usaha dan kantor, SHM Harga 850 Jt/nego Hub. 0852.7576.9248

RUKO DIJUAL

Jl. Marelan Raya No. 64 Kel. Tanah Enam Ratus Uk. 4x18m Surat Sertifikat Hak Milik Hub. 0813.9799.9953 (TP)

RUMAH DIJUAL

Di Komp. Villa Malina Jl. Permata Nusa No. 6, ringroad Tjg Sari, Uk. 10x15m, SHM, 3 KT, 2 KM, Carpot, List 1300 W, PDAM, Harga 350 Jt/nego Hub. 0812.6397.7600

DIJUAL CEPAT

Rumah 2 Tkt di Tasbi Blok FF No. 35 Sudut, Sertifikat Hak Milik, Luas Tanah 346m² Km Tidur 4 AC, KM 4 Hub. 0811.640.054 - 0831.9921.1869

RUMAH DIJUAL

Type 100 (Tanah 14x40m)(LT: ±550m²), Hrg 400 Jt/ng, TK dgn 4 Ruang kelas, 1 Ruang guru, 3 WC dan 2 AC, SHM Jl. Roso - Mariendal 1 (Psr V) Taman Mariendal Mas), Hrg 250 Jt/ng Hub. (061) 6997.2200 (TP) PERUMAHAN SAMANHUDI PERMAI BINJAI Jl. Samanhudi Binjai Pasar V Pinggir Jalan Besar SIAP HUNI Dengan Harga Rp. 55 Jt DP Rp. 6 Juta Cicilan Rp. 286.000/bulan KPR BTN Belum termasuk biaya pengurusan SHM Hub. (061) 7744.5855 0812.6075.455 0857.62509899 0857.6199.0155

RUMAH DIJUAL

Jl. Sei Mencirim - Paya Geli, 1½ LT, 6,5x16m, SHM, Strategis Harga Rp. 200 Jt-an Hub. 7701.7188 / 0819.607.0471 TANAH TANAH Dijual Uk. 30x20m², Lokasi Johor Psr. V sebelah Pesantren Da’rul Ilmi (depan Perumahan 100m dari Jalan besar (Gg. Permata), Jual cepat B.U 105 Jt Hub. (061) 9107.0971/ 0852.6134.0601

RUKO Perum. Bumi Asri Dijual Jl. Asrama Hub. 0852.6169.4207 (061) 7633.6103 (TP)

TANAH DIJUAL 15X34: 500M

1 Unit Rumah 2 Lt di Perumahan Classsic Residence 1C 13 di Jl. Abdul Hakim Pasar 1 Tj. Sari Medan Dengan 4 Kamar tidur ˆ 2 diatas & 2 di bawah 3 Kamar mandi (Harga bisa nego) Hubungi: - 0821.6528.1509 - (061) 7626.4141 - 0812.6477.0629

ENGLISH COURSE

RUMAH DIJUAL

TANAH & RUMAH DIJUAL, SHM:

DISEWAKAN

BURSA

PENDIDIKAN

Rp. 175 Jt/nego, L. 17m, P. 12m, 1½ LT, 4 KT, 1 KP, Jl. Tempirai Sejati Blok VI No. 184 Griya Martubung Hub. 0812.6013.4738

RUMAH dijual Taman Johor Baru (Jl. Karya Wisata), 3 KT, RT, Dapur, PAM, PLN 1300, LT. 153m², LB. 80m2 Hub. 0816.313.1990 Harga nego

RUMAH Disewakan dikawasan Setiabudi Komplek Puri Tanjung Sari 3 No. A4, Fasilitas Air, PLN, Telkom, Satpam 24 jam Berminat hub. 0812.6440.718 - (061) 7734.0340

TANAH Kosong Dijual L. 70, P. 70: 4900m² Jl. Kenanga Raya daerah Setia Budi dekat Ringroad, SHM Hub. 0813.6007.5306

1. Jl. Pertiwi Baru Uk. 10x35m (Siap huni) 2. Jl. Mesjid Taufik Uk. 13x26m Hub/i: 0852.7547.4550 Surat Hak Milik, Jl. Melur 3 Pasar 3 Setia Budi Tj. Sari Hub. (061) 7752.1868

