Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 4 April 2012/12 Jumadil Awal 1433 H

No: 23824 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) Harga Eceran: Rp2.500,-

Mendagri Berhentikan Bupati Palas JAKARTA (Waspada): Menteri Dalam Negeri Gamawan Fauzi akan memberhentikan Basyrah Lubis dari jabatannya sebagai Bupati Padang Lawas (Palas), terkait keputusan Mahkamah Agung. Mendagri akan menerbitkan Surat Keputusan (SK) pemberhentiannya dalam pekan ini. “SK-nya sudah ada di meja saya dan akan segera saya teken. Saya juga sudah konsultasi ke Mahkamah Agung. SK dapat diterbitkan tanpa harus menunggu putusan PK,” kata Menteri Dalam Negeri Gamawan Fauzi kepada wartawan seusai menghadiri penandatanganan kerjasama antara Perumnas dan bupati/wali kota di Jakarta, Selasa (3/4). Keputusan Mahkamah Agung telah berkekuatan hukum tetap memvonis Basyrah Lubis bersalah dengan hukuman 6 bulan percobaan. Selain memberhentikan Basyrah Lubis, Mendagri juga akan memberhentikan tiga kepala daerah lainnya, yakni Wali kota Bekasi Mochtar Muhammad, Bupati Subang dan Bupati Lampung Utara.

Hasil Rapat Cikeas

PKS Langgar Etika Koalisi

Waspada/Arianda Tanjung

TRAFFIC light di simpang Jl. Perintis Kemerdekaan-Jl. Sutomo rusak akibat aksi anarki para pengunjukrasa yang menolak kenaikan harga BBM. Foto diabadikan Selasa (3/4) malam.

Pasca Demo BBM Di Medan

Lanjut ke hal A2 kol. 2

JAKARTA(Waspada): Partai-partai tergabung dalam Sekretariat Gabungan (Setgab) sepakat menyatakan Partai Keadilan Sejahtera (PKS) melanggar kode etik koalisi. Kesepakatan itu diambil dalam pertemuan para ketua umum partai koalisi dan Presiden Susilo Bambang Yudhoyono di Cikeas, Selasa (3/4)malam. “Sangat melanggar,” kata Sekretaris Setgab, Syarif Hasan di Cikeas, Bogor, Jawa Barat. Syarif mengungkapkan, bahasan utama dalam pertemuan di kediaman SBY malam ini adalah masalah kontrak koalisi. “Kami membahas masalah kontraknya saja, kontrak koalisi,” ujarnya. Dalam pertemuan ini, Syarif memastikan tidak ada perwakilan PKS yang hadir. Namun dia tidak menjelaskan apakah ketidakhadiran itu karena tidak diundang atau memang sengaja mengabaikan pertemuan ini. Lantas, apa sanksi yang akan dijatuhkan untuk PKS yang dianggap melanggar etika koalisi tersebut? “Di kontrak koalisi, kalau sudah tidak sama-sama ya ayo,” ujarnya.

Lanjut ke hal A2 kol. 1

Traffic Light Rusak Rp1,1 M MEDAN (Waspada): Dinas Perhubungan Kota Medan mengajukan anggaran ke Pemko Medan untuk perbaikan traffic light di lima persimpangan di Medan yang rusak akibat aksi unjukrasa menolak kenaikan harga BBM pekan lalu, sebesar Rp1.178.516.000. Anggaran tersebut dialokasikan dari anggaran bencana dengan proses penunjukan langsung (PL).

Antara

JAKARTA BANJIR:Dua orang warga duduk di atas rumahnya sambil menyelamatkan barangbarang berharga yang rumahnya terendam banjir setinggi satu hingga dua meter untuk mengungsi di perumahan IKPN Bintaro, Jakarta Selatan, Selasa (3/4). Banjir yang menggenangi Komplek IKPN sejak Selasa dini hari disebabkan karena meluapnya Kali Pesanggrahan.

DPR Hanya Wakil Partai Bukan Wakil Rakyat MEDAN (Waspada): Para anggota Dewan Perwakilan Rakyat (DPR) Republik Indonesia yang dipilih rakyat sebagai legislatif untuk menyampaikan dan memperjuangkan aspirasi masyarakat secara luas kepada eksekutif (pemerintah), dinilai tidak lagi berfungsi mewakili rakyat melainkan

mewakili partai politik masingmasing terutama yang tergabung dalam Setgab Koalisi. Hal tersebut disampaikan pengamat politik dari Universitas Negeri Medan (Unimed) Aulia Andri dan Fakultas Ilmu Sosial dan Ilmu Politik (Fisipol) Universitas Sumatera Utara (USU) Warjio PhD, kepada

Al Bayan

Misteri Kulit Oleh Tgk. H. Ameer Hamzah FISIK manusia terdiri dari jasmani dan ruhani. Jasmani terdiri dari kulit, tulang, darah, urat, saraf, otak, jantung, lambung, perut, paru-paru, gigi, rambut, alat vital, bulu, mata, hidung, mulut dan lain-lain anggota tubuh. Mari kita perhatikan kulit berdasarkan penelitian ahli biologi. Kulit adalah alat tubuh yang paling besar pada manusia, luasnya bila dihamparkan lebih kurang dua meter persegi, beratnya tiga kilogram, mengandung sepertiga dari jumlah darah yang mengalir dalam tubuh manusia. Setiap satu centimeter kulit mengandung dua aparat pencatat dingin, 12 aparat pencatat panas, tiga juta sel, lebih kurang sepuluh helai bulu (rambut), satu meter urat darah halus, 100 kelenjar keringat, 3000 sel perasa, empat meter urat syaraf, dam 25 aparat pencatat tekanan.

Waspada kemarin, menanggapi sikap anggota DPR RI dalam sidang paripurna pengajuan APBN-P 2012 yang diajukan pemerintah pada 30 Maret 2012 lalu. “Partai politik di Indonesia saat ini telah membuat parlemen itu menjadi kerdil. Karena Lanjut ke hal A2 kol. 6

“Kerugian kita selama aksi unjukrasa penolakan BBM sebanyak Rp1 miliar lebih. Kita sudah ajukan kepada pak wali untuk perbaikan traffic light itu. Anggaran tersebut untuk memperbaiki sebanyak 20 traffic light yang rusak,” kata Kepala Dinas Perhubungan Kota Medan, S. Armansyah Lubis kepada Waspada, Selasa (3/4). Adapun traffic light yang rusak itu, kata Armansyah, untuk persimpangan Jalan Yos Sudarso/Adam Malik perbaikan traffic light sebesar Rp94.040.000, simpang Jalan Perintis Kemerdekaan/Jalan Gaharu Rp119.476.000, simpang Jalan Sutomo/ Jalan Perintis Kemerdekaan Rp163.172.000. Simpang HM Yamin/ Jalan Sutomo Rp60.974.000. Lanjut ke hal A2 kol. 1

Presiden Instruksikan Penghematan Besar-besaran JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono telah menginstruksikan gerakan penghematan di segala sektor untuk menyelamatkan APBN, kata Menteri Koordinator Perekonomian Hatta Rajasa. “Presiden sudah menginstruksikan penghematan besar-besaran,” kata Hatta di kantor kepresidenan, Jakarta, Selasa (3/4). Berkenaan dengan hal itu Hatta mengatakan sudah meminta semua instansi pemerintah melakukan penghematan dengan menekan alokasi anggaran untuk hal-hal yang tidak terlalu mendesak seperti studi banding dan perjalanan dinas. Lebih lanjut dia menjelaskan bahwa sebenarnya penaikan harga bahan bakar minyak bersubsidi (BBM) Lanjut ke hal A2 kol. 3

Antara

KTT ASEAN KE-20: Presiden dan Perdana Menteri negara ASEAN berfoto bersama dalam upacara pembukaan KTT ASEAN ke-20 dan peringatan hari jadi ASEAN ke 45 di Istana Perdamaian, Gedung Dewan Kementrian di Phnom Penh, Selasa (3/4). (dari kiri-kanan) Presiden Filipina Benigno Aquino, PM Singapura Lee Hsien Loong, PM Thailand Yingluck Shinawatra, PM Vietnam Nguyen Tan Dung, PM Kamboja Hun Sen, Presiden Brunei Sultan Hassanal Bolkiah, Wapres Boediono, PM Laos Thongsing Thammavong, PM Malaysia Najib Razak dan Presiden Myanmar Thein Sein. Berita baca halaman A9.

KPK Tangkap 7 Anggota DPRD Riau JAKARTA (Waspada): Tujuh anggota DPRD Riau tertangkap tangan oleh Komisi Pemberantasan Korupsi (KPK), Selasa (3/4) sore. Mereka ditangkap diduga terlibat kasus korupsi. Bersama dengan itu, KPK juga menangkap empat orang dari pihak swasta, dan dua orang dari Dinas Pemuda dan Olahraga Provinsi Riau. Juga menyita sejumlah uang sebagai

barang bukti. Ketujuh anggota DPRD Riau yang ditangkap itu berinisial MFA, AA, II, MD, TM, TA, dan RS. “Mereka kami tangkap terkait dengan kasus dugaan korupsi, dalam pembahasan peraturan daerah tentang persiapan penyelenggaraan PON 2012 di Riau,” kata Kepala Bagian Pemberitaan KPK, Priharsa.

Wartawati Senior Herawati Diah Tetap Semangat Di Usia 95 Tahun

Ada-ada Saja Piara Ayam Untuk Kurangi Sampah

DI USIA senja, Herawati Diah (foto) masih tampak sehat dan bugar. Langkahnya pelan tapi bersemangat, saat berjalan ke sekeliling ruang tamu. Sesekali dia berpindah duduk, seolah tidak mau tinggal diam di satu tempat. Gambaran perempuan penuh energi, masih melekat pada dirinya. Lanjut ke hal A2 kol. 3

Waspada/Dok Menteri BUMN

MENTERI BUMN Dahlan Iskan berdiri di dalam gerbong KA menuju rumah susun di kawasan Cakung, Jaktim.

Menteri Tidur Di Rusun

Lanjut ke hal A2 kol. 3

HERAWATI Diah bersama cucu dan cicit.

Waspada/ist

Dalam penangkapan ini KPK juga menyita sejumlah uang Rp800 juta. Sekaitan dengan itu, KPK dalam misi pengungkapan kasus para anggota DPRD Riau juga memanggil Kapolda Riau Brigjen Pol Suedi Husein. Kapolda datang ke ruang pemeriksaan di Markas Direktorat Reserse Kriminal Khusus Polda Riau sekitar pukul 22.18. Sampai tengah malam, pemeriksaan masih terus berlanjut. (kps/ant)

JAKARTA (Waspada) : Gebrakan dari Menteri BUMN Dahlan Iskan tidak pernah berhenti. Setelah melempar kursi dan membuka palang pintu jalan tol dalam kota di kawasan Sudirman karena petugas loket telat datang, kali ini dia melakukan gebrakan dengan bermalam di rumah susun di Perumnas Pulo Gebang Cakung, Jakarta Timur, Senin (2/4) malam. “Bapak tidur di rumah susun Cakung. Itu rumah untuk kalangan sederhana,” ungkap Kabag Humas dan Protokoler Kementerian BUMN Faisal, kepada Waspada, Selasa (3/4). Lanjut ke hal A2 kol. 3

SEBUAH desa di Prancis telah mengusulkan cara unik untuk mengurangi sampah organik. Pemerintah setempat memberikan masing-masing dua ekor ayam kepada warga untuk mengurangi sampah organik. Para pejabat di Desa Pince mengatakan, ternyata seekor

Lanjut ke hal A2 kol. 2

Serampang - Hemat pangkal kaya ya Pak...? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 4 April 2012/12 Jumadil Awal 1433 H

z zNo: 23824 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Setgab Janji Fasilitasi PKS Keluar Dari Koalisi

Jakarta Siagakan Posko Korban Banjir

JAKARTA (Antara): Pemerintah Provinsi DKI Jakarta telah menyiagakan beberapa posko pengungsian yang dilengkapi pos kesehatan bagi korban banjir di beberapa wilayah Jakarta seperti Bukit Duri, Gang Arus, dan Kampung Melayu. “Kami telah menyediakan tempattempat pengungsian di dekat wilayah rawan banjir. Namun hingga saat ini masih belum ada masyarakat yang mengungsi,” kata Gubernur DKI Jakarta, Fauzi Bowo, di Jakarta, Selasa (3/4). Hujan deras yang mengguyur wilayah Jakarta pada Senin (2/4) malam menimbulkan genangan air yang merendam rumah warga di Kelurahan Pondok Labu, Cilandak, Jakarta Selatan, dan hingga Selasa siang kurang lebih 10 wilayah rukun tetangga (RT) masih terendam air. “Untuk yang terjadi di Pondok Labu, pompa air baru akan berfungsi bulan depan, dan masyarakat sudah mengetahui karena kita sudah mensosialisasikan hal tersebut, dan permasalahan tersebut belum terselesaikan apabila pompa tersebut masih belum berfungsi,” kata Fauzi. Lanjut ke hal A2 kol 4

Antara

SELAMATKAN TELEPON UMUM. Sejumlah petugas Telkom membawa telepon umum yang terendam banjir yang berada di SD 05 Bintaro di perumahan IKPN Bintaro, Jakarta Selatan, Selasa (3/4). Banjir yang menyerang Jakarta sejak Selasa dini hari disebabkan tingginya curah hujan dan meluapnya kali Pesanggrahan.

JAKARTA (Antara): Sekretariat Gabungan (Setgab) akan memfasilitasi Partai Keadilan Sejahtera (PKS) untuk keluar dari koalisi, demikian anggota Dewan Pembina Partai Demokrat Ahmad Mubarok, Selasa (3/4). “Koalisi memfasilitasi keinginan PKS untuk berada di luar. Kan PKS sudah bilang siap di luar. Jadi tidak ada pemecatan, tidak ada pengusiran. Yang ada adalah memfasilitasi keinginan PKS,” kata Mubarok. Mubarok menandaskan, Setgab tidak akan mengeluarkan PKS karena jika dikeluarkan maka PKS akan diuntungkan. “PKS memang menginginkan dipecat atau dikeluarkan dari koalisi sehingga terkesan dizolimi,” kata Mubarok. Dia menyatakan apa yang dilakukan Setgab dalam waktu dekat ini semata terjadi karena pernyataan PKS bahwa partai ini sudah tak nyaman lagi dalam Setgab. “Setgab akan segera berkumpul dalam waktu dekat guna mencari waktu yang tepat untuk memfasilitasi keluarnya PKS dari Setgab. Kalau tidak mau mundur, koalisi berakhir dengan Lanjut ke hal A2 kol 5

Mendagri Berhentikan Bupati Palas Presiden Instruksikan Penghematan Besar-besaran JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono telah menginstruksikan gerakan penghematan di segala sektor untuk menyelamatkan APBN, kata Menteri Koordinator Perekonomian

Hatta Rajasa. “Presiden sudah menginstruksikan penghematan besar-besaran,” kata Hatta di kantor kepresidenan, Jakarta, Selasa (3/4). Berkenaan dengan hal itu

Hatta mengatakan sudah meminta semua instansi pemerintah melakukan penghematan dengan menekan alokasi anggaran untuk hal-hal yang Lanjut ke hal A2 kol 6

JAKARTA (Waspada): Menteri Dalam Negeri Gamawan Fauzi akan memberhentikan Basyrah Lubis dari jabatannya sebagai Bupati Padang Lawas (Palas), Sumatera Utara, terkait keputusan Mahkamah Agung. Mendagri akan menerbitkan Surat Keputusan (SK) pemberhentiannya dalam pekan ini. “SK-nya sudah ada di meja saya dan akan segera saya teken. Saya juga sudah konsultasi ke Mahkamah Agung. SK dapat diterbitkan tanpa harus menunggu putusan PK,” kata

Menteri Dalam Negeri Gamawan Fauzi kepada wartawan seusai menghadiri penandatanganan kerjasama antara Lanjut ke hal A2 kol 6

Calhaj Lansia Prioritas ONH Kemungkinan Naik JAKARTA (Antara): Kementerian Agama (Kemenag) pada penyelenggaran musim haji tahun 1433 H/2012 berencana memprioritaskan calon jamaah haji (Calhaj) usia lanjut untuk berangkat ibadah haji

terlebih dahulu daripada yang berusia lebih muda. “Ini program kami untuk memberikan prioritas untuk lanjut usia (lansia), misalnya yang 90 tahun ke atas kita habisi dulu, setelah itu 80 tahun ke

atas habis,” kata Menteri Agama Suryadharma Ali kepada wartawan usai meninjau Gedung Siskohat Kementerian Agama Jakarta, Selasa (3/4). Lanjut ke hal A2 kol 1

Pasca Demo BBM

Perbaikan Traffic Light Yang Rusak Rp1,1 Miliar MEDAN (Waspada): Dinas Perhubungan Kota Medan mengajukan anggaran ke Pemko Medan untuk perbaikan traffic light di lima persimpangan di Medan yang rusak akibat aksi unjukrasa menolak kenaikan harga BBM pekan lalu, sebesar Rp 1.178.516.000. Anggaran tersebut dialokasikan dari anggaran bencana dengan proses penunjukan langsung (PL). “Kerugian kita selama aksi

unjukrasa penolakan BBM sebanyak Rp1 miliar lebih. Kita sudah ajukan kepada pak wali untuk perbaikan traffic light itu. Anggaran tersebut untuk memperbaiki sebanyak 20 traffic light yang rusak,” kata Kepala Dinas Perhubungan Kota Medan, S. Armansyah Lubis kepada Waspada, Selasa (3/4). Adapun traffic light yang Lanjut ke hal A2 kol 6

Cabub Aceh Utara Sulaiman Ibrahim: HERAWATI DIAH bersama cucu-cucu.

Wartawati Senior Herawati Diah Tetap Semangat Di Usia 95 Tahun DI usia senja, Herawati Diah masih tampak sehat dan bugar. Langkahnya pelan tapi bersemangat, saat berjalan ke sekeliling ruang tamu. Sesekali dia berpindah duduk, seolah tidak mau tinggal diam di satu tempat. Gambaran perempuan penuh energi, masih melekat pada dirinya. “Sebentar lagi keluarga

besar dan sahabat-sahabat saya datang. Saya senang sekali, “ujarnya, membuka percakapan pagi itu. Sambil berbincang, sesekali tangannya sibuk menata sejumlah pernak-pernik perak di atas meja tamu. Memang, saat Waspada datang di kediamannya di Apartemen di bilangan Dhar-

mawangsa Jakarta Selatan, isteri BM Diah (almarhum) ini tengah sibuk mempersiapkan acara open house memperingati hari kelahirannya. Selasa, 3 April 2012, legenda jurnalistik di Indonesia ini genap berusia 95 tahun. Tentu saja, usia demikian Lanjut ke hal A2 kol 3

Daerah Penghasil Gas Masih Tertinggal

WARGA beramai-ramai melihat kondisi angkot dan sepedamotor yang hangus terbakar di Jalinsum Desa Goti, Kec. Batang Angkola, Kab. Tapsel, Selasa (3/4).

M ATA N G K U L I , Ac e h Utara (Waspada): Sulaiman Ibrahim mengatakan hasil gas yang dikuras dari perut bumi di Aceh Utara belum dinikmati warga kawasan penghasil. Masih banyak fasilitas umum kondisinya memperihatinkan. Dalam orasinya di Lapangan Sepak Bola Mantang Kuli, Sulaiman mengungkapkan berbagai kensenjangan terjadi dalam pembangunan di Aceh Utara. Ironisnya,

P.SIDIMPUAN (Waspada): Satu mobil angkot (angkutan kota) yang membawa jerigen berisi premium, Selasa (3/4) siang, hangus terbakar bersama sepedamotor yang disenggolnya di Jalan Lintas Sumatera (Jalinsum), Desa Holbung,

Matang Kuli, Pirak Timu dan beberapa kecamatan kawasan sumur gas masih tertinggal. “Padahal banyak dihasilkan dari dalam perut bumi di bawah kita berdiri ini (Aceh Utara-red),” ujar Sulaiman yang diikuti tepuk tangan ribuan warga dalam kampanyenya, Selasa (3/4). Sulaiman mencontohkan, jalan kabupaten kawasan Lanjut ke hal A2 kol 6

Waspada/Sukri Falah Harahap

Angkot Dan Sepedamotor Terbakar Di Jalinsum Tapsel Kec. Batang Angkola, Kab. Tapanuli Selatan. Peristiwa itu menyebabkan satu dari tiga penumpang angkot, Maratua Naek Lubis, mengalami luka bakar serius pada bagian tangan, wajah, dan kaki. Korban menjalani

Ada-ada Saja

Al Bayan

Piara Ayam Untuk Kurangi Sampah

Misteri Kulit Oleh: H Ameer Hamzah FISIK manusia terdiri dari jasmani dan ruhani. Jasmani terdiri dari kulit, tulang, darah, urat, saraf, otak, jantung, lambung, perut, paru-paru, gigi, rambut, alat vital, bulu, mata, hidung, mulut dan lain-lain anggota tubuh. Mari kita perhatikan kulit berdasarkan penelitian ahli biologi. Kulit adalah alat tubuh yang paling besar pada manusia, luasnya bila dihamparkan lebih kurang dua meter persegi, beratnya tiga kilogram, mengandung sepertiga dari jumlah darah yang mengalir dalam tubuh manusia. Setiap satu centimeter kulit mengandung dua aparat pencatat dingin, 12 aparat pencatat panas, tiga juta sel,

Lanjut ke hal A2 kol 2

TEBINGTINGGI (Waspada): Seorang suami tega menjual istrinya ke sebuah lokalisasi. Tak terima diperlakukan seperti itu, sang istri melaporkannya ke Mapolres Tebingtinggi. Kini, sang suami ditahan Polres Tebingtinggi guna mempertanggungjawabkan perbuatannya. Tersangka TS alias Kodrat, 25, warga Lingk II, Kel. Badak Bejuang, Kec. Tebingtinggi , Kota, Kota Tebingtinggi

SEBUAH desa di Prancis telah mengusulkan cara unik untuk mengurangi sampah organik. Pemerintah setempat memberikan masing-masing dua ekor ayam kepada warga untuk mengurangi sampah organik. Para pejabat di Desa Pince mengatakan, ternyata seekor ayam dapat mengkonsumsi 150 kg sampah organik per tahun. Hal itu diharapkan dapat mengurangi limbah di lingkungan desa dan sebaliknya membantu banyak keluarga dengan berternak telur ayam. Hingga kini sudah ada 15 sampai 20 keluarga yang berminat memelihara ayam tersebut sejak rencana itu dilakukan pada September 2011. “Sa ya kira it u a da l a h

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 5

Waspada/Muhammad Idris

TERSANGKA pelaku menjual istri saat diperiksa petugas di Mapolres Tebingtinggi.

Suami Jual Istri Ke Lokalisasi Masuk Sel

Bocah Setahun Tewas Dalam Mesin Cuci PERINGATAN bagi para orang tua dengan anak balita. Tiffany Hebb yang menyangka, kebiasaan mengajak Ollie Hebb, anaknya yang masih berusia 21 bulan mencemplungkan pakaian ke mesin cuci berakibat fatal. Di luar pengawasannya, sang anak ternyata melakukan sendiri pekerjaannya dan tercebur dalam mesin cuci. Pagi itu, Tiffany kebingungan tak menjumpai anaknya. Ia mencari ke tiap sudut rumah, dan sang anak tak kunjung ditemukan. Tak dinyana, sang anak ternyata tenggelam dalam tabung mesin cuci. Ollie meninggal sehari kemudian. “Saya berlari melalui seluruh rumah saya, memanggil namanya dan tidak bisa menemukannya di mana pun,” kata Tiffany pada News Desert. “Tidak pernah berpikir bahwa ia akan berada dalam mesin cuci.” Lanjut ke hal A2 kol 4

perawatan di klinik Bidan M Siregar Desa Goti. Supir angkot, AAH, melarikan diri. Informasi Waspada peroleh di lokasi, peristiwa terjadi ketika angkot BB 1069 HC berpenumpang dua orang meluncur kencang dari arah Padangsidimpun menuju Batang Angkola. Tiba-tiba, dua pria bersepedamotor yang datang dari arah belakang memotong jalan dan nyaris menyenggol angkot. Saat itu, sopir angkot banting stir ke kiri. Ternyata ban angkot slip dan terbalik beberapa kali, kemudian berdiri kembali. Saat itulah, percikan api muncul dari angkot dan Lanjut ke hal A2 kol 5

Baca Pentas Demokrasi Aceh Di Halaman A7

Serampang - Palas jangan palak - He.... he....he....