TANAH DI BRASTAGI/ GUNDALING Ukuran luas 4.479, Surat Sertifikat Hub HP. 0821.6538.5351

BURSA

HILANG/TERCECER TERCECER/HILANG

SK. Gubernur K.D.H. Propinsi Sumatera Utara. No: 202/ DA/HML/LB/1973 Tgl. 10 November 1973. Tentang Hak Milik atas tanah. a/n. HERMAINI, yang terletak di Desa Negeri Lama Kec. Bilah Hilir Kab. Lab. Batu. Bagi yang menemukan Hub. No. Telp. 0852 6163 6312, Dan akan diberikan imbalan sepantasnya

BERITA TERCECER

Telah tercecer sebuah Surat Tanah Nomor Kendaraan (STNK) dan sebuah Buku Pemilik Kendaraan Bermotor (BPKB) atas nama Achmad Delianur Nasution, Jenis Kendaraan Avanza, BK 1352 JE, Tahun 2008, Warna hitam No. Mesin DC80358 No. Rangka MHFM1BA3J8K080053. Barang siapa yang menemukan silahkan menghubungi 061-8211137, tidak dituntut dan akan diberi imbalan sepantasnya.

TERCECER BPKB Sepeda Motor Honda BK 3583 CQ. An. MUHAMMAD FARIJ Jl. Jermal XVII No. 11 B. Medan Denai. TERCECER Surat Tanah No. 11868/A/I 26 Tgl. 24 Agustus 1973 atas nama: JOSEP BANGUN. Terletak dr. Dusun II. Desa Sunggal Kanan Kecamatan Sunggal, tercecer disekitar Desa Namo Riam.

TERCECER

1 (Satu) BPKB No. 1879030 - G No. Pol.: 8328 LW. a/n. IR BADULLAH HSB, Empl: PTP IV BALIMBINGAN. Kec. T. Jawa Kab. Simalungun.

TERCECER / HILANG 1 (Satu) Berkas Surat Tanah a/n. Ridwan Ahmad, Tercecer disekitar Jl. SM. Raja. Bagi yang menemukan Hub. TETNA SIREGAR HP. 0813 8162 7702. Akan diberi hadiah sepantasnya.

BERITA - HILANG

Surat Tanah SK Lurah Tegal Rejo Kec. M. Perjuangan Ukuran: 16,20 Meter X 10 Meter atas nama Alm. Thomson Panggabean Jalan Mesjid Taufik Gang Nangka No. 6 Kel. Tegal Rejo. Kec. Medan Perjuangan. HILANG / TERCECER

Luas Tanah ± 7 Rante di Jl. Sempurna Psr. 7 Tembung Hub. 0813.6200.6612 0813.6120.8550

Telah hilang 1 buah Surat Keterangan Tanah Atas nama: ZULKIFLI, dengan nomor: 593/475/VII/005/KM/2001 tertanggal 05 Juli 2001. Tanah tersebut beralamat: di Jalan Kayu Putih Gg. Wakap Lingkungan VIII Kel. Tg. Mulia Hilir Kec. Medan Deli, dengan ukuran 20x15M. Hubungi HP: 0812 6099 6062

TANAH DIJUAL

Ingin Promosikan Produk Anda

TANAH DIJUAL CEPAT

5,2x28,4m + Rumah Tua, Sertifikat Hak Milik, Jl. Sei Blutuh No. 64 Medan Baru, Lokasi ±30m di seberang setelah praktek dr. Kolman, Harga 325 Jt Hub. 0858.1111.2741

Harian

WASPADA Media yang Tepat untuk Iklan Anda

Ekonomi & Bisnis B8 180 Tahun, Pengguna TabunganHanya60-70Juta JAKARTA (Waspada): Walau industri perbankan di Indonesia sudah berkembang hampir 180 tahun, masyarakat memiliki rekening tabungan di perbankan nasional ternyata hanya sebanyak 60-70 juta rekening. Menurut Chief Financial Officer PT Bank Mandiri Tbk, Pahala N Mansury, pencapaian itu jauh di bawah jumlah peng-

guna kartu telekomunikasi (simcard) yang tercatat sebanyak 150-160 juta kartu. Padahal, industri telekomunikasi seluler baru berkembang 18 tahun. “Rekening tabungan di Indonesia hanya 60-70 juta,” katanya dalam Media Training di Bandung, Jawa Barat. Catatan Bank Mandiri menunjukkan, selama tahun 2009, jumlah masyarakat sudah memperoleh layanan perbankan (banked) memiliki pendapatan sebesar 99 juta dolar AS per tahun. Dari jumlah pendapatan itu, keuntungan usaha diperoleh mencapai 59 dolar AS juta per tahun. Sementara itu, jumlah ma-

syarakat yang belum tersentuh bank tercatat memiliki pendapatan hingga 110 juta dolar AS per tahun dengan laba usaha sebesar 44 juta dolar AS per tahun. Dari data itu, Bank Mandiri sendiri berusaha agar masyarakat yang selama ini belum tersentuh dunia perbankan bisa menggunakan berbagai fasilitas perbankan. Tiga sektor berpotensi menjadi bidikan itu adalah pensiunan, nelayan dan petani, serta mahasiswa atau pelajar. “Selain melalui microbanking, kami juga menawarkan produk bank berupa TabunganKu,” ujar Pahala.

Untuk menjangkau masyarakat unbanked tersebut, kata Pahala, tidak bisa dilakukan hanya dengan mendirikan kantor cabang. Pasalnya, biaya untuk mendirikan kantor cabang dianggap kurang efisien. “Untuk membangun kantor cabang paling tidak keluar biaya sekitar Rp1 miliar untuk membiayai fasilitas teknologi informasi dan working capital,” ujarnya. Namun, dia mengingatkan upaya perbankan untuk menggaet masyarakat unbanked tersebut tidak akan berhasil tanpa adanya dukungan dan sektor swasta dan pemerintah.(vvn)

BI Cermati Potensi Krisis Ekonomi Dunia NEW YORK (Antara): Bank Indonesia (BI) akan terus mencermati perkembangan krisis ekonomi di berbagai negara agar tidak menyeret Indonesia ke dalam krisis yang sama, demikian Gubernur BI Darmin Nasution dalam upacara serah terima jabatan Kepala Perwakilan BI di Gedung KJRI New York, Kamis. Jabatan Kepala BI New York diserahkan dari Lucky Fathul Aziz Hadibrata kepada penggantinya, Kusumaningtuti Sandriharmy Soetiono. Darmin mengingatkan, krisis ekonomi tidak selalu berasal dari dalam negeri tapin

juga bisa dari negara paling maju, seperti tahun-tahun ini dialami Amerika Serikat dan Eropa. “Malah sekarang ada negara, yang karena skalanya, masuk ke dalam kategori sistemik berpotensi untuk membuat negara lain juga ikut terseret ke dalam krisis,” kata Darmin. Darmin menganggap perwakilan BI di luar negeri memiliki peranan besar untuk mencegah Indonesia terseret ke dalam krisis. “Ini adalah perkembanganperkembangan baru sehingga kantor perwakilan kita menjadi sangat penting peranannya untuk mengikuti apa yang

sedang terjadi,” kata Darmin. Selain puluhan perwakilan di Indonesia, saat ini BI memiliki empat kantor perwakilan di luar negeri yaitu di New York, London, Tokyo dan Singapura. Kantor-kantor perwakilan di luar negeri tersebut antara lain bertugas memantau dan menganalisa isu strategis, terutama terkait dengan regulasi serta kebijakan ekonomi dan moneter dikeluarkan oleh pemerintah dan bank sentral di negara bersangkutan. Wilayah kerja Kantor Perwakilan BI NewYork mencakup Amerika Serikat, Kanada, Meksiko, Argentina dan Brazil.

Waspada/Hamdani

TETAP TINGGI : Seorang pedagang tampak menyusun telur ayam di Pasar Petisah Medan, Jumat (15/10). Harga jual telur ayam di Pasar tetap bertahan tinggi. Harga bervariasi, mulai dari Rp.750 hingga Rp 900 perbutir.