Berita Utama

A2

WASPADA Rabu 4 April 2012

Polisi Sita 5 Ton BBM Dari Kilang Padi

Waspada/Bothaniman Jaya Telaumbanua

SEJUMLAH rumah warga di Jln. Diponegoro Desa Miga, Kecamatan Gunungsitoli, Senin (2/4) malam terbakar.

8 Rumah, 1 Gudang Terbakar Di Gunungsitoli GUNUNGSITOLI (Waspada): Sebanyak 8 unit rumah dan satu unit gudang di Jl. Diponegoro Desa Miga, Kec. Gunungsitoli, terbakar, Senin (2/4) malam. Selain itu satu rumah warga terpaksa dirubuhkan untuk mengantisipasi menyebarnya kobaran api. Peristiwa itu mengakibatkan 11 kepala keluarga, terdiri dari 68 jiwa kehilangan tempat tinggal.Namun tidak ada korban jiwa. Api berhasil dipadamkan setelah Pemko Gunungsitoli menurunkan satu unit mobil pemadam, satu unit mobil pemadam milik Pemkab Nias dibantu warga sekitar. Kerugian mencapai ratusan juta rupiah. Sementara Kapolres Nias melalui Kasat Reskrim, AKP. Eneli Hulu, SH yang dikonfirmasi wartawan mengatakan, hasil penyelidikan sementara penyebab kebakaran berasal dari kompor masak milik salah seorang korban. (a25)

ONH 2012 Bisa Turun Rp1 Juta JAKARTA (Antara): Ongkos biaya haji tahun 2012 bisa turun Rp1 juta dari yang diusulkan Kementerian Agama, kata Ketua Kelompok Kerja Fraksi Komisi VIII Partai Demokrat Muhammad Baqhowi. Dalam proposal Kementerian Agama yang disampaikan ke Komisi VIII DPR, ada penambahan Ongkos Naik Haji (ONH) 2012 hingga Rp5 juta. Penambahan itu dikarenakan bertambahnya biaya avtur (minyak pesawat) dan bertambahnya biaya pemondokan di Makkah. “Kemenag melalui proposalnya mengusulan bia-

ya ONH 3.900 dolar AS. Sebelumnya 3.300 dolar, naik 600 dolar, atau naik Rp5 juta yang harus dibayar oleh jamaah,” kata Muhammad Baqhowi di Gedung DPR RI, Jakarta, Selasa (3/4). Namun, Baqhowi menilai, biaya ONH tahun ini bisa tidak naik. Bahkan, kata dia, biaya ONH bisa turun satu juta rupiah. “Adanya dana APBN Rp1,1 triliun, ditambah dana optimalisasi (bunga setoran awal) tahun ini Rp1,88 triliun, sisa optimalisasi Rp200 miliar dan sisa dana operasional tahun lalu, bisa menutupi kenaikan pemondokan dan biaya penerbangan.”

Traffic Light ...

Proses yang akan dilakukan nantinya secara penunjukkan langsung dan tidak melalui proses tender, sehingga pengadaan traffic light yang rusak itu bisa langsung dilakukan. “Kalau menggunakan proses tender itu kan nanti akan lama waktunya, makanya untuk ini kita lakukan dengan PL,” ucap Armansyah. Ketika ditanya kapan selesainya pengadaan untuk traffic light tersebut, Armansyah menjawab kalau pengadaannya itu masih tergantung kepada persetujuan dari Wali Kota Medan. “Setelah dapat persetujuan nanti dan anggarannya keluar untuk pengadaan itu tidak akan lama, karena pengadaannya tidak harus baru keseluruhannya hanya perbaikan dan pembelian lampu, jadi tidak akan memakan waktu yang lama,” katanya. Dikatakan Armansyah, tidak semua traffic light harus dilakukanpengadaanbaru,sebabbeberapa traffic light yang rusak itu merupakantiangrendah,sedangkan yang tiang tinggi tidak rusak. Ada sebagian juga yang boksnya hancur dan alat control serta countdownnya yang rusak. “Jadi tidak semua alatnya yang harus diganti,”terangArmasnyah.(m50)

Begitu juga untuk simpang Jalan HM Yamin/Jalan Gaharu Rp60.974.000, simpang Jalan Sudirman/ Jalan S Parman Rp75.032.000, simpang Jalan Jamin Ginting/Jalan Iskandar Muda Rp141.006.000, simpang Jalan Jamin Ginting/Jalan Dr Mansyur Rp260.862.000, Jalan Ngumban Surbakti/Jalan Setia Budi Rp161.014.000 dan simpang Jalan Sisingamangaraja/ Jalan HM Jhoni Rp40.966.000. Disebutkannya, anggaran yang diajukan ke Pemko Medan merupakan anggaran yang nantinya akan dialokasikan dari anggaran bencana, karena perbaikan traffic light itu terjadi karena adanya keadaan darurat akibat aksi unjukrasa yang dilakukan sejumlah elemen dalam menolak rencana kenaikan BBM.

PKS Langgar ... Namun, Syarif tidak menjelaskan apa yang dia maksud dengan“ya ayo” di akhir kalimatnya itu. Kemelut posisi PKS ini bermula dari sikap penolakan mereka terhadap rencana kenaikan harga bahan bakar minyak. PKS dianggap membangkang. Sehingga sejumlah partai koalisi meminta PKS meninggalkan koalisi dan duduk manis di kursi oposisi. (vvn)

Mendagri Berhentikan ...

Alasannya sama, telah diperoleh putusan hukum berkekuatan hukum tetap (inkrach). Menurut Mendagri, keputusan pemberhentian ketiga kepala daerah telah sesuai dengan Jawaban Problem Catur, UU No. 32 tahun 2004 tentang Pemerintahan Daerah yang TTS Dan Sudoku mengamanatkan pemberhenDari Halaman Sport. tian bagi kepala daerah yang telah dihukum dengan keputusan berkekuatan hukum tetap. Jawaban Problem Catur: Sebagaimana diwartakan, mantan Camat Barumun, Kabupaten Tapsel, Basyrah Lubis 1. Gd-c6+, Rf8. (saat ini menjabat Bupati Palas2. e7+, Rf7. red) divonis majelis hakim Mahkamah Agung (MA) dengan Ke3. e8(M)+mat. (Jika tua Majelis, H Mansur Kartayasa beserta anggota M Zahruddin 1. ...., BxGc6. Utama M dan R Imam Haryadi, pidana penjara 6 bulan dengan 2. Bb8+, Bc8. masa percobaan 1 tahun karena terbukti sah dan meyakinkan 3. BxB+mat. bersalah melakukan tindak pidana memalsukan surat. Majelis hakim MA yang meJawaban TTS: meriksa perkara tersebut dalam TTS Topik Kesehatan salinan putusan MA Nomor 1021 K/Pid/2009 menyatakan, D E M A M N Y E R I S P S kalau pidana tersebut tidak perN I A E E P lu dijalankan terdakwa, kecuali apabila dikemudian hari dengan R E F A G A N A M N E S I A putusan hakim terdakwa dinyaR R A A A S takan terbukti bersalah melaG I L A H A S T A K F M kukan tindak pindana sebelum masa percobaan selama 1 I I I U tahun terakhir.(j02) M A E K E D O A I M K O B A U S H A I D R

N T R I K A E K T E R A N E E R S E T K A A U G U S A R A E E S U S I T A

R I E S A P H A I R A D N K E R G M A I R R S I

Jawaban Sudoku: 8 5 6 4 2 9 7 3 1

7 2 9 5 1 3 6 8 4

3 1 4 8 7 6 9 2 5

5 7 2 6 4 1 3 9 8

6 8 3 2 9 5 4 1 7

4 9 1 3 8 7 2 5 6

9 4 8 1 6 2 5 7 3

2 6 5 7 3 8 1 4 9

1 3 7 9 5 4 8 6 2

Ada-ada Saja ... mengonsumsi 150 kg sampah organik per tahun. Hal itu diharapkandapatmengurangilimbah di lingkungan desa dan sebaliknya membantu banyak keluarga dengan berternak telur ayam. Hingga kini sudah ada 15 sampai 20 keluarga yang berminat memelihara ayam tersebut sejak rencana itu dilakukan pada September 2011. “Saya kira itu adalah lelucon, tapi kemudian kami menyadari bahwa itu adalah ide yang sangat baik. Ini juga akan memperkuat jaringan masyarakat, sama sepertimemeliharakucingdananjing. Mereka juga pasti akan menjagaayam-ayamtersebut,”ujarwali kota Pince Lydie Pasteau, seperti dikutip dari BBC, Senin (2/4). Pasteau juga berharap ayam dapat mengurangi biaya pembuangan limbah. (ok/rzl)

TEBINGTINGGI (Waspada): Polres Tebingtinggi menyita sedikitnya 5 ton Bahan Bakar Minyak (BBM) solar dan premium diduga ditimbun sejumlah pengusaha kilang padi di kawasan Tebingtinggi dan Kec. Tebingsyahbadar, Kab. Sergai, Selasa (3/4). “Hingga saat ini sudah 5 ton BBM terdiri dari 18 drum serta sejumlah jerigen berisi solar dan premium kita amankan selama berlangsung operasi Dian (api). Diantaranya dari kilang padi di Desa Binjai, Kilang Padi Desa Paya Pasir, depan gudang Bulog, Kec. Tebing Syahbandar, Sergai, Kilang Padi Brohol Tebingtinggi. Operasiiniakanterusdigelar,“kata KapolresTebingtinggi, AKBP Andi Rian Djajadi, SIK ketika dikonfirmasi melalui Kasat Reskrim

AKP Lili Astono, Selasa (3/4). Dikatakannya, pengusaha kilang padi tersebut membeli minyak ke SPBU terdekat dengan menggunakan jerigen. Minyak tersebut dikumpul dan disimpan dalam drum. ‘’Seharusnya pengusaha industri seperti kilang padi membeli minyak industri, bukan di SPBU. Minyak bersubsidi di SPBU hanya untuk pelaku UKM,’’ katanya dan menambahkan, perbedaan harga minyak subsidi dengan industri yakni, untuk industri Rp 6.500./ liter, minyak subsidi di SPBU seharga Rp 4.500./liter.“Sampai saat ini, kita sudah tetapkan dua tersangka dalam kasus penimbunan dan penyalahgunaan peruntukan BBM tersebut.Mereka dikenakan UU Migas,” ucap Kasat. Sementara itu, Humas Ki-

lang Padi Hasil Jaya Desa Binjai, Kec. Tebingsyahbadar, Sergai Sarwono kepada Waspada mengatakan, pembelian BBM ke SPBU beradasarkan surat keterangan dan rekomendasi dari Dinas Perindustrian Perdagangan dan Pasar Pemkab Sergai dengan No. 590/P2P/XII/2011 tertanggal 22 Desember 2012, ditandatangani Dra. Hj. Dewi Iriani,MPd. Surat keterangan itu dikeluarkan sebagai rekomendasi pengisian BBM di SPBU untuk usaha kecil dan berlaku sampai dengan 31 Desember 2012. “Semua kilang padi di wilayah ini memiliki surat rekomendasi dari Dinas Perindustrian Perdagangan dan Pasar Sergai untuk pembelian BBM ke SPBU, mereka tidak akan berani

membeli ke SPBU bila tidak ada surat rekomendasi,” ucap Sarwono. Terkait surat rekomendasi tersebut, Kasat Reskrim AKP Lili Astono mengatakan akan memanggil pihak Dinas Perindustrian Perdagangan dan Pasar Sergai. “”Kita akan pertanyakan, apakah industri kilang padi yang memiliki 4 mesin dompeng itu termasuk katagori usaha kecil, apa perbedaan usaha ‘industri’ dengan ‘home industri’,” tandasnya. Sita Minah Sementara itu, satu unit mobil jenis L-300 pick-up BK 8195 CJ dikemudikan Konstan Sinaga,47, warga Desa Pancurbatu, Kec. Merek, yang mengangkut 67 jerigen BBM jenis minyak tanah (minah), diaman-

Waspada/Muhammad Idris

PERSONIL Sat. Reskrim Polres Tebingtinggi mengamankan sejumlah drum minyak solar dari kilang padi. kan tim Polres Tanah Karo di Desa Sukanalu, Kec. Barusjahe, Minggu (1/4). “Ketika ditanyakan dokumenminyaktanahbersubsididan izin angkutnya, sopir tak dapat menunjukkan kepada petugas,” ujar Kasubbag Humas Polres

Tanah Karo, AKP Sayuti Malik, saat dikonfirmasi di ruang kerjanya, Selasa (3/4).Pengendara mobil dan pemilik minah dikenakan wajib lapor. Sementara, mobil dan 67 jerigen berisi minah bersubsidi disita di Mapolres Tanah Karo. (a11/cal/a36)

Pemilik 3,6 Kg Sabu Dituntut Seumur Hidup TANJUNGBALAI (Waspada): Jaksa Penuntut Umum (JPU) Samian dalam sidang di Pengadilan Negeri Kota Tanjungbalai, Selasa(3/4) menuntut terdakwa pemilik 3,6 kilogram sabu dari Malaysia, Ridhonya alias DO, 37, dengan hukuman seumur hidup. Terdakwa yang semula santai duduk di kursi pesakitan, tiba-tiba pucat begitu mendengar tuntutan tersebut. Dalam amar tuntutannya, JPU menerangkan, terdakwa dinyatakan terbukti bersalah melanggar pasal 112 ayat (2) junto pasal 132 ayat (1) Undang-undang RI No. 35 Tahun 2009 ten-

tang Narkotika. MenurutJPU,halyangmemberatkan terdakwa, tidak mendukung program pemerintah dalam pemberantasan narkoba, terdakwa sudah pernah dihukum 2 kali dalam kasus yang sama. Tidak ada yang meringankan terdakwa. “Meminta kepada majelis hakim untuk menetapkan terdakwa dengan penjara seumur hidup dan denda Rp 1 miliar subsidair 5 bulan penjara,” tegas JPU saat membacakan tuntutannya di depan Majelis Hakim Egi Novita, Aurora Quintina dan Ricki Zulkarnaen. Usai mende-

Wanita 80 Tahun Daratkan Pesawat Dengan Selamat STURGEON BAY (AP): Seorang wanita berusia 80 tahun berhasil mendaratkan pesawat bermesin ganda di timurlaut Wisconsin setelah sang pilot

Presiden Instruksikan ... merupakan salah satu cara untuk mengurangi subsidi pemerintah di sektor energi yang bisa mengurangi defisit dan memperbaiki postur APBN. Pemerintah sebelumnya berencana menaikkan harga BBM bersubsidi namun tidak bisa dilakukan karenanya hanya bisa melakukan penghematan untuk menyelamatkan APBN.

Menteri Tidur ... Faisal menjelaskan, Pak Menteri ke sana dengan KRL JabodetabekCommuter Linedari Stasiun Sudirman, Jakarta Pusat sekitar pukul 20:30. Kemudian, mantan Direktur Utama PLN ini transit di Stasiun Manggarai, Jakarta Selatan dan selanjutnya dengan KRL Ekonomi ke Bekasi. Sepanjang jalan, tambah Faisal, Pak Menteri berdialong dengan penumpang untuk memastikan apakah pelayanan kereta sudah semakin baik atau tidak. “Bapak turun di Stasiun Klender, Jakarta Timur dan sejenak meninjau tingkat kebersihan

Wartawati Senior ... “Sebentar lagi keluarga besar dan sahabat-sahabat saya datang. Saya senang sekali, “ujarnya, membuka percakapan pagi itu. Sambil berbincang, sesekali tangannya sibuk menata sejumlah pernak-pernik perak di atas meja tamu. Memang, saat Waspada datang di kediamannya di Apartemen di bilangan Dharmawangsa Jakarta Selatan, isteri BM Diah (almarhum) ini tengah sibuk mempersiapkan acara open house memperingati hari kelahirannya. Selasa, 3 April 2012, legenda jurnalistik di Indonesia ini genap berusia 95 tahun. Tentu saja, usia demikian membuat Herawati sarat dengan pengalaman. Tapi tutur katanya halus dan lembut, tidak jumawa dan penuh kehati-hatian. Orang bilang, itulah ilmu padi. Dan Herawati, sudah melakukan itu. Padahal, perannya dalam perjuangan kemerdekaan Indonesia tidak dapat dianggap remeh. Kiprahnya di masa lalu sebagai seorang jurnalis dijalaninya dengan penuh semangat kemerdekaan. Perjalanan jurnalistik Herawati semakin bersinar saat meliput untuk koran Harian Merdeka yang dibangun sang suami pada 1 Oktober 1945. Koran inilah yang pertama kali mempublikasikan naskah asli teks proklamasi. “Naskah proklamasi itu sempat dibuang Sayuti Melik. Jiwa wartawan Pak Diah mun-

ngarkan tuntutan JPU, terdakwa melalui kuasa hukumnya meminta waktu seminggu untuk pembacaan pledoi. Sidang ditunda hingga minggu depan dengan agenda pembelaan atau pledoi terdakwa. Ridhonya alias DO, didakwa memiliki 3.688,32 gram sabu yang rinciannya, 3 bungkus besar plastik transparan berisi narkotika jenis sabu seberat 3.078,-69 gram, dan 6 bungkus plastik tran-

Denny Indrayana Akan Dievaluasi Menkum HAM

yang merupakan suaminya pingsan dan meninggal. Sheriff Door County, Terry Vogel, mengatakan pusat bandara diberitahu setelah pukul 5 sore Senin (2/4) bahwa satu pesawat Cessna berhasil mendarat darurat sekitar 6 mil di selatan Teluk Sturgeon. Pilot pesawat itu, seorang pria berusia 81 tahun, menderita penyakit tiba-tiba dan jatuh pingsan. Istrinya, yang menjadi penumpang, terpaksa mener bangkan pesawat itu. Dia mampu mendarat di Bandara Cherryland di Door County. Istri sang pilot menderita cedera ringan. Suaminya dinyatakan tewas. (m23)

JAKARTA (Waspada): Menteri Hukum dan HAM Amir Syamsuddin, bereaksi keras terhadap tuduhan penamparan kepada sipir penjara Pekan Baru, Riau, yang diduga dilakukan Wakil Menteri Hukum dan HAM, Denny Indrayana. Kepala Direktorat Jenderal Lembaga Pemasyarakatan, Sihabuddin, mengatakan Amir Syamsuddin akan memutuskan nasib wakilnya itu, Rabu (4/4). “Ya mungkin besok. Kita buat laporan dari hasil rapat dan kajian Menkumham. Nanti mungkin akan ada evaluasi atau bagaimana,” katanya saat dihubungi, Selasa (3/4). Kendati demikian, Sihabuddin enggan menjelaskan bentuk evaluasi tersebut. Bila Denny terbukti melakukan penamparan maka Denny bisa terancamdicopotdarijabatannya. Denny Indrayana disebutsebut melakukan tindak kekerasan kepada sipir penjara saat

stasiun itu,” kata Faisal yang berasal dari Aceh ini. Lalu Dahlan menumpang ojek ke Perumnas Sentra Timur. Dahlan Iskan sudah merencanakan untuk menginap di rumah susun yang identik dengan rumah bagi kalangan sederhana itu. Setibanya di rumah susun tersebut, Dahlan ditemani Direktur Utama Perum Perumnas Himawan Arief Sugoto meninjau lantai demi lantai. Dahlan juga disambut antusias penghuni rumah susun tersebut yang dengan senang hati menjawab berbagai pertanyaan sang menteri terkait kondisi dan fasilitas rumah susun.

“Usai meninjau dan berdialog dengan sejumlah warga, sekitar pukul 22:00, bapak berpamitan untuk tidur di salah satu kamar di rumah susun tersebut,” tutur Faisal, mantan ajudan Menteri BUMN Mustafa Abubakar. Faisal menambahkan, peninjauan mendadak ini untuk memberikan dorongan kepada jajaran staf Perumnas agar bekerja lebih keras membangun perumahan untuk rakyat. Keputusan menginap di rumah susun dilakukan pada Minggu (1/4) siang usai berdialog dengan seluruh pejabat Perumnas seIndonesia. (cmz)

cul. Diambilnya naskah itu dan diterbitkan di Harian Merdeka. Sekarang naskah itu disimpan di Arsip Nasional,” ujarnya. Selanjutnya, Herawati membangun koran Indonesian Observer, atas permintaan Perdana Menteri Ali Sastroamidjojo yang saat itu menjabat ketua umum Konferensi Asia Afrika di Bandung. Itu terjadi pada 1955. “Saat itu, Indonesia tidak punya koran berbahasa Inggris. Jadilah kami ditantang untuk menerbitkan koran berbahasa Inggris,” ujar wanita yang mengecap pendidikan jurnalistik dan sosiologi di Amerika Serikat ini. Tapi jauh sebelum itu, Herawati adalah penerus media ‘Keluarga’ yang terbit pada 1940. Itulah warisan ibundanya. Dari situ, Herawati muda belajar menerbitkan media. Herawati pun mengungkapkan bahwa dahulu dia termasuk wartawan yang terbilang berani dan nekat. “Saya itu dulunya koboi, tidak pernah takut dalam meliput. Tapi wartawan saat ini lebih berani dan berkualitas. Jurnalis perempuan dan lelaki sama-sama berprestasi,” katanya dengan mata berbinar. Kini, di tengah kegiatan kesehariannya, Herawati masih tetap menyimak situasi terkini. Kadang dia juga menulis dan sesekali berkumpul dengan para jurnalis senior lainnya. Sekedar membicarakan hal-hal krusial dan terkini di negara ini. Tapi kegiatan rutin yang pa-

ling disukainya kini adalah bermain bridge. Setidaknya seminggu dua kali, yakni pada hari Senin dan Rabu, Herawati berinteraksi dengan rekan-rekannya sesama pecinta olah raga bridge. Dia mengenal bridge saat sang suami, BM Diah bertugas sebagai diplomat di Bangkok. “Beberapa hari lalu saya senang juga karena berhasil meraih juara pertama lomba bridge yang diadakan women international club. Saya yakin kesenangan saya yang satu ini membuat saya terhindar dari penyakit pikun,” katanya, sambil tertawa renyah. Kesukaan lain ibu 3 anak, 12 cucu dan 13 cicit ini adalah bercocok tanam. Jika tak sedang berada di apartemennya di kawasan Dharmawangsa, Herawati tinggal di kawasan Cipayung. Di sana, kata Herawati, dia bisa lebih leluasa menyalurkan hobinya berkebun. Sejumlah tanaman hias seperti suplir dan anggrek menjadi koleksinya. Selain hobi berkebun, dia juga menyukai lukisan dan kain tradisional. Untuk lukisan, dia menyukai karya Affandi. Kini, Herawati Diah hidup damai bersama anak-anak, para cucu dan cicit. Saking sayangnya kepada mereka yang dicintai, tak jarang dialah yang mendatangi mereka. “Bagi saya, keluarga adalah semangat hidup. Cucu-cucu dan cicit-cicitsayaadalahkegembiraan yang membuat saya bahagia sampai sekarang,”pungkas Herawati. (dianw)

Al Bayan ... Kulit mempunyai beberapa alat penerima, untuk perasaan sakit, rabaan, tekanan, aliran udara di badan, panas, dingin, pancaran sinarsinar gamma, rontgen, ultraviolet, kosmis, infa merah, dan lain-lain. Maha suci Alah yang Maha Pengcipta. Nikmat Allah yang manakah lagi yang engkau dustakan? Tanya Allah berulang-ulang dalam surat Ar-rahman. Islam mengajarkan thaharah (bersuci), mandi, wudhuk, mandi wajib, dan lain-lain agar kulit terpelihara. Kulit yang sehat jauh dengan penyakit. Islam menganjurkan kita menyayangi kulit sejak di dunia sampai di akhirat. Karena itu seorang yang beriman tidak mau berbuat dosa, serba

sparan berisi 609,64 gram sabu. Barang itu disita petugas Polres Tanjungbalai dari tangan dua kurir SEN, 31, warga Jl. DTM Abdullah, Kel. TB Kota III, Kec. Tanjungbalai Utara, dan Mis, 34, warga Dusun V, Desa Hessa Air Genting, Kab. Airbatu, Kab. Asahan, saat melabuhkan sampan di tangkahan Dubes Jl. DI Panjaitan, Kel. TB Kota III, Kec. Tanjungbalai Utara 25 Juni 2011. (a14)

kulit manusia yang berdosa hari akhirat akan dibakar dalam neraka. Jika kulit itu habis terbakar, Allah menggantikan dengan kulit yang baru agar manusia berdosa itu merasakan akibatnya. “Sesungguhnya orang-orang yang kafir kepada ayat-ayat Kami, kelak akan Kami masukkan mereka ke dalam neraka. Setiap kali kulit mereka hangus, Kami ganti kulit mereka dengan kulit yang lain, supaya mereka merasakan azab. Sesungguhnya Allah Maha Perkasa lagi Maha Bijaksana”. (QS. An-Nisa:56) Jika kulit ingin selamat, berusahalah untuk tidak masuk neraka. Kulit penghuni surga terlindungi dalam kamar-kamar yang nyaman tanpa bahaya. Subhanallah. Kulit penghuni surga memang selalu bersih, harum dan putih bersih. Allahu Akbar.

menggerebek transaksi narkotika dan obat terlarang di Lapas Pekan Baru, pada Senin 2 April 2012 dini hari. Korban aksi main hakim sendiri ini terjadi kepada sipir Kelas II Pekanbaru. Denny membantah tuduhan tersebut. Dia menolak disebut telah menggampar sipir pada penggerebekan kemarin. “Tidak benar berita yang mengatakan saya memukuli dan menampar petugas. Masa tampang saya tampang menampar,” kata Denny. Sihabuddin mengatakan dia telah memanggil Kakanwil Kemenkumham Riau dan Kepala LapasKelasIIPekanbaru.Diameminta penjelasan kepada mereka terkait peristiwa penamparan tersebut. “Amir Syamsuddin meminta agar melihat masalah ini secara proporsional dan seobjektif mungkin,” kata Sihabuddin. (ok)

DPR Hanya ... mereka yang duduk di DPR menjadi representasi dari partai masing-masing,” kata Aulia. Apalagi, lanjut Aulia Andri, dalam UU Parpol menyebutkan bahwa partai berhak me-recall anggota parlemen yang tidak sejalan dengan keputusan partai. “Ini kan makin menegaskan bahwa kedudukan seorang anggota DPR atau parlemen merupakan wakil parpol, bukan wakil rakyat. Nah, karena itu sangat wajar keputusan yang mereka ambil itu keputusan yang berbasis pada keputusan yang diambil partainya, bukan apa yang dikehendaki rakyat,” jelas Aulia. Menurut Aulia, keputusankeputusan DPR yang selalu tidak berpihak kepada rakyat tersebut, selain disebabkan oleh sistem partai tersebut, disinyalir ada kehendak segelintir penguasa atau sekelompok orang yang menginginkan agar harga BBM harusdinaikkan.“KeputusanDPR dalam sidang paripurna pengajuan APBN-P 2012 kemarin, ini bukan semata-mata keinginan pemerintah sendiri, tetapi ada tekanan pihak asing kepada pemerintahan SBY untuk menaikkan harga BBM,” paparnya.