Upacara serah-terima jabatan Kepala Kantor Perwakilan BINew York juga dihadiri Duta Besar RI untuk Amerika Serikat, Dino Patti Djalal dan Duta Besar RI untuk PBB di New York, Hasan Kleib. Dino menekankan pentingnya Indonesia sebagai emerging economy (negara berperekonomian sedang tumbuh) untuk membuka hubungan dengan negara-negara emerging economy lainnya. “Yang masih kurang dipicu membangun link dengan negara-negara seperti Brazil, Afrika Selatan, Turki, India. Pola hubungannya masih kurang,” kata Dino.

China Tak Mau Yuan Dijadikan Kambing Hitam BEIJING (Waspada): China menegaskan rendahnya nilai tukar yuan tidak boleh dijadikan “kambing hitam” atas masalah perekonomian Amerika Serikat (AS). “Amerika Serikat seharusnya menggunakan alasan domestik untuk meneruskan programnya dalam mengatasi pengangguran dan masalah ekonominya. Nilai tukar yuan tidak boleh dijadikan kambing hitam atas masalah domestik AS,” kata Juru Bicara Kemen-

terian Perdagangan China Yao Jian kepada wartawan seperti dikutip dari AFP, Jumat (15/10). Sebelumnya, China telah menetapkan yuan pada tingkat terkuatnya sejak pembuat kebijakan berjanji pada bulan Juni lalu untuk untuk melonggarkan nilai yuan. The People Bank of China (PBOC) menetapkan kurs tengah untuk yang di level 6,6497 per USD. Mata uang China itu telah menguat hampir sebanyak setengah persen pada minggu

ini, dan yuan juga telah menguat lebih dari 2,6 persen sejak musim panas. AS dan Eropa menyebut hal itu sebagai apresiasi cepat, dan sekarang mereka mengatakan itu undervalued. China juga sebelumnya telah membuka diri agar yuan dapat menguat. Di mana penguatan yuan terseut akibat tekanan atas nilai mata uang yang dilakukan China. Inilah menurut para kritikus China tidak adil dalam melakukan perdagangan.

China telah secara konsisten menolak setiap tekanan untuk naik cepat di yuan, bahkan ketika diminta untuk bersamasama memperkuat nilai mata uang secara bertahap. Yao mengatakan ketidaksabaran AS atas nilai yuan bagian dari strategi Amerika bertujuan untuk menghilangkan dominasi produk China di dunia. “Tindakan tersebut sangat akan melanggar aturan WTO dan akan masuk akal dan salah,” katanya. (okz)

Cowell Targetkan 20 Persen Penjualan Apartemen Di Medan MEDAN ( Waspada): PT Cowel Development Tbk yang melebarkan sayapnya ke bisnis apartemen Westmark di Jakarta Barat menargetkan sekitar 20 persen produk propertinya tersebut terjual di Medan. Menurut Business Development Director dan Marketing Director PT Cowell Development Tbk Novi Imelly dalam pameran di lantai I Medan Fair Plaza, Kamis (14/10), target tersebut berdasarkan tingginya aktivitas orang Medan ke Jakarta. Aktivitas orang Medan di

Jakarta lebih didominasi urusan bisnis tersebut tidak terlepas dengan kebutuhan hidup akan pentingnya tempat tinggal yang nyaman. Sehubungan hal itu Cowell Development menyediakan Westmark Apartemen dengan mengutamakan kenyamanan, ujarnya. Saat ini Cowell menargetkan sebanyak 20 persen dari 625 unit hunian apartemen Westmark dibangun dalam satu tower di atas areal 5000 meter persegi tersebut dapat terjual di Medan, katanya.

Apartemen Westmark dibangun dengan mengutamakan kenyamanan tersebut terletak di tengah fasilitas kebutuhan hidup perkotaan dapat dijangkau berkisar 10 menit dari lokasi hunian diantaranya terletak didepan loby Mall Taman Anggrek Jakarta Barat. Selain itu lokasi apartemen terletak di tengah fasilitas pendidikan seperti kampus Trisakti, Universitas Taruma Negara, Ukrida dan fasilitas kesehatan seperti RS Harapan Kita, RS Dharmais, dan pusat bisnis di Jakarta dalam waktu berkisar 10

menit lebih, sebutnya. Disamping itu komposisi tower tersebut 20 persen hunian dan 80 persen dari luas bagunan tower merupakan fasilitas umum seperti areal parkir, taman hijau dan ruang publik lainnya sehingga menghadirkan kesan lebih nyaman, sebutnya. Di s a m p i n g m e n g e m bangkan apartemen di Jakarta, Cowell juga telah melebarkan sayap ke Surabaya dan Balikpapan dikenal dengan Borneo Paradiso sukses memasarkan 125 unit hunian per bulan, tuturrnya. (m40)

Beras Jimpitan, Tradisi Menjaga Ketahanan Pangan Di L.Batu TRADISI beras jimpitan atau lumbung mini mungkin kini nyaris tidak pernah terdengar lagi. Padahal, tradisi beras jimpitan ini memiliki multifungsi bagi ketahanan pangan keluarga sekaligus bisa menjadi ketahanan ekonomi bagi bangsa. Kearifan lokal dimiliki bangsa ini memang paling tidak mengajarkan spirit menabung dalam artian tidak menabung uang, melainkan menyisihkan sejumput beras untuk ditabung guna keperluan keluarga, kelompok dan komunitas suatu masyarakat dalam menjaga ketahanan pangannya. Hal itu pula menjadi penekanan Bupati Labuhanbatu dr H Tigor Panusunan Siregar pada acara kunjungan Tim Monitoring Desa Percontohan 10 program pokok PKK dan Desa PT P2WS-KSS S Sumatera Utara di Desa Cinta Makmur, Kecamatan Panai Hulu, Kamis (14/10). Tigor mengenang, saat masih menjabat Kepala Puskesmas di Desa Talang Akar, Kecamatan Talang Ukir, Kabupaten Muara Enim, Sumselpada 1986 pada saat kegiatan PKK di desa itu jimpitan beras telah diawali oleh komunitas desa setempat. Jimpitan beras ini mengajarkan semangat menabung bagi masyarakat suatu desa, dimana setiap hari dari beras

Menkeu Bantah APBN Bukan Untuk Orang Miskin JAKARTA (Waspada): Pemerintah memastikan penyusunan Anggaran Pendapatan dan Belanja Negara (APBN) selama ini telah memperhatikan kesejahteraan rakyat. Ini tercermin dari program kebijakan pemerintah pro growth, pro poor, pro job dan pro environment. Menteri Keuangan Agus DW Martowardojo memastikan program ini memihak masyarakat kurang mampu dan selalu melindungi hak-hak mereka. Menkeu membantah atas permintaan uji materi UndangUndang Nomor 22 Tahun 2010 tentang APBN-Perubahan 2010 (APBN-P 2010) diajukan Koalisi CSO untuk APBN Kesejahteraan pada 4 oktober 2010. Negara lupa dengan orang kurang mampu, lanjut Menkeu, tentu saja tidak ada istilah seperti itu. Menurutnya alokasi anggaran APBN sekarang sudah cukup mencerminkan program-program sifatnya membantu rakyat kurang mampu. Bahkan porsi anggaran sendiri

hampir sekitar 30 persennya dialokasikan untuk program subsidi. Disebutkan program bersifat membantu itu misalnya Program Nasional Pemberdayaan Masyarakat (PNPM) dan KUR (Kredit Usaha rakyat). Bahkan keberhasilan pemerintah ini antara lain bisa dilihat dari peningkatan kesejahteraan dilihat dari peningkatan GDP secara nasional yang mencapai Rp6000 triliun dan pendapatan perkapita yang telah mendekati 3000 dolar AS per tahun. Seperti diketahui Mahkamah Konstitusi (MK) menggelar sidang uji materi UndangUndang Nomor 22 Tahun 2010 tentang APBN-Perubahan 2010 (APBN-P 2010) yang diajukan Koalisi CSO untuk APBN Kesejahteraan. Koalisi tersebut terdiri dari LSM Fitra, IHCS, ASPPUK, Prakarsa, Perkumpulan Inisiatif, Lakpesdam NU dan Publish What You Pay. Dalam permohonannya, Koalisi CSO untuk APBN Kese-