Waspada/Muhammad Idris

TERSANGKA penjual istri saat diperiksa petugas di Mapolres Tebingtinggi.

Suami Jual Istri Ke Lokalisasi Masuk Sel TEBINGTINGGI (Waspada): Seorang suami tega menjual istrinya ke sebuah lokalisasi. Tak terima diperlakukan seperti itu, sang istri melaporkannya ke Mapolres Tebingtinggi. Kini, sang suami ditahan Polres Tebingtinggi guna mempertanggungjawabkan perbuatannya. Tersangka TS alias Kodrat, 25, warga Lingk II, Kel. Badak Bejuang, Kec. Tebingtinggi , Kota, Kota Tebingtinggi ditangkap aparat Polres Tebingtinggi karena laporan istrinya Bunga, 17, (bukan nama sebenarnya) warga Jl. Bukit Barisan, Kel. Tanjung Marulak, Kec. Rambutan, Tebingtinggi. Informasi diperoleh Waspada di kepolisian, Selasa (3/4), TS dilaporkan istrinya 2 Oktober 2011. Dalam laporannya, sang istri mengatakan ia diperjualbelikan oleh suaminya di lokalisasi warung bubur di Desa Naga Kesiangan, Kec. Tebingtinggi, Kab. Serdang Bedagai. Ia mengaku dipaksa suaminya untuk melayani pria hidung belang. Bila menolak ia dipukuli. Sejak dilaporkan istrinya, TS melarikan diri.Namun, Senin (2/4) malam berhasil ditangkap petugas. Terbongkarnya perbuatan TS, karena sang istri menghubungi keluarganya dan menceritakan kejadian yang dialaminya. Mendengar itu, keluarga Bunga menjemputnya di lokalisasi warung bubur. Sementara, dalam pemeriksaan,TS ayah satu anak ini menolak dikatakan menjual istrinya. Kepergian mereka ke warung bubur atas ajakan istri. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, SIk ketika dikonfirmasi melalui Kasubbag Humas AKP Ngemat Surbakti mengatakan TS ditangkap atas tuduhan menjual istri dan menganiaya. (a11) Dia menyebutkan, dalam hal ini pemerintah sendiri tidak berdaya untuk melawan itu. Apalagi, saat ini hampir di setiap negara kenaikan harga BBM dilakukan, seperti misalnya di Iran. Presiden Iran menaikkan harga BBM-nya, tetapi kenaikan harga BBM di Iran dilakukan dengan cara yang terukur. Namun di Indonesia rencana kenaikan harga BBM tidak dilakukan dengan terukur, sehingga membuat rakyat tidak percaya kepada kebijakan pemerintah. Hal senada disampaikan pengamat politik dari Universitas Sumatera Utara (USU) Warjio, PhD. Ia menilai sikap para anggota dewan di parlemen saat ini menunjukkan ketidakseriusan para wakil rakyat tersebut dalam memperjuangkan persoalan-persoalan rakyat, seperti rencana kenaikkan harga BBM. “Mereka tidak tanggap terhadap persoalan-persoalan rakyat seperti penolakan rakyat terhadap kenaikan harga BBM,” ujarnya. Hal ini memperlihatkan kepada masyarakat bahwa kepentingan-kepentingan politik dan kelompok-kelompok di dalam partai lebih diprioritaskan daripada memikirkan kepentingan rakyat. “Karena tentu saja dalam

hal ini ada deal-deal politik mewakili persoalan yang dibuat pemerintah oleh mereka. Persoalannya menunjukkan bahwa minyak tetap naik tetapi kenaikannya ditunda,” ujarnya. Warjio mengatakan, semestinya DPR itu dipilih untuk menyampaikan aspirasi rakyat secara keseluruhan kepada eksekutif, namun dalam hal ini menunjukkan bahwa ada kepentingan kelompok meskipun seolah-olah dari masing-masing partai menyatakan menolak kenaikan harga BBM. “Padahal sebenarnya,itubentukketidaksungguhan legislatif untuk betul-betul memperjuangkan kepentingan masyarakat secara luas,” ujarnya. Seharusnya, secara kalkulasi ekonomi naik atau tidaknya harga BBM bisa diperhitungkan bahwa dalam kondisi seperti itu, harga BBM bisa tidak naik. Tapi pada kenyataannya hal ini sengaja mengulur waktu terhadap kenaikan harga BBM untuk dilakukan pada waktu berikutnya. “Tentuiniakanbermuatanpolitis, dimana kepentingan elit dan partai politik maupun kelompokkelompok itu sendiri terpenuhi atau tidak. Ini sebenarnya akalakalan dari para anggota dewan,” ujarnya. (m41)

Berita Utama

A2 Polling Pilkada Aceh

Waspada/Gito rolies

Kamar Mayat RSU Meuraxa Nyaris Hangus BANDA ACEH (Waspada): Kamar mayat Rumah Sakit Umum nyaris hangus terbakar, Selasa (3/4), sekitar pukul 17.30. Petugas jaga dibantu keluarga pasien dan petugas pemadam kebakaran berhasil memadamkan api yang berasal dar i r uang pembakaran limbah medis bersebelahan dengan kamar mayat. Direktur RSU Meuraxa dr. Dewi Lailawati di lokasi menyebutkan penyebab kebakaran terjadi karena percikan api saat pembakaran limbah medis. “Pembakarannya hampir selesai tapi mesin pembakaran tiba-tiba mengeluarkan percikan api menyambar minyak solar,” ujarnya. Setelah muncul percikan api kemudian terjadi ledakan saat jeriken penampung solar yang berada tidak jauh dari mesin pembakaran limbah medis tersebut terbakar. Api membesar dan menyilat kursi dan kertas. Tidak banyak inventaris rumah sakit di ruang pembakaran limbah medis yang bisa diselamatkan, namun barang-barang di ruang kamar mayat berhasil diselamatkan, seperti peti mayat dan beberapa peralatan lainnya. “Kebetulan juga tidak ada mayat,” kata Dewi.(b08/cb01)

Calhaj Lansia ....

Menag mengatakan, Kemenag saat ini sedang menganalisa jumlah sementara jamaah usia lanjut, secara berurutan. “Mereka tetap berangkat didampingi pendamping, tapi pendamping yang sudah terdaftar,” kata menteri. “Misalnya, jamaah usia 80 tahun ada 5.000 orang, katakan pendampingnya juga 5.000 orang,” imbuhnya. Persiapan lain yang dilakukan Kemenag, kata menteri, yaitu pemondokan di Makkah, apalagi terkait dengan pembongkaran gedung di sekitar Masjidil Haram, berdampak pada kenaikan harga sewa pemondokan. “Fasilitas ini menjadi perhatian, sejak jauh-jauh hari petugas haji di Arab Saudi sudah mencarikan pondokanpondokan terdekat bagi jamaah agar mereka semakin puas. Sampai saat ini kita sudah dapat untuk 60 ribu orang,” ujarnya. Pada penyelenggaraan haji tahun 2011 seluruh pemondokan jamaah haji di Makkah berada di ring I (maksimal 2.500 meter dari Masjidil Haram), sehingga tidak ada lagi ring II atau jamaah yang tinggal lebih dari jarak 2.500 meter. Sedangkan tahun 2010 pondokan jamaah di ring I

memiliki jarak maksimal 2.000 meter dari Masjidil Haram dan ring II maksimal 4.000 meter. Jamaah haji di ring I mencapai 63 persen dari seluruh jamaah dan ring II hanya 37 persen, padahal pada tahun 2009 jamaah di ring I hanya 27 persen dan di ring II 73 persen. \Menag juga menjelaskan, Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun ini masih dibahas di DPR, ada kemungkinan mengalami kenaikan. Hal itu dipengaruhi oleh kenaikan harga BBM dan pemondokan di Makkah. “BBM naik gak naik, harga avtur kan di pasar internasional naik, tinggal bagaimana harga di Indonesia, tapi harga beli naik,” ujarnya.

JK Jemput Jenazah Syamsul Mu’arif Di Singapura

JAKARTA (Antara): Mantan Wakil Presiden M Jusuf Kalla menjemput jenazah sahabatnya, mantan Menteri Komunikasi dan Informasi Syamsul Mu’arif, yang meninggal dunia di Singapura, Selasa (3/4) pagi. “Pak Jusuf Kalla jemput langsung jenazah almarhum Syamsul Mu’arif di Singapura,” kata staff khusus Jusuf Kalla, Egy Massadiah di Jakarta, Selasa.

Suami Jual Istri .... Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Gd-c6+, Rf8. 2. e7+, Rf7. 3. e8(M)+mat. (Jika 1. ...., BxGc6. 2. Bb8+, Bc8. 3. BxB+mat.

Jawaban TTS: TTS Topik

D E M A M N I R E F A G R R G I L A I I M A N E K E D O K A I M K O R B A U S H A I D R E

Kesehatan

N Y E R I A E A N A M N A A H A S T A I T R I K A E T E R A N E E S E T K A A U G U S A R A E S U S I T A

S P S E P E S I A A S K F M U R I E S A P H A I R A D N K E R G M A I R R S I

Jawaban Sudoku: 8 5 6 4 2 9 7 3 1

7 2 9 5 1 3 6 8 4

3 1 4 8 7 6 9 2 5

5 7 2 6 4 1 3 9 8

6 8 3 2 9 5 4 1 7

4 9 1 3 8 7 2 5 6

9 4 8 1 6 2 5 7 3

2 6 5 7 3 8 1 4 9

1 3 7 9 5 4 8 6 2

ditangkap aparat Polres Tebingtinggi karena laporan istrinya Bunga, 17, (bukan nama sebenarnya) warga Jl. Bukit Barisan, Kel. Tanjung Marulak, Kec. Rambutan, Tebingtinggi. Informasi diperoleh Waspada di kepolisian, Selasa (3/4), TS dilaporkan istrinya 2 Oktober 2011. Dalam laporannya, sang istri mengatakan ia diperjualbelikan oleh suaminya di lokalisasi warung bubur di Desa Naga Kesiangan, Kec . Te b i n g t i n g g i , K ab. Serdang Bedagai. Ia m e n g a k u d i p a k s a suaminya untuk melayani pria hidung belang. Bila menolak ia dipukuli. Sejak dilaporkan istrinya, TSmelarikan diri. Namun, Senin (2/4) malam berhasil ditangkap petugas. Terbongkarnya perbuatan

Al Bayan ....

lebih kurang sepuluh helai bulu (rambut), satu meter urat darah halus, 100 kelenjar keringat, 3000 sel perasa, empat meter urat syaraf, dam 25 aparat pencatat tekanan. Kulit mempunyai beberapa alat penerima, untuk perasaan sakit, rabaan, tekanan, aliran udara di badan, panas, dingin, pancaran sinar-sinar gamma, rontgen, ultraviolet, kosmis, infa merah, dan lainlain. Maha suci Alah yang Maha Pengcipta. Nikmat Allah yang manakah lagi yang engkau dustakan? Tanya Allah berulangulang dalam surat Ar-rahman. Islam mengajarkan thaharah (bersuci), mandi, wudhuk, mandi wajib, dan lainlain agar kulit terpelihara. Kulit yang sehat jauh dengan penyakit. Islam menganjurkan kita menyayangi kulit sejak di dunia sampai di akhirat. Karena itu seorang yang beriman

Rabu 4 April 2012

OTK Bakar Warkop Di Batangtoru B A T A N G T O R U (Waspada): Satu warung kopi m i l i k O K H a z m i Us m a n Siregar, yang berada di pinggir Jalinsum Desa Aek Pining, Kec. Batangtoru, dibakar orang tak dikenal (OTK), Selasa (3/4) dini hari. Personil Polsek Batangtoru yang kebetulan melintas segera memberitahukan kepada

Hasil polling ini dihitung berdasarkan suara pembaca Waspada yang dikirim dalam bentuk kupon yang telah disediakan (lihat halaman Pilkada Aceh). Metode polling yang digunakan tidak untuk mewakili keseluruhan suara pemilih dalam Pilkada Aceh, tapi hanya untuk mencari tahu suara pembaca Waspada terhadap kandidat yang muncul dalam Pilkada Gubernur Aceh maupun pemilihan bupati/wali kota yang ada di Aceh. Redaksi membuka peluang sebesar-besarnya kepada para pembaca Waspada untuk mengisi kupon polling berhadiah ini.(red)

WASPADA

PASANGAN calon Walikota Banda Aceh Aminullah Usman dengan Muhibban sedang berkampanye, Selasa (3/4) di Stadion Dimurtala Banda Aceh.

Aminullah-Tgk Muhiban Janji Tingkatkan Ekonomi Rakyat BANDA ACEH (Waspada): Kampanye akbar pasangan calon Walikota dan Wakil Walikota Banda Aceh Aminullah Usman dan Tgk H Muhibban dibanjiri massa dari segala penjuru dan selama musim kampanye pasangan ini paling banyak dihadiri massa pendukung. Massa Aminullah dan Tgk Muhibban sejak pukul 15.00 Selasa (3/4) sore sudah memadati tempat parkir stadion Dirmurtala Banda Aceh. Kendaraan roda dua empat , pick up dan jenis lainnya— yang seluruhnya ditempeli gambar dan stiker mendukung Aminullah-Muhibban ini, terpaksa parkir di halaman masjid, Lampriek, Banda Aceh. Habis Shalat Ashar, massa terus berbondong-bondong memadati areal kampanye. Mereka mengenakan kaos oblong putih bertuliskan, Aminkan kota Banda Aceh. Jargon Aminullah Usman-Tgk

H Muhibban A.Hajat. Suasana bertambah ramai dengan tampilnya artis lokal , Sabirin Lamno dan penyanyi lainnya. Aminullah Usman sebagai calon Walikota Banda Aceh ikut larut dalam suasana sambil menyanyikan sebuah lagu bernada gembira yang menggambarkan kemenangan untuk pasangan yang konsen terhadap kemajuan ekonomi warga kota Banda Aceh itu. Aminullah Usman dihadapan hampir delapan ribu pendukungnya mengupas data tentang pengangguran dan merosotnya perekonomian masyarakat Banda Aceh. Ia menjanjikan akan memperhatikan peningkatan ekonomi rakyat, sehingga kehidupan warga kota jauh lebih baik. “Pembangun gedung tidak bisa meningkatkan ekonomi rakyat,” tegas bankir yang sukses mengelola PT BPD Aceh, dari terburuk menjadi sehat itu.

Ketua DPD Golkar Aceh, Sulaiman Abda sangat yakin Banda Aceh ditangan Aminullah Usman-Tgk Muhibban akan berkembang dan maju, terutama pada sektor ekonomi. Wakil Ketua DPRA ini tidak ragu dengan kemampuan Aminullah Usman. “ Dia aset Aceh dan saat ini ia memilih mengabdi untuk kota Banda Aceh dan warga kota harus memberi dukungan penuh kepada Aminullah Usman,” ajak Sulaiman Abda. Muntasir Hamid, SH, M.Hum, Ketua DPD Golkar Banda Aceh, Sekretaris DPW PKS Aceh, M Hamid, Ketua PKB Banda Aceh, PBB dan Partai Daulah Aceh secara bergantian berkampanye untuk kemenangan pasangan Aminullah-Muhibban. Tidak kecuali, Ketua Forum Komunikasi Pemuda kampong se Banda Aceh, Fauzi Daud yang mengelu-elukan AminullahTgk H Muhibban. (b01)

Herawati Diah ....

“Saat itu, Indonesia tidak punya koran berbahasa Inggris. Jadilah kami ditantang untuk menerbitkan koran berbahasa Inggris,” ujar wanita yang mengecap pendidikan jurnalistik dan sosiologi di Amerika Serikat ini. Tapi jauh sebelum itu, Herawati adalah penerus media ‘Keluarga’ yang terbit pada 1940. Itulah warisan ibundanya. Dari situ, Herawati muda belajar menerbitkan media. Herawati pun mengungkapkan bahwa dahulu dia termasuk wartawan yang terbilang berani dan nekat. “Saya itu dulunya koboi, tidak pernah takut dalam meliput. Tapi wartawan saat ini lebih berani dan berkualitas. Jurnalis perempuan dan lelaki sama-sama berprestasi,” katanya dengan mata berbinar. Kini, di tengah kegiatan kesehariannya, Herawati masih tetap menyimak situasi terkini. Kadang dia juga menulis dan sesekali berkumpul dengan para jurnalis senior lainnya. Sekedar membicarakan hal-hal krusial dan terkini di negara ini. Tapi kegiatan rutin yang paling disukainya kini adalah bermain bridge. Setidaknya seminggu dua kali, yakni pada hari Senin dan Rabu, Herawati berinteraksi dengan rekanrekannya sesama pecinta olah raga bridge. Dia mengenal bridge saat sang suami, BM Diah bertugas sebagai diplomat di Bangkok. “Beberapa hari lalu saya senang juga karena berhasil

meraih juara pertama lomba bridge yang diadakan women international club. Saya yakin kesenangan saya yang satu ini membuat saya terhindar dari penyakit pikun,” katanya, sambil tertawa renyah. Kesukaan lain ibu 3 anak, 12 cucu dan 13 cicit ini adalah bercocok tanam. Jika tak sedang berada di apartemennya di kawasan Dharmawangsa, Herawati tinggal di kawasan Cipayung. Di sana, kata Herawati, dia bisa lebih leluasa menyalurkan hobinya berkebun. Sejumlah tanaman hias seperti suplir dan anggrek menjadi koleksinya. Selain hobi berkebun, dia juga menyukai lukisan dan kain tradisional. Untuk lukisan, dia menyukai karya Affandi. Kini, Herawati Diah hidup damai bersama anak-anak, para cucu dan cicit. Saking sayangnya kepada mereka yang dicintai, tak jarang dialah yang mendatangi mereka. “Bagi saya, keluarga adalah semangat hidup. Cucu-cucu dan cicit-cicit saya adalah kegembiraan yang membuat saya bahagia sampai sekarang,”pungkas Herawati. (dianw)

membuat Herawati sarat dengan pengalaman. Tapi tutur katanya halus dan lembut, tidak jumawa dan penuh kehati-hatian. Orang bilang, itulah ilmu padi. Dan Herawati, sudah melakukan itu. Padahal, perannya dalam perjuangan kemerdekaan Indonesia tidak dapat dianggap remeh. Kiprahnya di masa lalu sebagai seorang jurnalis dijalaninya dengan penuh semangat kemerdekaan. Perjalanan jurnalistik Herawati semakin bersinar saat meliput untuk koran Harian Merdeka yang dibangun sang suami pada 1 Oktober 1945. Koran inilah yang pertama kali mempublikasikan naskah asli teks proklamasi. “Naskah proklamasi itu sempat dibuang Sayuti Melik. Jiwa war tawan Pak Diah muncul. Diambilnya naskah itu dan diterbitkan di Harian Merdeka. Sekarang naskah itu disimpan di Arsip Nasional,” ujarnya. Selanjutnya, Herawati membangun koran Indonesian Observer, atas permintaa n P e r d a n a Me n t e r i A l i Sastroamidjojo yang saat itu menjabat ketua umum Konferensi Asia Afrika di Bandung. Itu terjadi pada 1955. TS, karena sang istri menghubungi keluarganya dan menceritakan kejadian yang dialaminya. Mendengar itu, keluarga Bunga menjemputnya di lokalisasi warung bubur. Sementara, dalam pemeriksaan,TS ayah satu anak ini menolak dikatakan menjual istrinya. Kepergian mereka ke warung bubur atas ajakan istri. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, SIk ketika dikonfirmasi melalui Kasubbag Humas AKP Ngemat Surbakti mengatakan TS ditangkap atas tuduhan menjual istri dan menganiaya. Dalam kasus ini, TS dijerat pasal 8 hurup b UURI Nomor 23 tahun 2004 tentang penghapusan kekerasan dalam rumah tangga dengan ancaman hukuman paling rendah 4 tahun dan paling tinggi 15 tahun. (a11) tidak mau berbuat dosa, serba kulit manusia yang berdosa hari akhirat akan dibakar dalam neraka. Jika kulit itu habis terbakar, Allah menggantikan dengan kulit yang baru agar manusia berdosa itu merasakan akibatnya. “Sesungguhnya orangorang yang kafir kepada ayatayat Kami, kelak akan Kami masukkan mereka ke dalam neraka. Setiap kali kulit mereka hangus, Kami ganti kulit mereka dengan kulit yang lain, supaya mereka merasakan azab. Sesungguhnya Allah Maha Perkasa lagi Maha Bijaksana”. (QS. An-Nisa:56) Jika kulit ingin selamat, berusahalah untuk tidak masuk neraka. Kulit penghuni surga terlindungi dalam kamar-kamar yang nyaman tanpa bahaya. Subhanallah. Kulit penghuni surga memang selalu bersih, harum dan putih bersih. Allahu Akbar.

Jakarta Siagakan ....

Menurut data dari TMC Polda Metro Jaya, hujan deras juga menyebabkan jalan Panjang yang mengarah ke Joglo tepatnya Pos Pengumben tergenang air, demikian juga dengan Jalan H Ipin Pondok Labu, Jalan Tanah Kusir Raya, dan Jalan Arteri Iskandar Muda 9 Underpass Bungur gandaria City. Jalan Lebak Bulus Tiga Gunung Balang Rt 11/04 Pondok Labu Cilandak, Komp IKPN Pesanggrahan, Bintaro, Pasar Cipulir, Jalan Kerja Bakti di Kec. Makasar, dan jalan Gunung Sahari juga tergenang air dengan ketinggian bervariasi.

Bocah Setahun ....

Menurut Komisi Keamanan Produk Konsumen, sebuah agen federal AS, kasus ini bukan yang pertama. Dalam kurun 2005-2009, setidaknya ditemukan dua kasus serupa. Tiffany dan Chris Hebb tidak mungkin akan menghadapi dakwaan. Kini, Tiffany dalam penyidikan polisi. “Saat kejadian dia ada di ruang tamu, membaca majalah,” kata polisi. “Itu bukan seperti ibu yang punya anak balita dan mengawasinya.” Laporan 2011 mengatakan dua anak di bawah usia 5 tahun meninggal di dalam mesin cuci antara 2005 dan 2009. Selama jangka waktu itu, 350 anak meninggal tenggelam di bathtub, dan 77 tenggelam dalam kolam atau septic tank. (t/m09)

Setgab Janji ....

sendirinya,” sebut Mubarok. Mubarok yakin meskipun PKS keluar dari koalisi, kekuatan koalisi di parlemen tak akan berkurang. “Koalisi sekarang ini kegedeaan dan tak solid. Mendingan kecil tapi solid,” sebut Mubarok. Dia menambahkan, jika PKS keluar dari koalisi, maka konsekuensinya menterimenteri KS di Kabinet Indonesia Bersatu II harus dicopot. “Menteri PKS di kabinet harus dibuang, ini merupakan implikasi dari keluarnya PKS dari koalisi,” pungkas Mubarok.

Angkot Dan ....

menyambar premium yang tumpah di lantaiya dan membakar angkot tersebut, lalu menyambar sepedamotor yang tergeletak di dekatnya. “Dari tiga orang penumpang angkot dan dua pengendara sepedamotor, seorang diantaranya mengalami luka bakar serius di tangan, wajah, dan kaki. Yang lainnya luka ringan,” kata Kapos Lantas Polsek Batang Angkola, Bripka Effendi. Pantauan Waspada di lokasi melihat angkot dan sepedamotor tinggal puing. Sementara, polisi melakukan pengejaran terhadap sopir angkot AAH. (a27)

Ada-ada Saja ....

lelucon, tapi kemudian kami menyadari bahwa itu adalah ide yang sangat baik. Ini juga akan memperkuat jaringan masyarakat, sama seperti memelihara kucing dan anjing. Mereka juga pasti akan menjaga ayam-ayam tersebut,” ujar wali kota Pince Lydie Pasteau, seperti dikutip dari BBC, Senin (2/4). Pasteau juga berharap ayam dapat mengurangi biaya pembuangan limbah. (ok/rzl)

Presiden ....

tidak terlalu mendesak seperti studi banding dan perjalanan dinas. Lebih lanjut dia menjelaskan bahwa sebenarnya penaikan harga bahan bakar minyak bersubsidi (BBM) merupakan salah satu cara untuk mengurangi subsidi pemerintah di sektor energi yang bisa mengurangi defisit dan memperbaiki postur APBN. Pemerintah sebelumnya berencana menaikkan harga BBM bersubsidi namun tidak bisa dilakukan karenanya hanya bisa melakukan penghematan untuk menyelamatkan APBN.

pemilik warung. Selanjutnya api berhasil dipadamkan dan ditemukan plastik bekas minyak tanah di dekatnya. Menurutnya kebakaran ini merupakan faktor kesengajaan, karena ditemukan buktibukti pendukung di sekitar lokasi. Namun, tidak ada saksi mata yang melihat pelaku

pembakaran tersebut. “Saya sudah melaporkannya ke Polsek Batangtoru. Barang bukti berupa potongan dinding papan yang terbakar dan plastik bekas minyak tanah sudah diamankan dari lokasi,” kata O.K Hazmi sembari menyebut polisi sedang mengembangkan kasus ini. (a27)

Pemilik 3,6 Kg Sabu Dituntut Seumur Hidup TANJUNGBALAI (Waspada): Jaksa Penuntut Umum (JPU) Samian dalam sidang di Pengadilan Negeri Kota Tanjungbalai, Selasa(3/4) menuntut terdakwa pemilik 3,6 kilogram sabu dari Malaysia, Ridhonya alias DO, 37, dengan hukuman seumur hidup. Terdakwa yang semula santai duduk di kursi pesakitan, tiba-tiba pucat begitu mendengar tuntutan tersebut. Dalam amar tuntutannya, JPU menerangkan, terdakwa dinyatakan terbukti bersalah melanggar pasal 112 ayat (2) junto pasal 132 ayat (1) Undang-undang RI No. 35 Tahun 2009 tentang Narkotika. Menurut JPU, hal yang memberatkan terdakwa, tidak mendukung program pemerintah dalam pemberantasan narkoba, terdakwa sudah pernah dihukum 2 kali dalam kasus yang sama. Tidak ada yang meringankan terdakwa.

Daerah Penghasil ....

hiran Menasah Mancang, Lhoksukon ini juga mengutarakan, mengapa dia sampai menerima ajakan 19 partai menjadi calon Bupati Aceh Utara berpasangan dengan H.Syarifuddin. “Saya merasa berkewajiban membantu masyarakat Aceh Utara yang terpuruk. Kami harus bisa menyelamatkan kabupaten yang kita cintai ini agar jangan dir usak pemimpin yang zalim,” tegasnya. Oleh sebab itu, dia mengajak warga untuk selalu berdoa dan mendukung niat tersebut agar masyarakat tidak menderita seperti lima tahun lalu.

Masyarakat juga harus berdoa dan shalat Istikharah agar Aceh Utara punya pemimpin yang adil. Sementara itu, Syarifuddin menjelaskan masa bupati lima tahun lalu banyak terjadi pemotongan tunjangan untuk kesejahteraan rakyat. Di antaranya, dana tunjangan prestasi kerja pegawai, uang meugang, dan insentif lainnya. “Ke depan, semua tunjangan itu akan kita berikan kembali,” tegasnya seraya menambahkan begitu juga dengan gaji geuchik dan imam meunasah, harus diberikan setiap bulan. (b11/b15/cmk)

Mendagri ....

tusan pemberhentian ketiga kepala daerah telah sesuai dengan UU No. 32 tahun 2004 tentang Pemerintahan Daerah yang mengamanatkan pemberhentian bagi kepala daerah yang telah dihukum dengan keputusan berkekuatan hukum tetap. Sebagaimana diwartakan, mantan Camat Barumun, Kabupaten Tapsel, Basyrah Lubis (saat ini menjabat Bupati Palas-red) divonis majelis hakim Mahkamah Agung (MA) dengan Ketua Majelis, H Mansur Kartayasa beserta anggota M Zahruddin Utama M dan R Imam Haryadi, pida-

na penjara 6 bulan dengan masa percobaan 1 tahun karena terbukti sah dan meyakinkan bersalah melakukan tindak pidana memalsukan surat. Majelis hakim MA yang memeriksa perkara tersebut dalam salinan putusan MA Nomor 1021 K/Pid/2009 menyatakan, kalau pidana tersebut tidak perlu dijalankan terdakwa, kecuali apabila dikemudian hari dengan putusan hakim terdakwa dinyatakan terbukti bersalah melakukan tindak pindana sebelum masa percobaan selama 1 tahun terakhir. (j02)

Perbaikan ....

Disebutkannya, anggaran yang diajukan ke Pemko Medan merupakan anggaran yang nantinya akan dialokasikan dari anggaran bencana, karena perbaikan traffic light itu terjadi karena adanya keadaan darurat akibat aksi unjukrasa yang dilakukan sejumlah elemen dalam menolak rencana kenaikan BBM. Proses yang akan dilakukan nantinya secara penunjukkan langsung dan tidak melalui proses tender, sehingga pengadaan traffic light yang rusak itu bisa langsung dilakukan. “Kalau menggunakan proses tender itu kan nanti akan lama waktunya, makanya untuk ini kita lakukan dengan PL,” ucap Armansyah. Ketika ditanya kapan selesainya pengadaan untuk traffic light tersebut, Armansyah

menjawab kalau pengadaannya itu masih tergantung kepada persetujuan dari Wali Kota Medan. “Setelah dapat persetujuan nanti dan anggarannya keluar untuk pengadaan itu tidak akan lama, karena pengadaannya tidak harus baru keseluruhannya hanya perbaikan dan pembelian lampu, jadi tidak akan memakan waktu yang lama,” katanya. Dikatakan Armansyah, tidak semua traffic light harus dilakukan pengadaan baru, sebab beberapa traffic light yang rusak itu merupakan tiang rendah, sedangkan yang tiang tinggi tidak rusak. Ada sebagian juga yang boksnya hancur dan alat control serta countdownnya yang rusak. “Jadi tidak semua alatnya yang harus diganti,” terang Armansyah. (m50)

Matang Kuli dan sekitarnya masih sulit dilalui. Bahkan jalan yang melintas di sepanjang garis pipa saat dipenuhi lubang. Ini sebagai bukti pemimpin tidak memperhatikan wilayah penghasil gas. Selain jalan, lanjutnya, jembatan juga mengalami kerusakan sehingga mengganggu ekonomi masyarakat. “Salah satunya jembatan Ara Kemudi. Banyak uang dari hasil gas, tapi mengapa jembatan dibiarkan rusak,” teriak calon bupati nomor urut 9 tersebut. Pengusaha sukses kela-

Perumnas dan bupati/walikota di Jakarta, Selasa (3/4). Keputusan Mahkamah Agung telah berkekuatan hukum tetap memonis Basyrah Lubis bersalah dengan hukuman 6 bulan percobaan. Selain memberhentikan Basyrah Lubis, Mendagri juga akan memberhentikan tiga kepala daerah lainnya, yakni Walikota Bekasi Mochtar Muhammad, Bupati Subang dan Bupati Lampung Utara. Alasannya sama, telah diperoleh putusan hukum berkekuatan hukum tetap (inkrach). Menurut Mendagri, kepurusak itu, kata Armansyah, untuk persimpangan Jalan Yos Sudarso/Adam Malik perbaikan traffic light sebesar Rp94.040.000, simpang Jalan Perintis Kemerdekaan/Jalan Gaharu Rp119.476.000, simpang Jalan Sutomo/Jalan Perintis Kemerdekaan Rp 163.172.000. Simpang HM Yamin/Jalan Sutomo Rp 60.974.000. Begitu juga untuk simpang Jalan HM Yamin/Jalan Gaharu Rp60.974.000, simpang Jalan Sudirman/ Jalan S Parman Rp75.032.000, simpang Jalan Jamin Ginting/Jalan Iskandar Muda Rp141.006.000, simpang Jalan Jamin Ginting/Jalan Dr Mansyur Rp260.862.000, Jalan Ngumban Surbakti/Jalan Setia Budi Rp161.014.000 dan simpang Jalan Sm Raja/Jalan Hm Jhoni Rp40.966.000.

Info Sumut

WASPADA Rabu 4 April 2012

Kolom Amir Syarifuddin

Langkah Gatot Stabilkan Harga RENCANA kenaikan harga bahan bakar minyak (BBM) menyebabkan harga sejumlah barang, termasuk sembilan bahan pokok (sembako) ikut membubung. Tapi ketika harga BBM bersubsidi tidak jadi naik, harga barang yang naik, tidak ikut turun. Kondisi ini rupanya menjadi perhatian serius Plt Gubsu Gatot Pujo Nugroho. Sabtu, 31 Maret lalu, Gatot mengeluarkan instruksi agar harga barang yang susah terlanjur naik, terutama sembako, segera diturunkan. Menurut Gatot, harga barang harus distabilkan kembali. Untuk itu, pihaknya segera memanggil Disperindag, Bulog, Pertamina dan Organda. Selain itu, juga bakal dipanggil distributor dan agen-agen besar komoditas. Diharapkan dari pertemuan tersebut bisa diketahui apa penyebab kenaikan harga tersebut. Apakah terletak pada pengusaha (pabrik), distributor, pengangkutan atau pedagang. Sehingga bisa dilakukan antisipasi dengan cepat dan tepat. Berdasarkan pantauan sejumlah media, sejak seminggu terakhir Maret, harga sembako di pusat pasar Medan misalnya, mengalami kenaikan antara Rp500 – Rp2.000 per kilogram. Gula misalnya, naik dari Rp10.500 menjadi Rp12.000 per kilogram, minyak goreng naik dari Rp10.500 menjadi Rp11.500. Sedangkan sayur-mayur seperti cabai naik rata-rata Rp1.000 per kilogramnya. Kondisi yang sama terjadi pula di pasar-pasar lain di Sumut. Tidak heran bila instruksi Plt Gubsu ini dipuji sebagai bentuk kepekaan pemimpin terhadap persoalan rakyatnya. Akibat melonjaknya sejumlah harga bahan kebutuhan menyebabkan sebagian rakyat, terutama yang berpenghasilan rendah, mengeluh lantaran penghasilan mereka tidak cukup untuk membeli kebutuhan hidup sehari-hari. Instruksi Plt Gubsu ini bisa menjadi “sitawar-sidingin” bagi masyarakat yang sedang pusing memikirkan kenaikan harga sembako. Para pedagang diharapkan ikhlas melaksanakan instruksi Plt Gubsu. Mereka diminta tidak memanfaatkan situasi dalam mencari keuntungan sebesar-besarnya. Empati dari mereka sangat diharapkan sebagai bentuk toleran terhadap saudara-saudara yang lain. Toh, harga-harga di tingkat produsen tidaklah naik, bahkan ada yang turun seperti sayursayuran di sentra pertanian Tanah Karo. Begitu juga dengan pengusaha angkutan. Mereka diharapkan tidak menaikkan ongkos angkut barang. Bisa jadi instruksi Plt Gubsu tidak serta merta berdampak langsung dalam menstabilkan harga. Namun Plt Gubsu berjanji pihaknya akan berkoordinasi dengan Forum Komunikasi Pimpinan Daerah (FKPD) akan mengawal dan memonitor secara ketat soal harga ini. “Termasuk melakukan inspeksi mendadak ke lapangan,” katanya. Bila perlu bakal dilakukan operasi pasar, sehingga harga kembali normal. Sejumlah kalangan, di antaranya anggota DPD RI asal Sumut, Parlindungan Purba, mendukung langkah cepat Plt Gubsu dalam menstabilkan kembali harga-harga barang. Parlindungan menyarankan Pemprov dan kabupaten/ kota harus turun langsung ke lapangan mengawasi. Menurut Parlindungan, perlu diselidiki penyebab kenaikan itu. Bila kenaikan akibat ulah spekulan, pihak Polda harus menindaknya. ***

Merangkul Semua, Untuk Kemajuan Sumatera Utara Pentingnya menjalin kerjasama dengan pihak lain sepertinya disadari betul oleh Pemrovsu di bawah kepemimpinan H Gatot Pujo Nugroho, ST. Mengingat begitu banyak masalah dan kebutuhan masyarakat yang harus dipenuhi. Pemerintah dalam hal ini Pemrovsu tentu tidak akan mampu bekerja dan berusaha sendiri dalam menjawab berbagai tuntutan yang ada. Karenanya, bekerjasama merupakan pilihan cerdas yang bisa diambi pemerintah dalam mensukseskan berbagai agenda pembangunan. Hal itu boleh jadi melatarbelakangi berbagai kerjasama yang dijalin Pemrovsu. Selama sepekan terakahir ini saja, Pemerintah Provinsi Sumatera Utara telah menjalin tiga kerjasama strategis dengan berbagai institusi dan beragam kesepakatan. Pada Senin (2/4) Plt Gubsu H Gatot Pujio Nugroho menandatangani memorandum of understanding (MoU) Pendirian Pusat Kajian Konflik dan Radikalisme, dengan Badan Nasional Penanggulangan Terorisme (BNPT) oleh Kepala BNPT Irjen Pol (purn) Drs Ansyaad Mbai dan Universitas Sumatera Utara diwakili Rektor Prof Sahril Pasaribu. Sebelumnya, Kamis (29/3)

Waspada/Ist

MOU : Plt Gubernur Sumatera Utara, Gatot Pujo Nugroho ST (kiri) dan Rektor Universitas Sumatera Utara, Prof Sahril Pasaribu (kanan), menandatangani Kesepakatan Kerjasama MoU dalam program rehabilitasi rumah tidak layak bagi 6.000 keluarga di Biro Rektor USU,Medan, Kamis (29/3). Plt Gubsu dan Panglima Kodam I Bukit Barisan Mayjen TNI Lodewijk F Paulus menandatangani kesepakatan kerjasama rehabilitasi terhadap 6.000 rumah tidak layak huni bagi masyarakat berpenghasilan

Waspada/Ist

BERSAMA : Gatot Pujo Nugroho, Sekda Provsu Drs H Nurdin Lubis MM, Rektor USU Prof Sahril Pasaribu dan Pangdam I/BB Mayjen TNI Lodewijk F Paulus, foto Bersama usai menandatangani Kesepakatan Kerjasama dalam program rehabilitasi rumah tidak layak bagi 6.000 keluarga di Biro Rektor USU, Medan, Kamis (29/3).

Ketua MUI Paluta:

Saya Doakan Fadly Nurzal Tetap Amanah PALUTA (Waspada): Ketua Majelis Ulama Indonesia (MUI) Kabupaten Padang Lawas Utara (Paluta) Drs H. Kosim Pohan mengatakan sosok Ketua DPW PPP Sumatera Utara H Fadly Nurzal, S.Ag adalah seorang pemimpin yang amanah, berwibawa dan bersahaja. Oleh karena itu, ia tidak saja dihormati tapi juga disayangi masyarakat. Hal itu dikatakan Ketua MUI Paluta kepada wartawan barubaru ini pada acara Pelantikan dan Mukercab DPC PPP Paluta di Gunungtua, Paluta. Menurut H. Kosim, sosok seperti Fadly Nurzal diharapkan muncul memimpin umat Islam dan masyarakat di Sumatera Utara. Ke depan, sosok pemimpin yang diharapkan umat tidak saja pintar mengelola pelaksanaan pemerintah, tidak juga sosok pemimpin yang lihai berbicara. Pemimpin ke depan harus orang yang teruji integritas, moralitas dan tentu harus harus orang yang amanah. “Untuk itu, saya berdoa kepada Allah, semoga Fadly Nurzal ke tetap teguh melaksanakan amanah yang diberikan umat dan masyarakat Sumatera Utara,” katanya. Dijelas H.Kosim, melaksanakan amanah memang tidak semudah mengucapkan. Amanah juga salah satu sifat Rasulul-

rendah. Pada saat yang sama, Gatot juga menandatangani kesepakatan dengan Rektor USU Prof Sahril Pasaribu untuk optimalisasi kemitraan dan peningkatan program kerja bersama. Berbagai kerjasama yang dilakukan oleh Pemrovsu tersebut terbilang strategis. Untuk kerjasama dengan Kodam untuk rehabilitasi terhadap 6.000 rumah tidak layak huni di seluruh kabupaten kota merupakan sebuah langkah cerdas, mengingat kemampuan dan kesiapan TNI yang sudah teruji. Program untuk membantu masyarakat yang kurang mampu agar dapat memiliki lingkungan hidup yang lebih layak ini agar lebih efektif dan efisien, maka disandingkan dengan fungsi pembinaan teritorial Kodam. Pangdam I Bukit Barisan, Lodewijk F Paulus mengungkapkan, program rehabilitasi rumah murah bagi keluarga pra

Waspada/Ist

KETUA DPW PPP Sumatera Utara H. Fadly Nurzal, S.Ag bersama Ketua MUI Paluta Drs H. Kosim Pohan diabadikan disela-sela acara DPC PPP Paluta baru-baru ini.

praktekkan nilai-nilai dan ajaran Islam dalam setiap gerak langkahdanprogramnya,”imbuhnya. Kemudian, H.Kosim mengajak seluruh umat Islam di Paluta untuk bersama-sama PPP memperjuangkan aspirasi umat Islam. Sebab, kata H.Kosim, Allah dalam firmannya mengatakan, Allah tidak akan mengubah nasib satu kaum, sebelum mereka berusaha mengubah nasibnya sendiri. “Saat ini PPP sebagai rumah besar umat Islam, untuk itu kita bersatu dan kompak bersama-sama PPP memperjuangkan nasib kita sendiri,” katanya.(m07/rel)

sejahterah sangat sesuai dengan kebutuhan masyakat. “Ke depan, kesulitan perekonomian akan sangat dirasakan dampaknya oleh masyarakat pra sejahtera, mudah mudahan ini dapat menjadi setitik air yang membasahi tenggorokan mereka ,” ujar Lodewijk. Dia menjelaskan, Kodam memiliki tugas dan fungsi utama dalam pembinaan teritorial terkait geografi, demografi dan kondisi sosial. Salah satu bentuk pembinaan teritorial yang dilakukan menurutnya adalah program adalah bakti kerjasama dengan Pemrovsu tersebut. “Terimakasih Pemrovsu suda mengajak Kodam. Pelaksanaannya nanti dilakukan oleh Batalyon Seni Tempur, yang memiliki kemampuan konstruksi. Batalyon ini memiliki kemampuan untuk merusak bangunan, namun juga memiliki kemampuan untuk merekonstruksi kembali. Ini program

yang sangat baik, karena pro kepentingan rakyat, dan mereka sangat terbantu,” kata Lodewijk. Sedangkan kerjasama dengan salah satu universitas tertua di Sumut, yakni USU merupakan langkah yang diambil

Pemrovsu utuk lebih meningkatkan kolaborasi dunia akademis dengan pemerintahan. Gatot menjelaskan kerjasama sebagai upaya untuk mendorong tata kelola pemerintahan yang juga melibatkan kolaborasi yang baik antara kalangan akademisi, bisnis dan pemerintah (ABG: academic, bussiness and Government). “Pemerintah tidak bisa bekerja sendiri tanpa kerjasama dengan pihak lain. Karenanya, kami sengaja melaksanakan acara penandatanganan MoU dengan USU dan Kodam digelar di Biro Rektor USU ini, agar terus mengingatkan kami untuk membangun kerjasama dengan pihak lain,” ujar Gatot. Gatot juga menghimbau para pejabat di lingkungan Pemrovsu terus belajar, mengingat dinamika sosial masyarakat yang terkadang sangat cepat, sehingga membutuhkan kemampuan dan pemahaman yang lebih baik dari para pejabat dalam mengambil kebijakan strategis. Sementara itu Rektor USU Prof Sahril Pasaribu menjelaskan bahwa selama ini hubungan kerjasama yang terjalin antara pihaknya dan Pemrovsu sebenarnya telah terjalin cukup lama secara parsial. (m28)

Waspada/Ist

SALAM KOMANDO : PLt. Gubsu Gatot Pujo Nugroho ST dan Pangdam I/BB, Mayjen TNI Lodewijk F Paulus melakukan Salam Komando usai menandatangani Kesepakatan Kerjasama MoU dalam program rehabilitasi rumah tidak layak bagi 6.000 keluarga di Biro Rektor USU, Medan, Kamis (29/3).