Ketua TP PKK Sumut Ny Hj Fatimah Habibi Syamsul Arifin (berdiri tegak) foto bersama dengan Ketua TP PKK L.Batu dr Hj Fitra Laila Tigor P Siregar, Bupati dan Wabup L.Batu Tigor Siregar dan Suhari Pane (3 dari kanan ke kiri). ngan bagi sebuah keluarga, masyarakat L.Batu dan pada akhirnya menjadi ketahanan ekonomi bagi bangsa dan negara. “Jimpitan beras yang dipraktikkan TP PKK Desa Cinta Makmur perlu ditiru desa dan kelurahan lain di L.Batu ini,” ujar Tigor didampingi Wakil Bupati Suhari Pane SIP dan Ketua TP PKK L.Batu dr Hj Fitra Laila Tigor P Siregar, Sp THT. Bupati juga mengharapkan, sebagai perwakilan L.Batu mengikuti perlombaan desa percontohan 10 program pokok

PKK, seluruh lembaga pemerintahan desa agar memikirkan dan memberi perhatian untuk Desa Cinta Makmur agar bisa meraih prestasi di tingkat Sumut. Tigor juga mengharapkan hal sama untuk Desa Sei Sanggul yang merupakan perwakilan L.Batu untuk lomba desa Program Terpadu, Peningkatan Pe ra n a n Wa n i t a Me n u j u Keluarga Sehat Sejahtera (PT P2W-KSS). Armansyah Abdi

jahteraan menganggap Undang-undang Nomor 22 Tahun 2010 tentang APBN-Perubahan

2010 inkonstitusional karena tidak memihak orang miskin. (vvn)

Harga Minyak Tembus 83 Dolar SINGAPURA (Antara): Harga minyak naik melewati 83 dolar AS di perdagangan Asia, karena “greenback” terjun bebas dan angka suram lapangan kerja di Amerika Serikat telah mempertinggi harapan adanya intervensi oleh Federal Reserve, kata para analis. Kontrak utama NewYork, minyak mentah light sweet untuk pengiriman November, maju 38 sen menjadi 83,07 dolar AS per barel di sore hari. Minyak mentah Brent North Sea untuk penyerahan Desember, naik 13 sen menjadi 84,33 dolar AS per barel pada hari pertama perdagangannya. “Harga minyak didorong oleh penurunan nilai greenback,”, kata Victor Shum, prinsipal senior konsultan energi Purvin and Gertz di Singapura. “Harga minyak benar-benar didukung oleh ekspektasi dolar AS terus menukik,” katanya. Di perdagangan Asia sore hari kemarin, euro bisa dibeli 1,4087 dolar AS, sedikit menurun dari 1,4083 dolar akhir Kamis di NewYork, setelah mencapai 1,4122 dolar dalam perdagangan intraday, tertinggi sejak Januari.

Kontribusi Bongkar Muat Di Belawan Diberlakukan Minggu Depan M E D A N ( Wa s p a d a ) : Pungutan kontribusi untuk kegiatan bongkar muat barang di Pelabuhan Belawan yang disepakati sebesar Rp 2.500 untuk setiap satuan tonase barang efektif diterapkan 18 Oktober 2010 atau mundur dari jadwal 11 Oktober 2010. Penundaan selama seminggu tersebut merupakan keputusan Rapat Anggota Tahunan (RAT) DPW Gafeksi Wilayah Sumut digelar Jumat (8/10) di Hotel Grand Angkasa Medan. Dewan Pengurus Wilayah (DPW) Gafeksi Sumut di antaranya SekretarisWilayah IrWiluyo Hartono, Wakil Ketua H Rizal Muhammad Nisfan MT, Ketua Bidang Multi Moda H Heru dan Kabid Kepelabuhan dan Peti Kemas Sabar T Marpaung menjelaskan penundaan tersebut kepada wartawan di Sekretariat Gafeksi Sumut, kemarin. Penjelasan tersebut menanggapi protes kalangan anggota Gafeksi yang menolak pe-