KPK Apresiasi Kinerja LIRA Sumut komplain dari perusahaan lain yang mengikuti tender secara prosedur. Hal ini sesuai dengan Keppres No. 80. Kata Oscar korupsi terjadi disebabkan karena melanggar hukum dan aturan, ingin memperkaya diri dan keluarganya serta mengakibatkan merugi-

MEDAN (Waspada): Komisi Pemberantasan Korupsi (KPK) sangat mengapresiasi kinerja dan program DPW Lumbung Informasi Rakyat Sumatera Utara (LIRA Sumut) dan menyatakan siap bekerjasama tentang pemberantasan korupsi khususnya yang terjadi di Sumut.

lah SAW, selain siddik, tagblih, fathanah. Artinya, orang yang melaksanakan amanah dapat dikatakan sebagai orang yang mengikuti dan melaksanakan sifat Nabi Muhammad SAW, H.Kosim juga mengaku sangat mendukung sikap teguh Partai Persatuan Pembangunan (PPP) tetap menjadi partai Islam. Oleh karena itu, ia berharap seluruh pengurus PPP, lebih meningkatkan kerja-kerja yang bersentuhan langsung dengan umat Islam. “Ketika PPP komit memegang teguh Islam sebagai azas partai, konsekuensinya seluruh kader PPP harus mem-

A3

Gubernur LIRA Sumut H.Rizaldi Mavi, MBA (foto) didampingi Sekjen Oscar Siagian, SKM serta pengurus lainnya bendahara Ir.M. Saleh Pane, Walikota LIRA Medan Ganda Manurung, Ir.Togi P. Siagian, MM, CP Siregar, Surya Calvin,SE, Ahmad Meizer,SH , mengatakan dalam jumpa pers di Graha DPW LIRA Sumut Jl.Bukit Barisan II Medan, Senin (2/4). Pernyataan KPK disampaikan salah seorang penasehat KPK Abdullah Hehamahua kepada pengurus LIRA Sumut pada Rapat Kerja Nasional (Rakernas) LIRA di Hotel Sahid Surabaya 27-29 Maret 2012 lalu. Pada Rekernas yang bertujuan mengevaluasi program LIRA secara nasional periode 2011 sekaligus merumuskan program kerja tahun 2012 menjadi pedoman kepengurusan LIRA secara nasional

dibuka langsung ketua Mahkamah Konstitusi (MK) Prof. Mahfud MD. Rekernas dirangkaikan dialog kebangsaan bersama sejumlah tokoh nasional, serta melakukan kajian atas sejumlah program dan rencana program pemerintah di antara isu kenaikan harga BBM membahas tiga hal pokok penting yaitu konsolidasi LIRA 2012, pemberantasan korupsi di Indonesia dan penataan sistem. Kata Rizaldi Mavi, apresiasi dan kerjasama KPK dan LIRA Sumut tentang pemberantasan korupsi, maka segala laporan LIRA Sumut masuk dalam skala prioritas. Karena diperoleh informasi terdapat 6000-an kasus korupsi terjadi di berbagai instansi khususnya di Sumatera Utara. Bahkan KPK meminta agar LIRA Sumut secara terusn menerus menyoroti, memantau dan memonitor guna menemukan bukti-bukti awal dalam tipikor (tindak pidana korupsi) terutama yang sangat menonjol adalah barang dan jasa (proyekproyek). LIRA Sumut diharapkan terus mengawasi pelaksaaan lelang tender di berbagai instansi pemerintah terutama yang menggunakan dana APBDAPBN terutama proyek yang masuk kategori dengan nilai Rp1 miliar maka segera laporkan, ujar Oscar meniru ucapan penasehat KPK. Walau bagaimanapun setiap proses awal pelelangan pasti ada tender yang telah diatur dan diduga telah mengelabui aturanaturan yang ada seperti munculnya proyek fiktif, Penunjukan Langsung (PL) dan lain-lain. Seperti di Sumut sendiri, hasil temuan LIRA Sumut ada perusahaan yang dalam proses tender tidak menang, tapi akibat adanya unsur KKN persekongkolan maka perusahaan tersebut tiba-tiba dimenangkan sehingga muncullah konflik dan

kan Negara. Saat ini diakui, banyaknya minus perawatan jalan-jalan, jembatan, sarana gedung perkantoran, rumah sakit maka inilah menjadi tugas LIRA untuk mengawasinya. Maka pengurus LIRA harus mengetahui seluk beluk adanya tipikor. Harus diakui rata-rata

kepala daerah ditemui terdapat kejanggalan masalah dana terutama di Binsos bukan saja di Provsu tapi diseluruh Provinsi di Indonesia. LIRA sebagai lembaga swadaya masyarakat yang independen siap menerima berbagai pengaduan masyarakat. (m24)

Medan Metropolitan

A4

WASPADA Rabu 4 April 2012

Pemko Pertahankan Kenaikan PBB 100 Persen Warga “Tergusur” Ke Pinggiran Kota MEDAN (Waspada): Walaupun DPRD Kota Medan mendesak Pemerintah Kota Medan cq Dinas Pendapatan untuk merevisi kembali Perda Pajak Bumi dan Bangunan (PBB) tahun 2012 yang mencapai 100 persen, namun tidak diindahkan. Pemko Medan tetap ngotot tidak merevisinya dengan alasan sudah sesuai undangundang. Wali Kota Medan Rahudman Harahap kepada wartawan seusai rapat evaluasi PBB di Kantor Dispenda Medan, Selasa (3/4) mengatakan, tidak akan merevisi kenaikan PBB karena sudah sesuai dengan UU yang merupakan landasan dasar. “Itu sudah sesuai dengan UU. PBB itu kan tergantung NJOP, kalau NJOPnya Rp1 miliar, maka dipastikan pajaknya juga tinggi. Kalau cuma 14 meternya rumahnya, berapalah itu NJOP nya. Kalau ada masyarakat yang keberatan silahkan ajukan kepa-

da kita, nanti akan ada tim untuk memverifikasinya agar bisa diberikan keringanan,” kata Rahudman didampingi Kadispenda Kota Medan Sahrul Harahap. Dijelaskannya, penetapan kenaikan PBB itu sudah sesuai dengan aturan UU dan sudah dievaluasi oleh Gubsu juga Menteri Keuangan RI. “Masalah revisi itu bukan gampang. Ini kan sudah ada aturannya dan tidak menyalahi UU. Lagi pula Perda ini sudah dievaluasi Gubsu,selainitujugasudahdieva-luasi Menteri Keuangan RI, jadi kalau direvisi ituterlalu kaku, sementara kenaikan ini juga baru diimplementasikan,” ucapnya. Demikian juga dijelaskan Sahrul. Menurutnya, kalau ada masyarakat yang keberatan untuk membayar kenaikan PBB itu maka bisa melampirkan surat dari kelurahan yang menyatakan kalau warga tersebut tidak mampu. “Kalau keberatan bisa kita berikan keringanan tentunya harus dengan surat dari lurah yang menyatakan dia tidak mampu, di sini kita kan juga menggunakan prinsip kepatutan, kewajaran, dan keadilan,” sebutnya. Sebelumnya, dalam lapo-

rannya kepadaWali Kota Medan menyebutkan, kenaikan PBB itu sesuai dengan UU No 28 tahun 2009, juga Perda No 3 tahun 2011 dan Perwal No 73 tahun 2011. “Dalam Perwal itu juga dinyatakan keringanan bagi pensiunan dan veteran, bahkan untuk veteran kita beri keringanan hingga 75 persen,” tuturnya. Sahrul menyebutkan, potensi PBB Pemko Medan sesuai dengan warga yang harus membayar PBB tahun ini sebanyak 453.509. Sementara Surat Pemberitahuan Pajak Tahunan (SPPT) yang telah diterbitkan masih sebanyak 436.744, sehingga masih ada potensi wajib pajak lagi yang belum terhitung sebanyak 16.765. Pinggiran kota Sementara itu, Direktur Lembaga Advokasi Perlindungan Konsumen (LAPK) FaridWajdi menyatakan, kenaikan Pajak Bumi dan Bangunan (PBB) terkesan sangat drastis. Pemerintah terkesan seperti ‘menggusur’ warga ke pinggiran. Menurut Farid, dalam beberapa bulan belakangan, warga banyak mengeluh atas kenaikan PBB tersebut. Bahkan beberapa warga Medan melaporkan kenaikan pajak mereka hingga

1000 persen. Sebagai contoh, kata dia, ada warga yang semula membayar pajak Rp60 ribu, saat ini pada tagihan pajak tahun 2011 harusmembayarRp600ribu,tentu hal itu terasa berat bagi mereka. Kenaikan pajak setinggi itu benar-benar tidak realistis dan dikhawatirkan pemilik tanah akan melepaskan tanahnya karena tidak sesuai dengan kemampuannya serta hasil yang didapat dari tanahnya tersebut. Sedangkan anggota DPD RI asal Sumut Parlindungan Purba SH meminta DPRD Me-dan merespon kembali Perda pembayaran PBB yang memberatkan masyarakat tersebut. “Jadi, DPRD lah yang harus mendengar keluhan masyarakat, karena mereka duduk di lembaga terhormat atas kepercayaan mewakili masyarakat kota Medan,” katanya. Parlin belum melihat dan tidak yakinWali Kota Medan Rahudman Harahap secara pelanpelan mengusir warganya ke pinggir kota. “Saya tidak yakin dan tidak ada pemerintah yang menyengsarakan masyarakat, namun sebaliknya pemerintah biasanya melindungi rakyatnya,” ujarnya. (m50/m32)

8.200 Guru Tidak Lulus Ujian Sertifikasi GP Tendik Sumut Ke Kemendiknas MEDAN (Waspada): Sedikitnya, 20.000 guru di Sumatera Utara mengikuti ujian sertifikasi pada tahun 2011. Dari jumlah tersebut, 8.200 orang dinyatakan tidak lulus dan 2.200 lainnya mengikuti ujian sertifikasi sebanyak dua kali. Masalah lainnya, ada guru yang sudah berusia 50 tahun ke atas. Hal itu disampaikan Ketua Gabungan Pendidik dan Tenaga Kependidikan Indonesia (GP Tendik) Sumatera Utara Drs. F.J. Pinem, MSc, MPd, saat melakukan audiensi kepada Kepala Badan Pengembangan SDM Pendidikan dan Penjaminan Mutu Pendidikan Prof. Dr. Syawal Gultom, MPd, di Kantor Kementerian Pendidikan Nasional Jakarta, Selasa (3/4). Turut hadir Penasihat GP Tendik Parlindungan Purba, SH, MM yang juga anggota DPD RI asal Sumatera Utara. FJ Pinem mengharapkan, pemerintah memberikan dispensasi kepada para guru yang sudah berusia 50 tahun lebih namun belum lulus ujian serti-

fikasi sehingga dapat mengikuti Pendidikan dan Latihan Guru. Pasalnya, para guru ini akan memasuki masa pensiun dan diharapkan dapat menikmati tunjangan profesi guru. FJ Pinem juga menyampaikan permasalahan yang dihadapi puluhan guru TK di Kabupaten Deliserdang yang tidak lulus uji kompetensi. Dari 41 guru TK yang ada, 37 orang mengikuti uji kompetensi, namun naskah soal ujian yang mereka terima merupakan naskah soal ujian untuk uji kompetensi guru SD. Akibatnya, mereka tidak dapat mengerjakan soal ujian tersebut dengan baik. Sementara itu, 4 orang yang berhalangan ikut uji kompetensi awal, diberi kesempatan mengikuti ujian ulangan dan mereka berhasil lulus karena mereka menerima naskah ujian untuk TK. “Kami berharap pemerintah merespon dua permasalahan guru tersebut dan mencari solusinya sehingga bisa diselesaikan dengan baik,” ujar Pinem. Sementara itu, Syawal Gul-

Waspada/ist

KETUA GP Tendik Sumatera Utara Drs.F.J.Pinem,MSc,MPd (kanan) saat beraudiensi kepada Kepala Badan Pengembangan SDM Pendidikan dan Penjaminan Mutu Pendidikan Prof. Dr. Syawal Gultom, MPd (tengah) didampingi Penasihat GP Tendik Parlindungan Purba, SH, MM (kiri).

tom selaku Kepala Badan Pengembangan SDM Pendidikan dan Penjaminan Mutu Pendidikan berjanji akan memberi perhatian serius dan mencari solusi terbaik sehingga masalah tersebut dapat diselesaikan. Sedangkan anggota DPD RI asal Sumut Parlindungan Purba menambahkan, nasib guru harus betul-betul diperhatikan. Sebab, mereka merupakan tenaga pendidik yang sangat berjasa kepada dunia pendidikan khususnya generasi muda. Parlindungan juga memberi apresiasi kepada GPTendik yang terus berjuang demi pening-

katan mutu dan kesejahteraan para guru di Sumatera Utara. Dengan terselesaikannya masalah ini, maka para guru tersebut dapat menambah keahlian mereka dan meningkatkan kesejahteraan hidup mereka. “Saya percaya, Syawal Gultom akan memberi perhatian serius terhadap masalah sertifikasi guru di Sumatera Utara. Sebab, beliau merupakan mantan Rektor Universitas Negeri Medan dan menghabiskan waktu puluhan tahun untuk berkarir di bidang pendidikan di Sumatera Utara,” demikian Parlindungan.(m25)

Kasus Penganiayaan Ngambang Di Polsek Medan Area MEDAN (Waspada): Kasus penganiayaan yang diadukan oleh korban Hendra David Simangunsong ke Polsek Medan Area pada 11 Agustus 2011 lalu, masih ngambang dan hingga kini belum ada tindaklanjutnya. Akhirnya korban melalui kuasa hukumnya melaporkannya ke Kapolda Sumut Irjen Pol.Wisjnu Amat Sastro dengan tembusan Kapolri. “Surat laporan ke Kapoldasu telah kami kirimkan pada 26 Maret 2012, agar memerintahkan Kapolsek Medan Area segera menindaklanjuti kasus penganiayaan yang diadukan klien kami dan segera dilimpahkan ke Kejaksaan Negeri Medan,” Advocat Zulham Effendi Mukhtar SH, CN, selaku kuasa hukum Hendra David Ham Simangunsong, Senin (2/4). Menurut Zulham, sebelumnya juga pihaknya pada 16 November 2011 lalu menyurati Kapolsek Medan Area agar segera menindaklanjuti kasus penganiayaan tersebut. Namun, kenyataannya sampai hampir

8 bulan BAP kasus tersebut belum juga dilimpahkan ke Kejaksaan Negeri Medan. Kata dia, korban Hendra David Ham Simangunsong, warga Jln. Selam, Kel. Tegal Sari Mandala, Kec. Medan Denai, dikeroyok dan dianiaya oleh pelaku berinisial JS CS, warga Jln. Perguruan, Kec. Medan Tembung, pada 10 Agustus 2011 pukul 22:00, di Jln. Mandala By Pass Gg LKMD. Sementara itu, Kanit Reskrim Polsek Medan Area AKP J Banjarnahor menjelaskan, tersangka JS Cs masih dalam pengejaran dan belum diketahui keberadaannya. “Surat perintah penangkapan terhadap tersangka JS sudah dikeluarkan namun pelaku belum diketahui dimana keberadaannya,” jelasnya. Menurut Banjarnahor, pihaknya juga mengharapkan informasi dari korban dan warga bila mengetahui keberadaan tersangka JS agar segera memberitahukan kepada pihak penyidik. “Kami terus memburon tersangka JS,” tegasnya. (h04)

600 Siswa SD Ikuti Try Out Di YPIT Khairul Imam MEDAN (Waspada): Yayasan Pendidikan Islam Terpadu (YPIT) Khairul Imam kembali melaksanakan try out Ujian Nasional (UN) untuk tingkat Sekolah Dasar (SD), Minggu (25/3). Sebelumnya, YPIT Khairul Imam juga melaksanakan try

out untuk tingkat SMP. Pelaksanaan try out UN untuk SD ini diikuti sekitar 600 siswa dari beberapa sekolah swasta maupun negeri di sekitar Kecamatan Medan Johor. Ketua Pembina YPIT Khairul Imam Drs. H. Hasrul Azwar, MM da-

lam sambutannya berpesan agar seluruh siswa menjawab pertanyaan dengan jujur dan cermat. Sebab kejujuran merupakan modal yang utama untuk hidup di masa depan. Hasrul juga mengingatkan bahwa try out merupakan lang-

Waspada/Ist

KETUA Dewan Pembinan YPI Plus Khairul Imam Drs. H. Hasrul Azwar, MM sedang memperhatikan seorang peserta try out yang sedang mengisi data, Minggu (25/3).

kah awal untuk menuju pelaksanaan UN sesungguhnya yang dilaksanakan dalam waktu dekat ini. “Jadikan try out ini sebagai latihan untuk menghadapi UN sesungguhnya. Dengan demikian, ketika menghadapi UN tidak akan bingung dan hasilnya akan memuaskan,” ujar Hasrul. Usai meninjau pelaksanaan UN dan melihat daftar pertanyaan yang ada di dalam soal try out, Hasrul mengatakan, pertanyaan yang ada dalam soal try out tersebut menunjukkan peningkatkan kualitas. “Saya melihat pertanyaan yang ada dalam soal try out ini menunjukkan sebuah peningkatan kualitas untuk tingkat SD, sehingga kita berharap hasil pendidikan SD bisa lebih maju dari tahun kemarin,” sebut Hasrul. Panitia pelaksana try out Burhanuddin Zuhlil MA menegaskan kegiatan ini sudah dua kali dilaksanakan diYPIT Khairul Imam. “Minggu lalu ( 18/3) sudah dilaksanakan try out tingkat SMP dan diikuti sebanyak 800 siswa. Saat ini, try out untuk SD. Tujuan kegiatan ini untuk melatihsiswaagarmampumenja-wab pertanyaan di dalam soal UN,” demikian Burhanuddin. (h02)

Waspada/Hamdani

KETUA PARFI Sumut Erwin Norman Siregar (dua dari kanan), bintang sinetron Elma Theana (tiga dari kanan) dan pengurus PARFI Sumut Jonny Chandra (dua dari kiri) saat berbincang-bincang dengan panitia Dies Natalis ke-25 STIK-P di Garuda Plaza Hotel, Senin (2/4).

Festival Band Dan Pemilihan Top Model Semarakkan Dies Natalis Ke-25 STIK-P Elma Theana: Ilmu Komunikasi Berperan Dalam Dunia Entertainment MEDAN (Waspada): Dies Natalis ke-25 Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) akan disemarakkan dengan Festival Band dan Pemilihan Top Model Kota Medan pada pertengahan Mei 2012. Perhelatan akbar tersebut merupakan hasil kerjasama STIK-P dengan Persatuan Artis Film Indonesia (PARFI) Sumut. Demikian hasil pertemuan Ketua Panitia Dies Natalis ke 25 STIK-P Drs. Hendra DS dengan Ketua PARFI Sumut Erwin Norman Siregar di Garuda Plaza Hotel, Senin (2/4). Turut hadirWakil Ketua Panitia David Swayana, SIKom; Puket III STIK-P Austin Antariksa Tumengkol, SSos; bintang sinetron Elma Theana; pengurus PARFI Sumut Jonny Chandra, dan Bendahara PARFI Sumut Devi Olivia. Hendra DS mengatakan, Festival Band dan Pemilihan Top Model ini bertujuan untuk menggali bakat remaja di

Sumatera Utara khususnya Kota Medan. Diharapkan kegiatan ini menjadi saluran kreativitas para remaja untuk melakukan hal-hal positif dan bermanfaat bagi masa depannya. Pada kesempatan itu, Hendra memaparkan tentang perjalanan Sekolah Tinggi Ilmu Komunikasi “Pembangunan” selama 25 tahun dan kiprahnya dalam dunia jurnalistik maupun kehumasan yang banyak menghasilkan tenaga-tenaga trampil di bidangnya.

Mendengar pemaparan tersebut, bintang sinetron Elma Theana mengakui bahwa ilmu komunikasi memiliki peranan penting dalam dunia entertainment (hiburan). Salah satunya dalam Pemilihan Top Model Kota Medan yang akan digelar bulan depan. “Dalam Pemilihan Top Model tersebut, para peserta dituntut mampu berkomunikasi dengan baik terutama pada sesi tanya-jawab bersama dewan juri. Jadi, kemampuan para peserta membangun komunikasi dan berinteraksi dengan penonton akan memberi nilai tambah bagi dewan juri,” ujar Elma Theana. Melihat begitu semaraknya Ulang Tahun Perak STIK-P, Elma Theana menyatakan kesediaannya menjadi salah seorang dewan juri pada Pemilihan Top Model Kota Medan. “Insya Allah, saya akan hadir dan menjadi dewan juri dalam Pemilihan

Top Model nanti,” ujarnya. Sementara itu, Ketua PARFI Sumut Erwin Norman Siregar mengatakan, pihaknya memberi dukungan penuh demi terselenggaranya Festival Band dan Pemilihan Top Model Kota Medan. “ PARFI Sumut terus berupaya menjaring remaja-remaja yang memiliki bakat di bidang seni untuk dikembangkan sehingga mampu berprestasi di tingkat nasional,” ujarnya. Saat ini, lanjut Erwin, sejumlah artis asal Kota Medan yang sudah dibina oleh PARFI Sumut mulai berkiprah di kancah perfilman nasional. Ada juga artis asal Kota Medan yang membintangi sejumlah sinetron. “Jadi, PARFI Sumut berharap Festival Band dan Pemilihan Top Model Kota Medan dalam rangka Dies Natalis ke-25 STIKP ini, akan melahirkan bintangbintang baru yang mampu bersaing di tingkat nasional,” demikian Erwin.(m25)

Mobil Mewah Di Poldasu Jadi Rongsokan MEDAN (Waspada): Sejumlah mobil mewah barang bukti hasil kejahatan yang disimpan di Mapolda Sumut Jln. Sisingamangaraja Km 10,5 Medan, kini menjadi barang rongsokan. Pantauan Waspada, Selasa (3/4) siang, di antara mobil mewah itu ada Toyota Harrier, Mercy, BMW, Mitsubishi Double Cabin, dan Mazda Sport teronggok di tempat penyimpanan barang bukti yang tidak beratap. Selain itu ada juga mobil Suzuki Escudo, Toyota Kijang dan lainnya, termasuk dua alat berat dan sejumlah truk. Kondisi mobil-mobil itu terlihat memprihatinkan, ban kempes, body kusam dan berkarat karena setiap hari diterpa panas dan hujan. Sebagian kaca lampunya juga pecah dan interior dalam mobil kupak-kapik. Mesinnya juga berkarat, sepertinya sudah tidak hidup. Beberapa di antaranya bahkan tertutup semak belukar yang dibiarkan tumbuh di tempat penyimpanan barang bukti itu, sehingga sama sekali tidak kelihatan lagi. Semula mobil-mobil mewah itu sempat diletakkan di halaman masing-masing direktorat yang menangani kasusnya. Seperti Mercy warna biru tua sempat di parkir di depan Direkrorat Reserse Umum, sebelum Serse dipecah dua menjadi Serse Umum dan Serse Khusus. Sekitar dua tahun lalu mobil itu bahkan sempat digunakan salah seorang pejabat di Poldasu untuk operasional kerja. Tetapi kini sudah menjadi barang rongsokan. Sementara Mazda Sport warna hitam plat BL sudah bertahun-tahun teronggok di Poldasu, sejak mobil itu kelihatan

kinclong hingga kusam tak berharga. Dari keterangan sumber di Mapoldasu, barang bukti Mazda Sport itu nyangkut di Mapoldasu karena tidak memiliki surat-surat resmi. Mobil itu, kata sumber berasal dari Kota Sabang, Aceh. Mobilmobil lainnya yang nyangkut di Polda, karena pemiliknya kedapatan menyimpan barang bukti narkoba seperti ganja dan sabu-sabu. Kabid Humas Polda Sumut Kombes Pol. Heru Prakoso dihubungi Waspada mengakui banyak mobil mewah yang

menjadi barang bukti dibiarkan teronggok hingga rusak. Itu, kata dia, dikarenakan Polda tidak mempunyai penginapan khusus barang bukti, juga tidak ada petugas khusus merawat barang bukti. “Karenanya kita selalu mengimbau pemilik mobil merawat kendaraannya sendiri,” sebut dia. Tetapi, kata Heru, mobilmobil yang saat ini dibiarkan rusak merupakan barang temuan. “Kalau barang temuan mau diapakan, orangnya juga tidak jelas siapa, seperti Toyota Harrier sudah ada di Polda sejak

2006 lalu,” kata dia memberi alasan. Heru juga mengatakan tidak boleh anggota Polri menggunakan barang bukti tersebut, meskipun dengan alasan untuk perawatan. Namun ketika ditanya bahwa pejabat di Polda pernah menggunakan mobil-mobil itu sebagai alat operasional, Heru menyebutkan, semestinya tidak bisa. “Mungkin dulu ada kelonggaran, tetapi sekarang tidak, karena itu mobil-mobil tersebut sekarang dibiarkan di halaman dan rusak,” sebutnya.(m27)

Waspada/gito ap

MOBIL Mercy teronggok menjadi barang rongsokan di tempat penyimpanan barang bukti Polda Sumut, Selasa (3/4). Selain mobil itu, masih banyak mobil mewah lainnya yang senasib dengan Mercy tersebut, termasuk barang bukti lain semisal alat berat dan truk.

PAN Buat Program Berada Di Hati Rakyat MEDAN (Waspada): DPW Partai Amanat Nasional (PAN) Sumatera Utara berharap pengurus partai di kabupaten/kota segera membuat program kerakyatan. Dengan begitu, diyakini PAN akan berada di hati rakyat dan dapat mengejar target Pemilu 2014. Ketua DPW PAN Sumut Syah Afandin mengatakan itu kepada wartawan, Selasa (3/4). Pernyataan disampaikannya sekaitan dengan pelaksanaan rapat koordinasi (Rakor) PAN yang berlangsung di Parapat tangga 31 Maret lalu. Menurut Syah Afandin, yang akrab disapa Ondim itu, Rakor dilaksanakan untuk menyatukan persepsi kader PAN

di setiap tingkatan tentang program yang akan dilaksanakan sesuai hasil Rakernas PAN 1011 Desember 2011. Katanya, Rakernas PAN mengamanahkan partai harus melaksanakan program-program yang mendekatkan partai ke hati rakyat. Tidak saja secara emosional dan ideologis saja, tapi juga PAN ikut menjawab serta terlibat dengan permasalahan yang dihadapi rakyat. Berkaitan dengan itu, kata Ondim, maka Rakor PAN Sumut telah menugasi jajaran partai di kabupaten/kota untuk membuat program nyata. Mengakomodir serta menjawab permasalahan yang dihadapi rakyat di daerah. Tentunya tidak setiap

daerah menghadapi persoalan yang sama. “Makanya peran pengurus partai di daerah sangat penting. Karena merekalah yang tahu masalah yang dihadapi rakyat di daerahnya,” sebutnya. Selain itu, Rakor PAN Sumut juga menghasilkan rekomendasi tentang percepatan konsolidasi internal partai. Ditargetkan, Musyawarah Cabang (Muscab) PAN di tingkat kecamatan harus sudah selesai Mei 2012. Sedangkan Musyawarah Ranting (Musran) harus selesai Juli-Agustus,danditingkatRayon, paling lambat November 2012. Menurut Ondim, PAN berkeyakinan dengan membuat program kerakyatan, diiringi dengan kesiapan infrastruktur

partai, target pencapaian Pemilu akan bisa diukur. “Karena itu saya mengajak seluruh kader untuk membangun kebersamaan memberhasilkan komitmen Rakernas secara sungguhsungguh,” katanya. Disebutkannya juga, pelaksanaan Rakor PAN dirangkai dengan kegiatan pelestarian Danau Toba. Bersama dengan Badan Eksekutif Mahasiswa (BEM) Fakultas Ekonomi Universitas Medan Area (UMA), PAN menggelar aksi tabur bibit ikan nila. Kata Ondim, itu perwujudan dari kecintaan dan keterlibatan partai terhadap pelestarian Danau Toba yang sudah masuk dalam Kawasan Strategis Nasional (KSN). (m12)

Medan Metropolitan

WASPADA Rabu 4 April 2012

Masuk Inti Kota Medan, Sat Lantas Tahan 10 Truk Pengunci Roda Disiapkan Untuk Mobil Parkir Sembarangan MEDAN (Waspada): Sat Lantas Polresta Medan menahan 10 unit truk yang mengangkut material bangunan karena memasuki inti Kota Medan pada siang hari. “Selain ditahan, suratsurat kendaraannya juga ditilang,” tegas Kasat Lantas Kompol Risya Mustario, SH, SIK kepada Waspada di Medan, Selasa (3/4). Risya menjelaskan, razia terhadap truk yang masuk inti kota ini merupakan perintah Kapoldasu Irjen Pol Drs. Wisjnu Amat Sastro sebagai upaya mengantisipasi terjadinya kemacatan lalulintas. Risya yang didampingi Kanit Dikyasa AKP Rosmawati dan Iptu H. Sitorus merincikan, dalam razia di Jln Bambu II, polisi menilang 7 unit truk yang membawa material bangunan. Kemudian, satu truk di Jln.

Imam Bonjol, satu di Jln. Masjid Raya dan satu truk lagi di Jln. Ir. H. Juanda Medan. Selanjutnya, 10 truk tersebut ditahan di pergudangan kayu putih selama sebulan. Berdasarkan rekomendasi dari Dinas Perhubungan, lanjut Risya, truk yang mengangkut material bangunan hanya diizinkan masuk ke inti kota pada malam hari. “Truk yang mendapat rekomendasi dari Dinas Perhubungan mulai pukul 21:00 sampai pukul 05:00,” jelasnya. Tapi kenyataannya, banyak truk pengangkut material bangunan masuk ke inti kota pada siang hari. Kondisi ini menjadi pemicu kemacatan lalulintas dan mengganggu pengguna jalan lainnya. “Razia terhadap truk yang masuk ke inti Kota Medan akan terus dilakukan Sat Lantas Polresta Medan. Diharapkan truk yang mendapat rekomendasi mematuhi ketentuan yang sudah ada,” tegasnya. Selain itu, Sat Lantas Polresta Medan melakukan razia

terhadap becak bermotor (betor) plat hitam dan dari daerah luar Medan, hari ini (Rabu, 4/ 4). “Mulai hari ini, Sat Lantas Polresta Medan dibantu Polisi Militer merazia betor berplat hitam dan dari luar Medan di sejumlah lokasi,” jelasnya. Parkir berlapis Risya menambahkan, pihaknya akan melakukan penindakan terhadap mobil yang parkir berlapis dalam waktu dekat. “Hasil rapat kordinasi de-

ngan Dinas Perhubungan, penindakan dengan alat pengunci roda ini akan kita berlakukan minggu depan. Untuk sementara ini sudah ada 10 unit alat pengunci roda bantuan dari Dishub,” kata Risya. Jadi sistem kerjanya, bila ada mobil yang parkir berlapis atau di lokasi yang terdapat tanda larangan parkir dan tidak ada sopirnya, maka ban mobilnya langsung dikunci. “Di kaca mobil kita tempelkan kertas pem-

beritahuan, agar sopir segera datang ke Sat Lantas Polresta Medan. Setelah itu kita berikan tilang dan pengunci roda kita buka,” jelas Risya. Sebelum melakukan penindakan, Sat Lantas Polresta Medan melakukan sosialisasi melalui sejumlah media massa. Dengan adanya sosialisasi ini, diharapkan tidak ada lagi protes dari warga terutama pemilik mobil yang terkena tindakan. (m39)

Tewas Gantung Diri BELAWAN (Waspada): Seorang pemuda Indra Mawan, 24, warga Dusun 11, Desa Pematang Johar, Kec Labuhan Deli, ditemukan oleh adiknya Widi, tewas tergantung di dapur rumah orangtuanya, Senin (24) malam sekitar pukul 19:30. Indra gantung diri dengan menggunakan tali nilon dan diduga nekat bunuh diri akibat tidak tahan serta merasa malu karena dituduh teman-temannya sebagai pencuri. Petugas Polsek Medan Labuhan yang datang ke lokasi langsung melakukan olah TKP. Setelah pihak keluarga setuju dan membuat surat pernyataan, jenazah Indra tidak dibawa ke RSU dr Pirngadi Medan untuk divisum. Menurut Widi, abangnya itu baru tiga bulan datang ke Medan, setelah dipecat dari pekerjaanya di salah satu perusahaan swasta di Jakarta. Selama berada di Medan tidak bekerja dan hanya bergaul bersama teman lamanya. Satu bulan belakangan ini, di lingkungan tempat tinggal korban ada kabar rumah tetangga mereka kemalingan dan temantemannya menuduh korban yang melakukan pencurian itu. Indra sering diejeki teman-temannya hingga membuatnya malu. “Akibat diejek-ejek temannya, abang merasa malu dan tak mau keluar rumah seminggu belakangan ini,” kata Widi. Diduga akibat ejekan temannya itu, membuat jiwa Indra tidak tenang. Akibatnya, anak sulung dari dua bersaudara itu nekat mengakhiri hidupnya dengan cara gantung diri menggunakan tali nilon di dapur rumahnya. “Saya tadi mau ke belakang, tibatiba abang sudah tergantung,” sebutnya. (h03)

Dai Harus Mampu ‘Kawinkan’ Kesalehan Ibadah Dan Amal MEDAN (Waspada): Ketua Komisi Dakwah dan Pengembangan Masyarakat MUI Kota Medan Al Ustadz KH Zulfiqar Hajar Lc mengatakan, seorang dai atau mubaligh harus mampu“mengawinkan” antara kesalehan ibadah dengan kesalehan amal. “Jika hanya ibadah baik, tetapi duniawinya tidak baik, maka tidak bisa. Atau sebaliknya. Seharusnya, mampu ‘mengawinkan’ antara keduanya,” kata Zulfiqar dalam sambutannya mewakili Ketua Umum MUI Medan saat membuka Pelatihan Kader Dakwah (PKD) MUI Medan di kantor lembaga ulama itu, Jumat (30/3) siang. Acara yang diawali pembacaan ayat-ayat suci Alquranulkarim oleh Qari H Syaifuddin Azmi turut dihadiri unsur pengurus MUI Medan Prof Dr Ir H Basyarudin MS, Drs H Nasrun Zakaria (ketua panitia), dan Drs H Romsil Harahap sebagai moderator. Sedangkan narasumber Dekan Fakultas Dakwah IAIN Sumut Dr H Abdullah Jamil MA yang membahas tentang Ghazwul Fikri. Menurut Zulfiqar, seorang dai/daiyah dan mubaligh agar dapat membaikkan ibadah dan amal. Misalnya, aktif dalam Shalat Subuh berjamaah. “Dai/daiyah maupun mubaligh harus seperti kunci dan anak kunci. Keduanya harus puas,” sebut Zulfiqar yang juga Pimpinan Majlis Ta’lim Jabal Noor Medan. Dia meminta kepada dai serta mubaligh dalam menyampaikan materi ceramah harus aktual dan up to date. Misalnya, jika menjadi khatib Shalat Jumat pada satu masjid yang kebetulan sebagai tempat Safari Jumat Wali Kota Medan H Rahudman Harahap yang biasa membantu dalam pembangunan masjid, maka materi khutbah seharusnya bertemakan infak dan sedekah. “Media yang mereka gunakan adalah suratkabar, majalah, brosur, buku, media elektronik (televisi dan radio), internet dan lain-lain,” ujarnya. (cwan)

Waspada/Ist

ZULFIQAR Hajar (3 kanan) menyampaikan sambutan pada pembukaan PKD MUI Medan.

Pencuri Sepedamotor Dihajar Massa MEDAN ( Waspada): Dua pencuri sepedamotor dibekuk petugas kepolisian bekerjasama dengan warga dalam dua lokasi berbeda, Senin (2/4) malam. Satu di antaranya babak belur dihajar massa. Dari kedua tersangka Swt, 30, penduduk Jln. Gelas, Kel. Sei Putih Tengah, Kec. Medan Petisah dan HS, 26, penduduk Jln. Sei Asahan, Kel. Babura, Kec. Medan Sunggal, disita barang bukti dua sepedamotor Yamaha Jupiter MX BK 3830 OE dan Yamaha Mio BK 3054 SO, serta kunci leter T. Informasi Waspada peroleh di lapangan, kedua tersangka HS dan Swt dengan mengendarai Yamaha Mio mencari sasaran aksi mereka sepedamotor sepedamotor yang lagi parkir. Setiba di Jln. Setiabudi, Pasar I Medan, mereka melihat sepedamotorYamaha Jupiter MX BK 3830 OE lagi parkir di depan kedai korban Sukamto, 45. Keduanya langsung berhenti. Selanjutnya tersangka Swt turun dari bocengan mendekati sepedamotor itu, sedangkan HS standby di sepedamotor Mio. Melihat korban sedang sibuk melayani pembeli, tersangka Swt membuka paksa kunci kontak kendaraan itu dengan menggunakan kunci T. Namun, saat mesin sepedamotor itu dihidupkan, korban Sukamto mendengarnya dan bergegas keluar kedai.

Korban melihat sepedamotornya sedang didorong pria yang tidak dikenal, langsung mengejar dan menerkam tersangka Swt. Sementara tersangka HS langsung kabur dengan sepedamotornya. Massa yang berada di lokasi membantu menangkap tersangka Swt dan menghajarnya hingga babak belur. Petugas Reskrim Polsek Sunggal yang melintas di kawasan itu segera mengamankan tersangka dari amuk massa. Ketika dilakukan pemeriksaan dan pengembangan kasus itu, tersangka Swt mengakui temannya melakukan pencurian berinisial HS yang kemudian berhasil ditangkap saat tidur-tiduran bersama kekasihnya di rumah kos Jln. Gelas, Ayahanda Medan. Ketika diinterogasi, keduanya mengaku melakukan pencurian sepedamotor sudah berlangsung lama diperkirakan hingga mencapai 20 kali. Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK, melalui Kanit Reskrim AKP Victor Ziliwu, SH, SIK, ketika dikonfirmasikan seputar dua tersangka spesialis pencurian sepedamotor, membenarkan. Menurut Victor, kedua tersangka melakukan pencurian selalu bersama dan sasaran sepedamotor yang lagi parkir. “Satu tim kini sedang memburu satu pelaku lagi yang berperan sebagai penadah sepedamotor curian kedua tersangka,” katanya. (m36)

Tim Sespimti Polri 2012 Sharing Informasi Ke Pemprovsu

Kantor Hukum Rangkuty Santuni Anak Yatim MEDAN (Waspada): Kantor Hukum (Law Office) M Sa’i Rangkuty SH, MH Associate terdiri dari M. Satria SH, Suardi SH, M Iqbal Rangkuty SH, dan Ronny Chandra SH, menyantuni anak yatim piatu di lantai 2 kantornya Jln. Letda Sujono No.37-B Medan, Senin (2/4). Menurut advokat Sa’i Rangkuty, santunan dan pemberian bingkisan kepada 30-an anak yatim piatu terdiri dari pelajar SD Negeri Medan Estate dan SMP plus guru disekitar Jln. Letda Sujono, dimaksudkan sebagai syukuran memasuki kantor baru. “Sebelumnya kami berkantor di Jl. Willem Iskandar Medan Estate, mudah-mudahan dengan doa anak yatim kami mendapat ridho Allah SWT dalam melaksanakan tugas sebagai advokat untuk melayani klien dan masyarakat yang membutuhkan bantuan hukum,” ujar Rangkuty. Dia menyatakan, pihaknya bangga karena telah mendapat kepercayaan sebagai klinik hukum nara sumber di Radio UMSU guna mensosialisasikan tentang hukum kepada masyarakat melalui siaran langsung tiap hari Senin mulai pukul 09:00 s/d 10:00 Wib.(m24)

A5

Waspada/Rudi Arman

Petugas Sat Lantas Polresta Medan menghentikan truk yang mengangkut material bangunan di Jln. Bambu II Medan, Selasa (3/4). Penindakan terhadap truk masuk inti kota Medan ini merupakan perintah Kapoldasu Irjen Pol Drs. Wisjnu Amat Sastro.

DPRDSU Desak Percepat Pembangunan KEK Sei Mangkei MEDAN (Waspada): DPRDSU meminta Pemerintah Provinsi Sumatera Utara (Pemprovsu) membuat rekomendasi dan mendesak pemerintah pusat agar mempercepat pembangunan Kawasan Ekonomi Khusus (KEK) Sei Mangkei. Pemprovsu juga diminta segera membentuk tim supervisi yang khusus menangani program KEK ini. Dua pimpinan fraksi DPRDSU berbicara kepada wartawan di gedung dewan, Senin (2/4). Mereka adalah Ketua Fraksi Partai Demokrat (FPD) Tahan Manahan Panggabean dan Sekretaris Fraksi Partai Amanat Nasional (FPAN) Irwansyah Damanik. Pernyataan disampaikan berkaitan dengan pelaksanaan Musyawarah Rencana Pembangunan (Musrenbang) Sumut 2012 pada 2-3 April 2012. Tahan menyebutkan, KEK Sei Mangkei di Kabupaten Simalungun merupakan industri terpadu yang mengelola kelapa sawit dari hilir sampai hulu. Rencananya di kawasan itu akan dibangun pabrik-pabrik yang mengolah sembilan turunan produk kelapa sawit. Katanya, proyek di kawasan seluas lebih kurang 2002 hektare

ini akan menghabiskan dana sekitar Rp5 triliun. KEK didisain tidak untuk usaha kecil dan menengah. Seluruh industri yang ada disana merupakan skala besar dengan teknologi tinggi. Sementara usaha kecil dan menengah akan menjadi pendukung KEK Sei Mangke. Ditambahkan Irwansyah Damanik, kehadiran KEK akan memacu pertumbuhan ekonomi di Sumut. Diperkirakan sampai tahun 2025, di kawasan itu akan menampung 84.000 tenaga kerja. Artinya, setiap tahun sebanyak 6.500 orang akan ditampung di tempat itu. KEK, kata Irwansyah Danamik, merupakan salah satu bagian dari rencana besar pemerintah yang dituangkan dalam Masterplan Percepatan dan Peluasan Pembangunan Ekonomi Indonesia (MP3EI). Selain KEK Sei Mangke, proyek lainnya yang termasuk di dalamnya adalah Bandara Kualanamu, pelabuhan peti kemas Kualatanjung dan proyek Inalum. Untukmengdukungkegiatan MP3EI ini hingga akhir 2012, diperkirakaninvestasiyangmasuk ke Sumut lebih kurang Rp12,7 triliun. Yakni untuk membiayai

pembangunan KEK Sei Mangke, Bandara Kualanamu dan pelabuhan Kualatanjung. Sedangkan hingga tahun 2016 investasi itu akan menjadi Rp23,3 triliun. Melihat besarnya program yang telah disusun pemerintah pusat untuk mendukung percepatan pembangunan ekonomi di Sumut, Tahan Panggabean dan Irwansyah Damanik, merasa perlu mendesak Pemprovsu untuk bekerja lebih serius lagi. Kata mereka, Musrenbang yang sedang dilaksanakan sekarang ini sangat strategis untuk membicarakan masalah ini. DPRDSU menilai, pelaksanaan proyek KEK Sei Mangkei berjalan lambat. Industri yang baru terbangun di sana masih pabrik pakan ternak. Karenanya sangat dibutuhkan percepatan pembangunan agar target yang ditentukan tercapai. DPRDSU berpikiran, Musrenbang yang sedang dibahas dapat menghasilkan rekomendasi. Isinya Pemprovsu mendesak pemerintah pusat untuk mempercepat program MP3EI. Khusus untuk proyek KEK, DPRD SU meminta Pemprovsu membentuk tim supervisi yang khusus menangani proyek ini. (m12)

MEDAN (Waspada): Sejumlah peserta Sekolah Staf dan Pimpinan Tinggi (Sespimti) Polri Angkatan ke 20 mengunjungi Pemprov Sumatera Utara, untuk melakukan Sharing (mengumpulkan) informasi tentang daerah ini, Selasa (3/4). Kunjungan tim dalam rangka kuliah kerja dalam negeri (KKDN) dengan pimpinan rombongan Kombes Pol Nasrullah itu diterima Sekda Pemprov Sumut H Nurdin Lubis SH, MM yang bertindak atas nama Plt Gubsu H Gatot Pujo Nugroho ST dan didampingi sejumlah Staf Ahli dan pimpinan Satuan Kerja Perangkat Daerah (SKPD) terkait. Dalam pertemuan yang digelar di Ruang Beringin Lantai VIII Kantor Gubernur Sumut itu, Sekda menjelaskan beberapa perkembangan dan progres pembangunan daerah yang berpenduduk 12.985.075 jiwa dengan 33 kabupaten/kota, 421 kecamatan dan 5.802 desa/kelurahan itu hingga akhir tahun 2011, terutama terkait indikator ekonomi, sosial, dan kemasyarakatan. “Selain pertumbuhan ekonomi Sumut 2011 sebesar 6,58 persen yang telah berhasil melampaui target pertumbuhan ekonomi nasional sebesar 6,50 persen, saat ini Sumut tengah mempersiapkan diri untuk menghadapi agenda demokrasi politik berupa Pilgubsu Tahun 2013 yang kini mulai terasa gaungnya,” ujar Sekda. Sekda berharap, suksesnya pelaksanaan Pilgubsu 2013 nanti bisa menyertakan peran aktif Polri khususnya Polda Sumut bersama Kodam I Bukit Barisan dan pihak-pihak terkait lainnya, terutama untuk mengantisipasi berbagai gejolak dan dinamika politik yang berkembang, sehingga agenda demokrasi tersebut terlaksana dengan aman dan kondusif. Selain itu Sekda juga menginformasikan kepada segenap aparat Bhayangkara Negara ini tentang penanganan wilayah perbatasan khususnya yang langsung berbatasan dengan negara tetangga, seperti Pulau Berhala di bagian Timur Sumut yang berbatasan dengan Malaysia dan Pulau Wunga serta Pulau Wau

di bagian Barat Sumut yang berbatasan dengan Madagaskar. “Kami berharap keberadaan tiga pulau ini bisa mendapatkan perhatian serius dari pemerintah khususnya Polri dan TNI, sebab dapat menjadi ancaman dalam hal keamanannya dan hal ini di masa-masa mendatang jangan sampai terjadi seperti kasus lepasnya Pulau Sipadan dan Ligitan dari NKRI,” sebutnya. Di kesempatan tersebut, Sekda atas nama Pemprov Sumut juga mengucapkan terima kasih kepada Polda Sumut dibantu Kodam I Bukit Barisan serta Forum Komunikasi Pimpinan Daerah (FKPD) yang sangat sigap dalam menghadapi aksi demonstrasi terkait kebijakan BBM. Hal penting lainnya yang diinformasikan kepada tim Sespimti Polri itu menyangkut penyelesaian masalah pertanahan, khususnya mulai dari Kabupaten Langkat hingga Kabupaten Labuhanbatu Selatan. Permasalahan agraria, khususnya menyangkut eks HGU PTPN 2 ini diakui Sekda telah menimbulkan konflik berkepanjangan antara warga dengan pihak PTPN 2. “Namun, secara umum berbagai permasalahan pertanahan di Sumut dewasa ini dapat diselesaikan dengan cara dialog dan musyawarah antara pihak-pihak terkait, walau tak dipungkiri permasalahan ini kerap ditunggangi pihak ketiga terutama menjelang agenda demokrasi politik pada Pilgubsu/Wagubsu tahun 2013,” kata Sekda. Kombes Pol Nasrullah mengaku, apa yang disampaikan Sekda Pemprov Sumut itu akan menjadi masukan sangat berharga bagi peserta Sespimti Polri Angkatan ke 20. Sebab, tujuan kunjungan ke daerah ini adalah untuk pembelajaran dan untuk membuka wawasan tentang Sumut. Nasrullah menerangkan, peserta Sespimti Polri Angkatan ke 20 yang keseluruhannya berjumlah 50 orang itu juga akan mengunjungi sembilan provinsi lainnya dengan tujuan dan maksud yang sama dengan apa yang dilakukan dalam kunjungan ke Sumut. Di akhir pertemuan, ke dua belah pihak melakukan tukar cenderamata yang diikuti dengan foto bersama antara peserta Sespimti Polri Angkatan ke 20 dengan Sekda Pemprov Sumut, Staf Ahli, dansejumlahpimpinanSKPDPemprovSumut.(m28)

UUM Kunjungi YPI Amir Hamzah MEDAN (Waspada): Universiti Utara Malaysia (UUM) melakukan kunjungan kerjasama akademik di Yayasan Pendidikan Islam (YPI) Amir Hamzah Jln. Meranti Medan Petisah, baru-baru ini. Pegawai TU YPI Amir Hamzah Mus’ab kepada Waspada, Sabtu (31/3) mengatakan, dalam kunjungan itu, tim UUM terdiri dari Prof Dr Abdul Rahman Abdul Aziz BA, Hons, MA, Ph.D, Prof Dr Sjafri Sairin MA, dan Dr Utari. Mereka secara langsung memperkenalkan UUM kepada siswa/i YPI Amir Hamzah. Kehadiran UUM di Kota Medan, juga melakukan kunjungan ke beberapa Universitas Negeri dan Swasta guna menjalin silaturrahim dan saling tukar informasi.