nerapan kontribusi atas kegiatan bongkar muat di Pelabuhan Belawan. Wiluyo menyebutkan, penundaan pemberlakuan kontribusi diputuskan peserta RAT Gafeksi Sumut untuk menampung masukan anggota yang meminta agar regulasi tersebut terlebih dahulu disosialisasikan. “Sosialisasi akan diberlakukannya kontribusi kegiatan bongkar muat barang di Pelabuhan Belawan sebenarnya sudah kami lakukan melalui surat elektronik kepada anggota Gafeksi. Namun, beberapa anggota merasa hal itu belum cukup, maka RAT sepakat menunda pemberlakuan kontribusi tersebut selama seminggu,” kata Wiluyo. MenurutWiluyo dan Nisfan, protes segelintir anggota Gafeksi yang menolak kontribusi muncul sebelum peserta RAT memutuskannya. General Manager (GM) Pelabuhan Belawan Syahputera

Kasus Indomine Persaingan Dagang Tidak Sehat

ditampi diambil sejumput untuk disisihkan. Tentu saja praktik jimpitan ini menjadi lumbung beras mini bagi keluarga dan masyarakat desa setempat. Beras yang terhimpun dari jimpitan ini berguna bagi keluarga dan warga desa tergabung dalam kelompok PKK untuk keperluan hajatan atau bisa ditukar dengan uang guna mendanai kegiatan kelompok. Tigor menuturkan, praktik jimpitan beras ini pada akhirnya bisa membentuk ketahanan pa-

WASPADA Sabtu 16 Oktober 2010

MEDAN (Waspada): Penarikan Indomie oleh pemerintah Taiwan dengan alasan mengandung bahan kimia atau pengawet berbahaya dinilai sebagai bentuk persaingan dagang tidak sehat. Untuk itu, pemerintah Indonesia diminta segera mengambil sikap dan langkah tegas, agar penduduk Indonesia tidak resah karenanya. “Kalau memang Indomie mengandung bahan pengawet berbahaya bagi kesehatan, jutaan rakyat Indonesia yang sudah sejak lama mengkonsumsinya pasti sakit. Tapi nyatanya tidak,” kata Pjs Ketua Pimpinan Pusat Federasi Serikat Pekerja Rokok Tembakau Makanan Minuman Serikat Pekerja Seluruh Indonesia (PP F-SP RTMM SPSI) Mukhyir Hasan Hasibuan di Medan, Jumat (15/10). Kata dia, PT Indofood selaku produsen Indomie tidak mungkin merusak citranya dengan mencampurkan bahan berbahaya dalam produknya. Apalagi PT Indofood salah satu perusahaan terbesar di Indonesia telah mempunyai lebih 30 pabrik di beberapa provinsi di negara ini. Disamping itu, PT Indofood memiliki puluhan ribu tenaga kerja yang hidupnya bergantung dengan produksi perusahaan, 90 persen pekerjanya anggota F-SP RTMM SPSI. “Jadi, perlakuan Taiwan terhadap penarikan produk Indonesia jelas merupakan bentuk persaingan dagang tidak sehat. Sebab kita sama-sama mengetahui produk Indomie ini sangat laris di pasaran, tidak hanya dalam negeri, tapi juga luar negeri,” sebut Mukhyir, juga Ketua Dewan Pimpinan Daerah Konfederasi SPSI (DPD K-SPSI) Sumut. Pihaknya meminta pemerintan Indonesia segera mengambil langkah jawaban terhadap penarikan produk Indomie oleh Taiwan. Karena penarikan produk Indonesia secara rekayasan termasuk pelecehan terhadap pemerintah Indonesia. “Teliti seluruh barangbarang produk Taiwan di Indonesia. Bila perlu stop dan boikot produk mereka,” tandas Hasibuan menambahkan, bila tindakan Taiwan memengaruhi produksi Indomie, bisa mengakibatkan PHK besar-besaran, juga berpengaruh terhadap pajak pemerintah.(m11)