Selama kunjungan di YPI Amir Hamzah, pihak UUM melakukan kegiatan, antara lain menawarkan kerjasama akademik berupaya pemberian beasiswa bagi pelajar SMA/SMK YPI Amir Hamzah yang lulus dengan prestasi memuaskan dari Ujian Akhir Nasional yang akan digelar 16 s/d 20 April 2012. Ketua Dewan Pembina YPI Amir Hamzah Prof Dr H Usman Pelly MA mengatakan, jarak antara Medan dan Malaysia yang begitu dekat, sangat memungkinkan untuk membangun kerjasama akademik yang saling menguntungkan kedua belah pihak. Kunjungan UUM mendapat sambutan hangat dari seluruh siswa/i SMA/SMK Amir Hamzah, dan para guru serta staf dalam suasana akrab penuh kekeluargaan.(m24)

Semarak Launching All New Vario Techno 125 PGM-FI MEDAN (Waspada): Ribuan pengunjung memadati lokasi digelarnya launching produk teranyar Honda All NewVario Techno 125 PGMFI yang berlangsung di Plaza Medan Fair pada 1 April 2012. Selain dipenuhi hiburan berkelas khas Honda, para pengunjung juga berkesempatan menjadi saksi lahirnya teknologi masa depan. Dalam kegiatan yang berlangsung sehari penuh itu, Honda tidak pernah membiarkan pengunjung berhenti merasakan semarak launching All New Vario Techno 125 PGM-FI. Beragam hiburan menarik yang disuguhkan seperti Batender Competition, Dance Competition, Foto Contest, dan Model Elegan Competition seakan menghipnotis mereka hingga tidak ingin melewatkan setiap moment walau hanya sedetik. Honda juga menyuguhkan keceriaan pada anak-anak lewat lomba mewarnai, menggambar dan sempoa, sehingga dapat mengasah kemampuan anak. Setiap zona pastinya memiliki daya tarik tersendiri, salah satunya zona teknologi, dimana pengunjung dapat lebih mengenal keunggulan

produk terbaru All New Vario Techno 125 PGM-FI, terutama teknologi yang diusungnya seperti PGM-FI dan eSP (Enhanced Smart Power) yang terbukti mampu memukau pengunjung. Zona Test Ride juga menjadi primadona, pesona All New Vario Tecnho 125 ini benar-benar telah memikat hati banyak pengunjung hingga rela antri untuk mencoba dan merasakan secara keunggulan matik terbaru ini. Leo Wijaya, Marketing Manager CV. Indako Trading Co selaku main dealer Honda di Sumatera Utara mengatakan, pihaknya sangat bangga dapat menghadirkan All New Vario Techno 125 PGM-FI yang dilengkapi dengan beragam teknologi canggih sehingga dapat menjawab kebutuhan masyarakat akan kendaraan berkualitas tinggi. “Melihat respon luar biasa yang ditunjukkan pengunjung saat launching, kami semakin yakin All New Vario Techno 125 PGM-FI akan diterima dengan baik oleh masyarakat, “ ujar Lie Ci Pin, Promotion Manager CV. Indako Trading Co. Tidak ketinggalan, club-club motor Honda juga turut memeriahkan launching kali ini, antara lain Honda Tiger Club Me-

dan (HTCM), Tiger Independent Medan Club (TIMEC), Medan Tiger Brotherhood (MTB), NSR Motor Club (NMC), Vario Matic Club (VANATIC), Honda Club CS 1 (HCC One), Honda Revo Club (HRC), Honda Vario Club(HVC), Honda Mega Pro Club (HMPC), D’BeATTELLS, Honda Cub 70 Medan (HC 70 M), Community Honda Supra Xpression (CAS-X), Club CB Medan (CCM), Honda Super Cub Community (HSCC), CBR Club Medan, Revo Executive Club (RECEX), Revolution Supra X 125 Motor Club (RSMC), HSX 125 Embrio Medan dan Scoopers. Kemeriahan launching semakin sempurna lewat hiburan berkelas dari band papan atas tanah air D’Masiv yang membawakan tembang-tembang andalan mereka seperti Jangan Menyerah, Cinta Ini Membunuhku dan Diam Tanpa Kata. Band yang digawangi Rian (vocal), Dwiki (gitar), Nurul (gitar), Rayyi (bass) dan Wahyu (drum) ini, sukses memuaskan kerinduan para Masivers yang ada di Kota Medan. All New Vario Techno 125 PGM-FI dibekali teknologi matik terbaru Honda yang dikembangkan secara global, yaitu eSP (Enhanced Smart Power) yang merupakan penamaan untuk

mesin terbaru inovasi Honda, mengaplikasi terknologi terkini yang mampu mengatur pelumas agar bekerja efektif yang akhirnya dapat menambah kinerja mesin sehingga menghasilkan beberapa manfaat. Pertama, performa terbaik di kelasnya berupa akselerasi cepat sehingga mampu menempuh jarak 200 meter hanya dalam waktu 12,8 detik. Kedua, konsumsi bahan bakar paling

efisien di kelasnya yang mana 30 persen lebih hemat dibandingkan denganVario sebelumnya (52,1 km per liter dengan menggunakan metode pengukuran ECE R40). Ketiga, skutik dengan teknologi mesin baru ini mampu menekan emisi gas buang secara drastis yang mencerminkan komitmen Honda untuk menciptakan“Langit Biru Untuk Indonesia.” Motor ini merupakan karya terbaik yang

memadukan performa dan kepraktisan. Sementara itu, Gunarko Hartoyo, Marketing Research Development Manager CV. Indako Trading Co mengatakan, Honda siap memasuki era baru bersama All NewVario Techno 125 PGM-FI. Honda juga siap bersamasama masyarakat mewujudkan Indonesia yang bersih, sehat dan nyaman.(adv)

Waspada/ist

RIBUAN pengunjung tidak berhenti memadati tempat digelarnya Launching produk teranyar Honda All New Vario Techno 125 PGM-FI yang berlangsung pada 1 April 2012 di Medan

Medan Metropolitan

A6

WASPADA Rabu 4 April 2012

MUI Tidak Berpihak Pada Umat

Nabi Warisi Masjid Pada Ulama MEDAN (Waspada): Para ulama yang tergabung dalam Majelis Ulama Indonesia (MUI) baik Medan maupun Sumut dinilai sudah tidak lagi berpihak kepada kepentingan umat. Kehadirannya sudah tidak dapat disebut lagi sebagai memrepresentasikan umat. Fatwa dan pernyataannya lebih condong berpihak kepada penguasa. Contoh konkrit MUI tidak berpihak pada kepentingan umat adalah dalam hal perubuhan masjid yang dilakukan pengembang di beberapa tempat di Medan. Umat Islam kecewa, karena MUI tidak pernah tegas mengeluarkan fatwanya tentang ini. Berbeda kalau program itu datangnya dari pemerintah. MUI langsung mengeluarkan fatwa haram merokok, atau haram bagi orang kaya menggunakan BBM bersubsidi. Mengapa itu terjadi? khusus untuk MUI Sumut dan Medan, karena unsur pengurus teras

organisasi ini diduduki oleh orang-orang dari kalangan birokrat atau mantan birokrat yang berstatus pegawai negeri. Inilah yang kemudian mempengaruhi keberpihakan mereka, tidak kepada umat, tapi kepada penguasa dan pengusaha. Menanggapi sinyalemen ini, Wakil Ketua DPRD Sumut Sigit Pramono Asri, juga tidak berani berkata tegas. Tapi dia memberikan gambaran-gambaran tentang tugas ulama secara umum. Ditemui Waspada di ruang kerjanya, Selasa (3/4), politisi Partai Keadilan Sejahtera (PKS) ini mengatakan, salah satu tugas ulama (baca MUI) adalah menjaga eksistensi masjid. Karena masjid adalah simbol persatuan umat Islam. Kata Sigit Pramono, ulama itu adalah pewaris para nabi. Sementara saat Nabi Muhammad SAW hijrah dari Makkah keYatsrib (Madinah), bangunan pertama yang didirikannya adalah masjid. Melihat ini, sesungguhnya melindungi masjid adalah tugas utama para ulama. “Karena mereka pewaris nabi, dan nabi mewarisi masjid,” katanya. Juga disebutkan Sigit, bahwa dari langit, pandangan yang

Usir Roh Halus

Mahasiswa Siram Air Tujuh Rupa Ke PTPN IV MEDAN (Waspada): Puluhan mahasiswa asal Kabupaten Simalungun, menyiram air tujuh rupa ke halaman kantor PT Perkebunan Nusantara (PTPN) IV Jln. Letjen Suprapto, Medan, saat unjuk rasa penolakan pengalihan lahan, Selasa (3/4). Aksi “mistis” itu disebut massa untuk mengusir roh halus yang sudah memengaruhi pejabat perkebunan sehingga mengkonversi lahan dari perkebunan teh menjadi sawit. Penolakan pengalihan lahan diakui massa sebagai langkah pencegahan kerusakan lingkungan dikarenakan lokasi konversi perkebunan di Kecamatan Bahbutong dan Sidamanik, mengakibatkan banjir. Padahal, kata mereka, selama ini kawasan perbukitan itu tidak pernah tergenang air. “Saat ini baru 15 hektar lahan yang dikonversi menjadi kebun sawit, bayangkan jika ratusan hektar kebun teh diganti sawit semua,” sebut Teguh, koordinator aksi massa. Berbeda dengan aksi sebelumnya yang diwarnai caci-maki hingga berujung bentrok, kali ini massa mengekspresikan kekecewaan mereka dengan ritual magis. Beberapa mahasiswa membawa dupa dan air jeruk perut melakukan upacara adat yang diakhiri penyemburan air sirih yang dikunyah, dan penyiraman halaman rumah dengan air tujuh rupa. Aksi itu menurut mereka bisa mengusir mahkluk halus di gedung PTPN IV yang sudah memengaruhi pola pikir pejabat perkebunan. Tidak lama setelah acara ritual itu, Plt Corporate Secretary PTPN IV Lindang Panggabean muncul menemui massa. Entah ada kaitannya dengan ritual itu, Lindang kemudian menyatakan manajemen sudah membatalkan rencana konversi lahan. Pernyataan itu langsung disambut histeris pengunjuk rasa dan mengucapkan pujian kepada direksi PTPN IV. Kata Lindang, keputusan membatalkan rencana konversi memiliki resiko kerugian yang besar. Dia menyebutkan, tanaman teh tidak memiliki keuntungan sehingga dialihkan ke perkebunan sawit. “Namun meski tidak untung, tetap dibatalkan. Kami lebih memilih mendengarkan aspirasi masyarakat,” sebutnya mengatakan areal itu seluas 1.646 hektar terletak di Sidamanik seluas 709 hektar dan 937 hektar di Bahbutong.(m27)

tampak terang benderang di bumi adalah masjid, sedangkan yang gelap gulita itu adalah pasar (tempat orang bertransaksi. Seperti mall, plaza dan sejenisnya). Dengan begitu, jangan karena ingin membangun pasar, masjid yang digusur. Menjawab Waspada, Sigit Pramono menyatakan setuju kalau harusnya para ulama lah yang berkewajiban memberikan pencerahan kepada semua pihak tentang masalah ini. Baik

kepada umat, umara (pemerintah) maupun umala (pemilik modal). “Sekarang sepertinya pemilik modal dibiarkan bebas mempengaruhi kebijakan pemerintah,” tambahnya. Tentang pengurus MUI yang umumnya berstatus atau bekas pegawai negeri? Sigit Pramono juga tidak menjawabnya tegas. Kembali dia memberikan ilustrasi tentang sejarah ulama Islam masa lalu. Katanya, ulama-ulama

besar masa lalu tidak dijumpai mereka yang berstatus pegawai pemerintahan. Ibnu Qaldun, misalnya, berasal dari keluarga pedagang yang kaya raya. Begitu juga Ibu Sinah yang berprofesi sebagai dokter. Juga Imam Syafii, yang merupakan konglomerat, serta sejumlah ulama lainnya. Dengan status seperti itu, tentu saja para ulama tersebut lebih mandiri dalam mengeluarkan pemikiran atau fatwa-fatwanya. (m12)

Aspri Tingkatkan Advokasi Jurnalis MEDAN (Waspada) : Untuk mengembangkan sayap organisasi, Dewan Perwakilan Daerah (DPD) Asosiasi Pers Republik Indonesia (Aspri) Sumatera Utara mulai melakukan pembentukan Dewan Perwakilan Cabang (DPC) di setiap kabupaten/kota. “Pembentukan pengurusan cabang ini dilakukan selain mengembangkan organisasi juga meningkatkan dan mengembangkan potensi pers atau wartawan dan memberikan advokasi kepada masyarakat tentang tugas dan kinerja pers,” ujar Wakil Ketua DPD Aspri Sumut Saifuddin AW didampingi Sekretaris TA Saladdin, di kantornya Jln. Merbabu, Medan, Selasa (3/4). Menurut dia, dengan semakin meratanya pembentukan kepengurusan di setiap kabupaten/kota, akan semakin meratanya pengetahuan tugas dan fungsi wartawan itu sendiri. “Karena dalam hal ini kita memberikan advokasi tentang bagaimana hukum undang-undang yang berlaku tentang pers,”

sebutnya. Kata Saifuddin, jika hal itu telah terbentuk di seluruh kabupaten/kota, tentunya tujuan dari pembentukan Aspri di dalam memberikan advokasi hukum pers akan semakin merata, tidak hanya kalangan pers atau wartawan juga masyarakat,” ujarnya. Selain itu, lanjutnya, Aspri juga dapat dijadikan mitra didalam perlindungan hukum terhadap wartawan ataupun pers yang terkena delik dari pemberitaan ataupun perlakuan tindakan kriminal, dan lainnya. Sementara Sekretaris DPD Aspri Sumut TA Saladdin menyatakan, organisasi Aspri telah terbentuk pada 30 November 2010 dan pada Oktober 2011 telah dilakukan perubahan komposisi kepengurusan di tubuh Aspri Sumut karena ada oknum yang mengaku pengurus DPD dan mengambil keuntungan sendiri dengan membentuk DPC-DPC di 5 kabupaten/kota. “Telah kita selidiki ternyata oknum tersebut tidak memiliki SK

dari DPP atas kepengurusan tersebut. Inilah yang perlu diawasi dan masyarakat harus berhati-hati,” katanya. Berkaitan rencana program kerja ASPRI Sumut dalam membentuk DPC dan dalam waktu dekat akan menurunkan tim ke setiap daerah untuk melakukan pembentukan DPC tersebut. Meski selama ini memang pembentukan DPC sedikit terlambat karena adanya sedikit halangan. Sampai saat ini, DPC Aspri Sumut yang baru terbentuk memang hanya DPC Labuhan Batu. “Seandainya jika ada di daerah sudah terbentuk berarti bukan kita yang memberikan. Dalam hal ini kita membuka peluang seluas-luasnya terhadap insan pers ataupun yang simpatik dengan insan pers dapat berbaur ataupun terlibat dalam kepengurusan di daerahdaerah. Untuk mendapatkan mandat ataupun SK tersebut, para calon pengurus daerah dapat langsung datang ke kantor Aspri Jalan Merbau,” tuturnya. (m38)

Satkom PWI Sumut Sajikan Informasi Aktual MEDAN (Waspada): Ketua Persatuan Wartawan Indonesia (PWI) Cabang Sumatera Utara Drs. Muhammad Syahrir melakukan pemancangan tower Satuan Komunikasi (Satkom) PWI Sumut di halaman Gedung PWI SumutParadaHarahapJln.Adinegoro No.4 Medan, Jumat (30/3). Turut mendampingi Sekretaris PWI Sumut Edward Thahir, SSos, Ketua Satkom PWI Sumut Brilian Moktar, SE, Wakil Ketua Feirizal Purba, Sekretaris M Akhiruddin, Wakil Bendahara Satkom Dra Evalisa Siregar, Sekretaris Koperasi PWI Sumut Zultaufik, dan Kepala Bidang Teknisi Satkom Ir. Suprianto. Pemancangan tower diawali pembacaan doa dipimpin

Wakil Sekretaris I PWI Sumut Zul Anwar Ali Marbun, dilanjutkan penaburan semen pada pondasi tower dilakukan Ketua PWI Sumut Muhammad Syahrir bersama unsur pengurus lainnya. Ketua PWI Sumut Muhammad Syahrir menjelaskan, pemancangan tower merupakan langkah maju untuk mempermanenkan posisi antena pemancar Satkom PWI Sumut.“Ini menjadi Satkom PWI yang pertama di Indonesia dan menjadi kebanggaan masyarakat Sumatera Utara,” kata Syahrir. Ketua Satkom PWI Sumut Brilian Moktar yang juga anggota DPRDSU mengatakan, setelah pembangunan tower permanen di Gedung PWI Sumut

selesai, dalam waktu dekat juga akan dilakukan pemasangan antena pemancar di Huta GinjangTapanuli Utara dan di lokasi lainnya, sehingga dapat menjangkau wilayah kerja 13 PWI Perwakilan yang tersebar di Kabupaten/Kota se Sumut. “Melalui sarana Satkom diharapkan komunikasi yang lebih intensif antar anggota PWI Sumut maupun dengan para mitra kerja dapat terjalin lebih harmonis. Dalam proses pembenahan yang berkelanjutan, Satkom PWI Sumut juga akan menyajikan informasi aktual, terkini dan tercepat yang menjadi kebutuhan masyarakat luas,” papar Brilian. (m08/rel)

Suami Istri Pengedar Togel Ditangkap MEDAN (Waspada): Petugas Unit IV Judi Subdit III Direktorat Reserse Kriminal Umum (Dit Reskrimum) Polda Sumut, Senin (2/4) malam, menggerebek kediaman AT, 45, atas dugaan bandar judi toto gelap (togel) di kawasan Jalan Binjai, Medan Sunggal. Polisi kemudian menangkap AT, termasuk istrinya D br S, 43. Selain itu, disita barang bukti uang Rp26 ribu, 2 kalkulator, buku catatan, HP dan pulpen. Kasubdit III Dit Reskrimum Polda Sumut AKBP Andry Setiawan melalui Kanit Judi Kompol Saptono kepada wartawan mengatakan, suami istri itu ditangkap saat menerima pesanan togel. Kata dia, D br S ditangkap dengan barang bukti HP berisi nomor pesanan togel.“Ditanya keberadaan suaminya, dia membawa petugas menuju lantai II. Di lantai II AP terlihat mencatat penghasilan togel,” kata Saptono. Tersangka AP sempat melarikan diri, bahkan lompat dari lantai II rumahnya dan menabrak seng rumah tetangga sehingga badannya lebam. Namun dia ditangkap dua petugas yang menunggu di samping rumah itu. Keduanya, kata Saptono, diancam pasal 303 KUHPidana, ancaman hukuman maksimal lima tahun penjara. Sementara, tersangka AP mengaku menjual togel untuk memenuhi kebutuhan hidup keluarganya. Dia mengatakan, baru tiga bulan menjual togel, kemudian uangnya disetor kepada pemilik togel STM bermarga Sinaga.(m27)

Waspada/Ist

KETUA PWI Sumut Muhammad Syahrir didampingi sekretaris Edward Thahir,Ketua Satkom PWI Sumut Brilian Moktar,Wakil Ketua Feirizal Purba,Sekretaris M Akhiruddin,Wakil Bendahara Satkom Dra Evalisa Siregar melakukan pemancangan tower Satkom di halaman Gedung PWI Sumut, Jumat (30/3).

Waspada/Arianda Tanjung

SEJUMLAH warga melihat mobil sedan Mitsubhisi Lancer BK 1001 ZZ dalam kondisi ringsek setelah menabrak tiang lampu Mercury dan pohon median jalan di Jalan Gatot Subroto, Medan, Selasa (3/4) sekira pk 03:30. Pengemudi mobil tewas di tempat kejadian.

Tabrak Tiang Mercury, Pengemudi Mobil Tewas MEDAN (Waspada): Mengendarai mobil dengan kecepatan tinggi, Dicki Minofti, 30, warga Jalan Sei Belutu, Kel. Padangbulan Selayang I, Kec. Medan Selayang, tewas akibat menabrak tiang lampu mercury di Jalan Gatot Subroto Medan, Selasa (3/4) sekira pukul 03:30. Informasi yang diperoleh di kepolisian, korbanyangbekerjasebagaiagenjualbelimobil, pagi itu mengendarai mobil sedan Mitsubhisi Lancer BK 1001 ZZ datang dari arah kawasan Jalan Gatot Subroto menuju inti Kota Medan. Sesampainya di Jalan Gatot Subroto depan Kantor Imigrasi, tiba-tiba mobil yang

dikendarai oleng ke kiri lalu korban banting stir ke kanan. Akibatnya, mobil menabrak tiang lampu Mercury dan pohon yang berada di median jalan sehingga terbalik. Korban meninggal dunia di tempat kejadian. Petugas Unit Laka Satlantas Polresta Medan Aiptu Syahnan yang turun ke TKP melihat korban sudah tewas dalam kondisi luka pecah di bagian kepala dan mengeluarkan darah dari telinganya, sedangkan mobil dalam kondisi ringsek. “Mayat Dicki segera dievakuasi ke instalasi jenazah RSU Dr Pirngadi Medan dan telah diambil oleh pihak keluarganya,” sebut Syahnan. (h04)

Unimed Didik 17.879 Guru Hasil UKA 2012 MEDAN (Waspada): Universitas Negeri Medan (Unimed) dipercayakan melatih dan mendidik 17.879 dari 20.196 guru yang masuk program sertifikasi tahun 2012 di Sumut. Di Indonesia, Unimed perguruan tinggi kedua paling banyak mendidik guru setelah Universitas Pendidikan Indonesia (UPI) Bandung. “Tahun ini kita dipercaya melatih 17.879 guru di 25 program studi. Paling banyak UPI dengan jumlah mencapai 21 ribu guru,” kata Pembantu Rektor I Unimed Prof Kharil Anshari, di Medan, Selasa (3/4). DiSumut,katanya,selainUnimed,Lembaga Pendidik Tenaga Kependidikan (LPTK) penyelenggaraPendidikanLatihanProfesiGuru (PLPG) adalah Universitas HKBP Nommensen dan Universitas Muslim Nusantara. Namun, Khairil mengaku tidak mengetahui jumlah guru yang dilatih di dua universtias itu.“Saya tidak tahu jumlahnya karena tidak ada tebusannya ke kita,” ujarnya. Penyelenggaraan PLPG saat ini semakin ketat. Hal ini merujuk hasil ujian kompetensi awal (UKA), di mana kualitas guru sangat rendah. “Nilai rata rata guru kita itu 30, dan

nilai rata-rata nasional 42. Kita diminta untuk meningkatkan kompetensi guru hingga mencapai 60 sebagai standar kelulusannya,” ucapnya. Khairil mengaku menaikkan standar guru hingga dua kali lipat bukan perkara mudah. “Kita akan pisahkan antara guru yang nilainya 40, dan yang nilainya 30 atau dibawah 30.Tentunya, perlakuannya juga akan berbeda nantinya,” jelasnya. Pelaksanaan sertifikasi guru akan dimulai Unimed pada pertengahan Mei. Saat ini pihaknya masih menunggu penandatanganan kontrak yang rencana dilakukan 12 April mendatang. “Rencana kita minta penambahan asesor, kalau jumlah yang ada ini tidak cukup untuk mengejar Agustus selesai,” sebutnya. Sementara Rektor Universitas HKBP Nommensen Jongkers Tampubolon menyatakan, tahun ini pihaknya dipercaya untuk mendidik 965 guru. Jumlah ini rencana akan di PLPG kan dalam tiga gelombang. “Rencananya kita mulai PLPG nya bulan Juni atau Juli, pada saat mahasiswa libur. Dalam satu gelombangnya waktu pelatihannya 10 hari, maka sebulan dosen kita fokus disini. Kami tidak mau gara-gara ini terganggu kuliah mahasiswa,” katanya. (m49)

Kemauan Mahasiswa Menulis Jurnal Ilmiah Masih Rendah MEDAN (Waspada): Secara umum kemauan mahasiswa menulis karya ilmiah masih rendah. Padahal, sesuai surat edaran Ditjen Dikti No: 152/E/T/2012, mahasiswa diwajibkan membuat karya tulisan ilmiah untuk meraih gelar S-1, S-2, dan S-3. “Budaya mahasiswa menulis karya ilmiah hasil penelitiannya masih sangat minim, sehingga keberadaan surat edaran Ditjen Dikti itu menuai pro dan kontra,” kata praktisi jurnalistikTaufikWal Hidayat S.Sos, MAP pada diskusi ilmiah di Fakultas Hukum UISU Al Munawwarah Jln. Sisingamangaraja Medan, Kamis (29/3). Dalam diskusi bertema “Menulis Karya Ilmiah Gampang tapi Bukan Gampangan” itu, alumni Komunikasi Fisipol USU tersebut mengatakan, dalam menulis diutamakan kemauan mencurahkan ide, gagasan ataupun pikiran.“Terusmenulisituperlu,agarmahasiswa terbiasa membuat karya tulis,” ujarnya. Kelemahan mahasiswa, sambungnya, mereka tidak mau mencurahkan ide-ide, gagasan atau orasi yang dilontarkannya dalam bentuk tulisan. Padahal, jika saja mau atau setidaknya untuk mencoba menulis, maka goresan itu bisa menjadi karya ilmiah. Katanya, kebiasaan menulis itu bahkan bisa bernilai ekonomis seperti tulisan yang terbit di media massa. Jika dikaitkan dengan

kata jurnal (catatan harian) dan istik (berkaitan estetika/seni) maka kebiasaan mencatat atau menulis, digabungkan dengan estetika ilmiah, akan menjadikan mahasiswa semakin terlatih dalam membuat karya ilmiah yang berestetika sesuai nilainilai objektivitas. Dia menilai, mahasiswa mau menulis jika diberikan tugas oleh dosennya atau menulis skripsi ilmiah untuk meraih gelar sarjananya. Hal itu membuat mahasiwa pasif, tidak kreatif dan berinovatif. Seharusnya mahasiswa begitu memiliki ide atau gagasan, apalagi temuan ilmiah yang dihasilkan, sebaiknya memasukan dalam jurnal ilmiah yang ada di kampus. Bagi sivitas akademika terutama dosen dan mahasiswa, lanjutnya, temuan ilmiah yang dipublikasikan ke jurnal ilmiah atau ke media massa merupakan salah satu realisasi dari amanah Tri Dharma Perguruan Tinggi. Sementara Dekan Fakultas Hukum UISU Dr Dra Hj LailyWashliati mengatakan, mahasiswa Fakultas Hukum harus memiliki orientasi ke depan, sebab ilmu dan pengetahuan terus berkembang. Perkembangan tersebut jika tidak diikuti dengan kreativitas daninovatifmakamahasiswaakanketinggalan,termasuk kemauan untuk berkarya dalam tulisan ilmiah. Apalagi saat ini, ujar Lailyi, kompetensi sangat dibutuhkan untuk berkarya di tengah masyarakat. “Saya berharap wawasan dan pengetahuan yang disampaikan pembicara bisa memotivasi mahasiswa untuk terus berkarya,” ujarnya. (m49)

WASPADA Rabu 4 April 2012

Pentas Demokrasi Aceh

A7

PA, PPP Agara Bantah Dukung Hasanuddin B

Waspada/Maimun Asnawi

CALON wali kota dan wakil wali kota Lhokseumawe Munir Usman-Suryadi dikerubungi usai berkampanye di Jalan Gudang kawasan KP3 Lhokseumawe, Minggu (1/4).