Sembiring dihubungi via telepon membenarkan penundaan pungutan kontribusi dari 11 Oktober menjadi 18 Oktober 2010. Menurut Syahputera, kontribusi tersebut merupakan putusan para asosiasi penyedia jasa di antaranya Gafeksi, Gabungan Perusahaan Ekspor Indonesia (GPEI), Gabungan Importer Indonesia (GINSI) dan Perusahaan Bongkar Muat (PBM). Berbenah Diri Wiluyo menyebutkan, kontribusi sebesar Rp 2.500 kepada Pelindo Belawan selaku pemilik lahan juga operator pelabuhan jangan membuat penyedia jasa lengah. Sebab, kata Wiluyo, tarif tersebut akan dievaluasi setiap tahun, apakah berdampak positif membenahi sekaligus meningkatkan kinerja para penyedia jasa. Wiluyo menjelaskan, mengacu kepada UU No 17/2008 tentang Pelayaran diikuti Peraturan Pemerintah No 61/2009, maka Pelindo Belawan menjadi operator tunggal yang berwenang penuh menyelenggarakan semua aktivitas di pelabuhan, termasuk bongkar muat. Mengacu kepada regulasi tersebut plus aturan ikutannya, sambung Wiluyo, maka ruang

gerak bagi penyedia jasa yang tidak berbenah diri di kawasan pelabuhan menjadi terancam. “Misalnya, sesuai regulasi tersebut penyedia jasa harus menyediakan modal senilai tertentu agar diizinkan beraktivitas melayani pemilik barang di kawasan pelabuhan. Karena itu kami memberikan apresiasi kepada GM Pelabuhan Belawan yang masih memberikan kesempatan bagi penyedia jasa setempat melayani pemilik barang,” kata Wiluyo. Disebutkannya, dari studi banding yang dilakukan pihaknya ke Tanjung Priok (Jakarta), Tanjung Perak (Surabaya) dan Semarang, operator pelabuhan di ketiga pelabuhan tersebut sudah menerapkan UU No 17/ 2008. Eksesnya, puluhan perusahaan penyedia jasa di pelabuhan tersebut harus merger. Menjawab pertanyaan tentang biaya tinggi yang dikeluhkan akan muncul akibat kontribusi tersebut.Wiluyo dan Nisfan menegaskan, sesuai tarif pasar dibayarkan penyedia jasa ditambah kontribusi kepada operator pelabuhan, nilainya masih di bawah besaran tarif yang tertuang dalam patokan harga tarif yang sudah disepakati stakeholder di palabuhan.(m38)

Simpati Gelar Program Ngobrol Tanpa Batas MEDAN (Waspada): Telkomsel menggelar promo tarif terbaru dari kartu prabayar simPATI yaitu Ngobrol Tanpa Batas ke semua operator, promo ini berlaku bagi pelanggan baru kartu simPATI Freedom yang melakukan aktivasi mulai 12 Oktober 2010, berupa hemat nelpon hanya Rp15/Menit atau setara dengan Rp0,4/detik. Untuk menikmati tarif hemat ini, pelanggan cukup melakukan registrasi dengan menghubungi *999*55#OK lalu ikuti petunjuk selanjutnya. Selain itu pelanggan juga dapat mengaktifkan dengan cara mengirim SMS dengan mengetik TM<spasi>TB kirim ke 8999. Waktu untuk melakukan registrasi mulai pukul 01.00 s/d 12.00. Setelah mendapatkan konfirmasi tentang keberhasilan pendaftaran layanan, maka akan dilakukan pengurangan pulsa sebesar Rp1.500,- (seribu lima ratus rupiah) dan pelanggan dapat menikmati nelpon berkali-kali hingga 100 menit, dengan ketentuan 98 (sembilan puluh delapan) menit ke sesama pelanggan Telkomsel (kartuHALO, simPATI dan kartu As), dan dua menit ke seluruh operator, dapat digunakan mulai pukul 01.00 s/d 17.00. Menurut Vice President Area Sumatera, Mirza Budiwan, sejak diluncurkannya simPATI Freedom pada akhir Juli 2010, produk ini mendapat respon sangat positif, program Ngobrol Tanpa Batas Ke Semua Operator ini dihadirkan untuk memenuhi kebutuhan pelanggan agar dapat menikmati layanan komunikasi berkualitas dan murah tidak hanya ke sesama pelanggan Telkomsel tapi juga ke seluruh operator. Di samping promo Ngobrol Tanpa Batas, simPATI freedom juga memberikan kebebasan untuk memilih paket sesuai kebutuhan pelanggan dengan hanya menekan satu kode akses *999#. (m09)


Waspada, Sabtu 16 Oktober 2010