Munir Usman-Suryadi Dikerubungi Massa LHOKSEUMAWE (Waspada): Pasangan calon wali kota Lhokseumawe Munir Usman-Suryadi dikerubungi massa usai berkampanye di Jalan Gudang kawasan KP3. Para pendukung rata-rata ingin berjabat tangan dengan Munir Usman, mantan orang nomor satu di kota petro dolar itu, Minggu (1/4) sore. Saat diwawancara, Munir mengatakan ingin memanfaatkan masa kampanye dengan sebaik-baiknya dan menggunakan caracara sopan dan penuh etika. “Kami menginginkan Pemilukada yang bermartabat, dengan kemartabatan ini akan menjadikan Kota Lhokseumawe yang islami,” kata Munir yang diamini Suryadi. Dalam kampanye dihadapan massa pendukung Munir menyebutkan, kalau pihaknya tidak menebar janji, tapi ingin memperlihatkan bukti, kalau kepemimpinan mereka dapat membawa berkah. Beberapa poin yang disampaikan yaitu meminta dukungan sepenuhnya kepada warga Kota Lhokseumawe sehingga dia terpilih ke dua kalinya sebagai walikota. Jika terpilih maka Munir berjanji akan melanjutkan beberapa program yang belum dapat diselesaikan sepenuhnya pada masa kepemimpinannya lima tahun lalu. (b18)

Ribuan Massa Hadiri Kampanye Nazar-Nova BANDA ACEH (Waspada): Ribuan massa dari berbagai pelosok Kota Banda Aceh dan Kabupaten Aceh Besar menghadiri kampanye calon Gubernur Aceh Muhammad Nazar dan calon Wakil Gubernur Nova Iriansyah di lokasi parkir Stadion Harapan Bangsa, Lhong Raya Banda Aceh, Minggu (1/4). Selain pasangan cagub dan cawagub dengan nomor urut 4, kampanye akbar itu menghadirkan Juru Kampanye dari partai politik yang mengusungnya, yakni Partai Persatuan Pembangunan (PPP) dan Partai Demokrat (PD) serta Partai SIRA. Dari Partai Demokrat tampil Juru Kampanye Jamaluddin T. Muku dan M. Yunus Ilyas. Dari PPP, Rukaiyah Ibrahim Nain dan Hakim el Muchtari. Sedangkan dari Partai SIRA, tampil salah seorang fungsionaris partai tersebut yakni Faisal Ridha. Muhammad Nazar yang mengenakan baju koko warna kecoklatan dipadukan celana panjang warna gelap dan ridhak yang melingkar di lehernya, tampil membakar semangat para pendukungnya. Dalam kampanyenya itu, Muhammad Nazar yang mantan wakil gubernur Aceh pada periode lalu, berjanji jika terpilih nanti akan melakukan berbagai terobosan di antaranya bidang agama, perekonomian, penciptaan lapangan kerja, pendidikan, kesehatan, kepemudaan dan kepedulian terhadap korban konflik. Di samping itu, Nazar juga berjanji akan memperjuangkan dana reintegrasi damai dari Pemerintah Pusat serta menjaga perdamaian Aceh dan tidak ingin mengalahkan agama, pembangunan dan hal-hal lain untuk kepentingan masyarakat Aceh. (b05)

Ribuan Massa Padati Kampanye PA RANTO SEULAMAT (Waspada): Kampanye terakhir Calon Bupati Aceh Timur Hasballah (Roky) – Tgk. Syahrul Syamaun di lapangan Alue Kumba, Kecamatan Ranto Selamat Senin (2/ 4) dipadati ribuan massa yang berdatangan dari sejumlah kecamatan dalam Kab. Aceh Timur. Sebelum kampanye dimulai, ribuan massa dan simpatisan juga dihibur oleh grup seudati Syah Lah Banguna. Sedangkan detik-detik berakhirnya kampanye massa pendukung Hasballah (Roky)–Syahrul Syamaun (Linud) juga dihibur oleh dua artis terkenal Aceh yaitu H. Umar dan Mando. Jurkam PA Iskandar Usman dalam orasi kampanye politiknya meminta massa untuk terus mendukung pasangan yang diusung PA yakni Hasballah M. Thaeb alias Rocky berpasangan dengan Syahrul Syamaun alias Linud. (b24)

Artis KDI Ramaikan Kampanye Zulkarnaini-Jamin Idham NAGAN RAYA (Waspada): Warga Kabupaten Nagan Raya tumpah ruah menghadiri kampanye H T Zulkarnaini yang mendatangkan artis dangdut Indonesia, Maya KDI dan Dede KDI Star. Namun pada acara yang diselenggarakan Minggu (1/4) sore itu hampir tidak dapat dibedakan antara massa pendukung cabup/ cawabup atau warga yang datang untuk melihat artis dangdut itu. Do Lapangan Rimba Kelapa, Desa Ujong Fatihah, Kecamatan Kuala, Kabupaten Nagan Raya itu kedua penyanyi dangut itu tampil memukau dan membuat suasana meriah. Karena kegiatan tersebut dalam rangka kampanye, tentunya tidak lepas dari orasi HT Zulkarnaini dan HM Jamin Idham yang menyebutkan akan terus melanjutkan pembangunan di Nagan Raya. (cda)

Sore Ini Prof. A. Hadi Arifin Kampanye Di Krueng Geukueh LHOKSEUMAWE (Waspada): Cabup Aceh Utara pasangan Prof A Hadi Arifin, MSi - Ridwan Lidan, SE Rabu (4/4) sore ini melakukan kampanye politik di lapangan bola kaki Krueng Geukueh, Aceh Utara. Menurut koordinator massa, 10 ribu massa Aceh Utara akan hadir. Koordinator massa Muntasir Pase, SSos kepada Waspada, Selasa (3/4) mengatakan, kampanye di hari terakhir tersebut merupakan kombinasi dari tanggal empat bulan empat, apabila ditambahkan menjadi delapan. Delapan merupakan nomor urut pasangan Prof A Hadi Arfin/Ridwan Lidan. Selain orasi politik, panitia HadiR nama jargon pasangan itu telah menyiapkan berbagai macam hiburan rakyat, semisal rapai pase plus daboh, penampilan artis lawak Aceh dari grub Apa Lahu, Damaneh dan ranup lampuan. Prof Hadi saat menghubungiWaspada menuturkan, kampanye akbar hari ini dia mengangkat tema damai dalam membangun Bumi Malikussaleh (Aceh Utara-red) lima tahun ke depan dalam bingkai perdamaian Aceh. Dalam kampanye nanti, Mutasir mengarapkan kepada relawan, simpatisan HadiR dan massa yang hadir agar tertib dalam berlalu lintas dan saling menjaga keamanan. (cmk)

KUTACANE (Waspada): Elit Partai Aceh (PA) dan Partai Persatuan Pembangunan (PPP) Aceh Tenggara membantah mendukung H. Hasanuddin B sebagai kandidat bupati periode 2012- 2017 berpasangan dengan H.Ali Basrah. Bantahan itu disampaikan Pimpinan PA Aceh Tenggara (Agara) Bagas selaku sekretaris kepada Waspada Selasa (3/4). Bagas mengatakan, hingga saat ini PA Agara belum menentukan sikap terkait masalah dukungan bakal calon Bupati Agara. “Tidak benar itu,” bantahnya. Dikatakan Bagas, PA Agara saat ini justru sedang berkonsentrasi dengan pesta demokrasi

mensukseskan pemilihan Gubernur Aceh. “Kami sama sekali belum menentukan sikap soal dukungan pencalonan Bupati Agara, soal ini akan kami bahas usai pemilihan Gubernur, kata Bagas. Sekretaris Partai Persatuan Pembangunan (PPP) Agara Muzakir juga menyatakan bantahan atas ucapan H.Hasanuddin B. Dikatakannya, belum ada dukungan seperti yang dipidatokan Bupati itu, karena hingga Selasa (3/4) siang, soal dukungan calon Bupati Agara masih dalam tahap pembahasan di Provinsi. Sebelumnya H.Hasanuddin B menyebutkan, pencalonannya sebagai bupati periode 2012

– 2017 berpasangan dengan H.Ali Basrah, didukung 15 partai termasuk PA. Hal itu disebutkan Hasanunddin B saat orasi di hadapan ratusan masyarakat yang hadir di kediaman pribadinya di desa Purwodadi. H.Hasanuddin melalui podium di halaman rumahnya, Selasa (3/4), menyampaikan berbagai isu diantaranya, menepis rumor bahwa dia tidak didukung partai Golkar. Dikatakannya, Aburizal Bakrie selaku Ketua DPP partai Golkar bersama Idrus Marham telah mensahkan pasangan H.Hasanuddin B dan H. Ali Basrah, maju menggunakan Partai Golkar. Pernyataan Bupati Agara ini

diikuti beredarnya fotocopi surat DPP partai Golkar yang bersifat rahasia dengan nomor surat R- 354/Golkar/IV/2012, tertanggal 2 April 2012 ditandatangani Aburizal Bakrie. Hasanuddin B dengan semangat menyatakan, pasangan mereka dengan sebutan SABAR itu, saat ini telah didukung 15 partai, artinya dari 25 kursi di DPRK Agara ada 20 anggota dewan bersama pasangan SABAR. Hasanuddin B juga mengimbau rombongan yang menjemputnya dari Bandara Alas Leuser Kutacane untuk bersama-sama pada 7 April ini menuju KIP Agara mengiringi pendaftaran mereka. (b25)

Zulham-Juaini Bertekad Bangun Langsa LANGSA (Waspada): Membangun Kota Langsa tak hanya cukup dengan semangat semata, namun tekad yang kokoh ditambah kegigihan yang tinggi. Namun, semua itu mustahil bisa dilakukan bila tanpa dukungan warga pada Pemilukada 9 April 2012 ini untuk pasangan HM Zulham-Juaini gadeng, SH, MM. “Karenanya kami berharap kepada segenap warga Kota Langsa kiranya berkenan memilih pasangan HM Zulham sebagai calon walikota dan Juaini Gadeng selaku wakil walikota untuk periode 2012-2017, ini,” pinta pasangan Zulham-Juaini yang memiliki nomor urut 6 tersebut. Dalam banyak kesempatan dan orasi politik pasangan Zulham-Juaini selalu menyeru kepada segenap warga Kota Langsa agar memilih calon walikota dengan menggunakan hati nurani, dan mengedepankan rasionalitas, tanpa tekanan dan intimidasi. Begitupun, bilamana ada di antara calon yang gemar menebar fitnah sebaiknya itu diabaikan saja. “Bukankah Allah Swt lewat Rasulullah Muhammad SAW selalu berpesan agar menghindari fitnah karena itu perbuatan keji dan mungkar, begitupun bukankah fitnah itu lebih kejam dari pembunuhan,” ucap Zulham dalam nada tanya. Pada bagian lain, Zulham mengatakan, kehadirannya dalam pencalonan walikota pada Pemilukada 2012 ini lebih

Waspada/Ist

CALON Wali Kota Langsa HM Zulham, SE (kiri) bersama H. Juaini Gadeng mengacungkan tangan sebagai tanda siap dipilih pada Pemilukada 9 April ini. disebabkan rasa tanggung jawab terhadap kota kelahirannya yang dari masa ke masa belum adanya perubahan secara signifikan. Sebuah kota, menurutnya, harus dibangun dengan skala prioritas tertentu, dimana pundi Pendapatan Asli Daerah (PAD) dapat digali dengan menciptakan dua sektor mendasar. “Yakni, sektor jasa dan industri. Saya kira semua kota harus dilakukan itu, karena berharap pada pertanian dan perkebunan sesuatu yang mustahil, ini disebabkan ketersediaan lahan yang amat sangat terbatas,” pungkas Zulham. Kendati demikian, pasa-

ngan Zulham-Juaini Gadeng juga berjanji akan membenah pelabuhan laut Kuala Langsa. Pelabuhan yang letaknya sangat strategis ini dapat dibangun dengan adanya ‘restu’ Pusat. “Untuk itu, kami akan berusaha semaksimal mungkin melobi Pusat dan pihak terkait agar mereka berkenan melepaskan pengelolaannya secara otonom kepada Pemko Langsa, kalau tidak selamanya Langsa beserta warganya hanya menjadi sebagai pihak penonton belaka, dan pemanfaatannya selamanya tak terkelola secara baik dan benar,” ungkap Zulham, sang pengusaha itu.

Zulham juga mengaku berkenan menghadirkan investor handal yang memiliki modal serta investasi yang memadai. “Investasi ini jauh lebuh penting, karena tak mungkin selamanya Langsa bergantung dengan dana alokasi umum atau bagi hasil. Apanya yang bisa bagi hasil, sementara Langsa sama sekali tak memiliki minyak dan gas,” tukas Zulham lagi. Untuk itu, pasangan Zulham-Juaini nantinya akan terus berupaya maksimal. “Karenanya kami selalu memohon dukungan dan doa restu semua warga Kota Langsa agar dapat terpilih pada hari pencoblosannya 9 April 2012 ini,” tambah Juaini Gadeng, sang pamong dan birokrat murni yang setahun terakhir ini pensiun. Dan, itu pula menjadi alasan Zulham mengapa dirinya memilih berpasangan dengan Juaini Gadeng. “Karena saya melihat Juaini Gadeng sebagai birokrat dan pamong sehingga dia memiliki kemampuan dan kecakapan dalam mengelola pemerintahan nantinya, ini menjadi pas dan komplit antara entrepreneurship—usahawan dengan birokrat. Insya Allah akan lebih mudah membangun Kota Langsa, sehingga praktis pula dapat tercipta kehidupan yang baldatun taibatun warrabbur ghafur, yakni bahagia para pemimpin dan sejahtera segenap warga,” demikian Zulham. (tim)

PA Bener Meriah Tak Pernah Dukung Tagore TAKENGEN( Waspada): Pengurus Partai Aceh (PA), Bener Meriah menyesalkan statemen anggota DPRD Sumatera Utara yang menyebutkan, PA mendukung incumbent dan merupakan orang yang tepat memimpin Bener. “Jangankan mendukung Tagore, duduk bersama membahas persoalan Bener tidak pernah kami lakukan, apalagi disebut anggota DPRD Sumut dari PDI Perjuangan,

Tagore memiliki kecerdasan intelektual,” sebut Sardi Nari, Ketua PA, Bener Meriah, dalam keterangannya kepada Waspada via seluler, Rabu (3/4). Sardi menyesalkan statement Ir. Taufan Agung Ginting, MSP, (Waspada Rabu 28/3) yang menyebutkan Tagore adalah sosok yang paling intelek dalam membangun Bener, sehingga PA juga menjadi pendukung Tagore. “Kami tegaskan, tidak

pernah mendukung Tagore. Kami punya calon bupati sendiri yang diusung PA, saudara Marzuki (Win Rime Raya). Taufan mengatakan, kalau tidak mengerti persoalan Aceh, datang dulu ke sini, pelajari dengan baik, baru berikan statemen,” sebutnya. “Kalau Tagore takut dengan PA dalam persoalan massa, mengapa harus menyebutkankan PA sudah mendukung Tagore. Tidak mungkin PA

mendukung Tagore, yang sejak dulu sampai sekarang berbeda haluan dengan PA,” sebut Sardi. Dengan memanfaatkan anggota DPRD Sumut dari Fraksi PDIP, Tagore sudah membohongi publik. Memutarbalikkan fakta. Yang jelas PA tidak pernah mendukung Tagore. PA punya kader sendiri yang maju untuk kandidat bupati dan insya Allah memang,” jelasnya. (b32)

Masyarakat Tamiang Antusias Ikut Pelatihan Daur Ulang Sampah KUALASIMPANG ( Waspada): Rumah Kreasi Daur Ulang pimpinan Hj Lina Tengku Tam menggelar pelatihan gratis pemberdayaan sampah menjadi aneka produk multi manfaat diantaranya pupuk kompos dan aneka kerajinan souvenir. Pelatihan tersebut dilaksanakan di Desa Kampung Selamat, Kec Tenggulun, Kab Aceh Tamiang, Minggu (1/4). Maksud dan tujuan diadakannya acara ini guna memberikan pendidikan karakter kepada masyarakat setempat cara-cara pemanfaatan sampah, sekaligus sebagai upaya perbaikan lingkungan, senut Lina Tengku Tam. Lina menambahkan, selama ini banyak yang tak mengetahui sampah ternyata sangat berguna apabila diberdayakan, banyak hal bisa dilakukan dari aneka jenis sampah. Dalam acara itu tampil 3 pembicara yang cukup berpengalaman diantaranya “Ratu” sampah Dewi Budiati Teruna Jasa Said, Guru Besar Pertanian USU Prof Dr Ir Abdul Rauf, MP dan Ketua Kelompok Tani Kecamatan Tamiang Hulu/ Ahli Pembuat kompos Karjo. Dalam paparannya Dewi Budiati mengatakan sebelum mengolah sampah seharusnya dilakukan pemilahan, karena dengan dipilah sampah mudah dikelola. Pemilahan sampah menjadi kunci sukses dalam penanggulangannya sekaligus mudah untuk dimanfaatkan ulang. Dewi juga menganjurkan agar setiap dapur memiliki bank sampah, yaitu sejenis wadah

untuk mengumpulkan sampah kering yang masih bisa dijual ke botot/pemulung, sedangkan yang tidak punya nilai jual dapat dijadikan bahan kerajinan/souvenir/prakarya sekolah yang tentunya dapat dijadikan sarana menambah pemasukan maupun sebagai sarana membuka industri kecil rumahan, seperti apa yang dilakukan Hj Lina Tengku Tam dengan Rumah Kreasinya. Sementara itu Prof Dr Ir Abdul Rauf memaparkan tentang pemberdayaan sampah basah/ organik diantaranya sampah sisa makanan, dedaunan, sayur

mayur, ataupun sampah yang mudah membusuk lainnya untuk menopang pertanian, apalagi Tamiang masih banyak dikelilingi perkebunan, yang tentunya akan sangat bermanfaat apabila setiap rumah tangga mau menggunakan sampah segar sebagai pupuk, agar tak terlalu sulit. Ada teknologi yang mudah dilakukan yaitu dengan menanam sampah langsung di sekeliling pohon, karena sampah basah umumnya masih punya nilai nutrisi yang dapat meningkatkan kesuburan tanah. Sampah basah juga dapat diolah

jadi pupuk kompos, pupuk cair organik, pakan ternak (itik, ayam dan ikan), sumber energi berbasis sampah (briket) dan pestisida nabati, ini yang sangat sesuai dengan potensi masyarakat Tamiang yang mayoritas bergerak di bidang pertanian, kata Rauf. Acara ini turut dihadiri ratusan ibu-ibu rumah tangga/ pemuda pemudi serta tokoh masyarakat setempat diantaranya HTengkuYusni anggota DPR Fraksi Golkar yang juga salah seorang calon bupati Aceh Tamiang serta anggota DPR fraksi PPP Ismail dan beberapa pejabat Kab Tamiang. (m08/rel)

Waspada/Rusli Ismail

H. SALMAN Ishak yang akrab dengan semua warga saat berdialog dengan wanita lanjut usia di desa pedalaman Ulee Gle, Kec.Bandar Dua, PiJay.

Salman Kampanye Keliling Kampung SIGLI (Waspada): Pasangan kandidat calon bupati dan wakil bupati Pidie Drs.H.Salman Ishak, M. Si dan Drs. Saifuddin Harun giat melakukan kampanye keliling kampung untuk berdialog langsung dengan warga. Menurut mantan Pj Bupati Pidie Jaya itu, kampanye keliling kampong dan dialogis menjadi target utama dalam mengisi kampanye di Kabupaten Pidie. Namun, pasangan ini juga melakukan kampanye dialogis dengan mendatangi desa-desa yang ada di 23 kecamatan. “Kita akan melakukan pertemuan dan saling tukar masukan kepada masyarakat,” terang H.Salman yang selama menjabat P. Bupati telah berhasil membangun Pidie Jaya dan menduduki peringkat pertama selama dua tahun berturut-turut dari 57 kabupaten/kota pemekaran di Indonesia. Kepada Waspada, Selasa (3/4), H.Salman menyebutkan, pertemuan dengan masyarakat sangat penting dilakukan karena sesuai dengan visi dan misi sebagai calon bupati dan wakil bupati Pidie. Apalagi visi yang diemban ke depan mewujudkan Pidie sejajar dengan daerah kabupaten/kota lain di Aceh bahkan di Indonesia yakni dengan mengutamakan kesejahteraan masyarakat. Pasangan yang maju melalui jalur independen ini secara khusus menyambangi majelis Taklim Gampong Pulo Masjid Dua dan Dayah Nurul Falah Gampong Blang Jeurat Tangse. Dalam kunjungan itu, Salman-Saifuddin menyerahkan dua paket perlengkapan memasak serta alat prasmanan. Sedangkan untuk Dayah Nurul Falah, mereka memberikan bantuan pembinaan dayah. (b09)

Kandidat Sabang Janji Perbaiki Ekonomi Rakyat SABANG (WASPADA): Kandidat wali kota dan wakil wali kota Sabang nomor urut 2 Ir.H.Hirwan Jack dan Drs. Saluddin Alqassani berjanji akan memperbaiki dan membangun perekonomian rakyat. Mereka juga berjanji akan memperbaiki dan meningkatkan kualitas pendidikan dan syariat Islam khususnya dibidang pendidikan agama dan baca Alquran. Selama ini setiap mengikuti MTQ tingkat Provinsi Aceh harus membayar qari dan qariah dari daerah lain, karena di Sabang tidak ada yang mampu sebagai qari dan qariah terbaik. Di bidang olah raga, banyak pemain bayaran didatangkan dari luar Sabang karena tidak memiliki pemain yang handal. Jika mereka terpilih akan disupport secara khusus untuk meningkatkan kualitas qari dan qariah dan mencetak olahragawan berprestasi. Janji-janji tersebut disampaikan dalam kampanye yang berlangsung di lapangan Play Ground Sabang yang dihadiri ribuan pendukung dari seluruh gampong Senin (2/3) sore. (b31)

Perpanjangan Waktu Pengumuman Polling Sesuai dengan pengumuman polling pembaca Waspada terkait Pilkada Aceh, kami sampaikan, hasil akhir polling akan diumumkan hari Jumat (7/4) sebelum pengumuman pemenang pada tanggal 15 April 2012. Kupon polling sendiri sudah tidak kami terbitkan sejak hari Selasa (4/4). Demikian kami umumkan kepada para pembaca untuk dimaklumi.(red)

Suara Sementara Pilkada Langsa

Suara Sementara Pilkada Lhokseumawe

Suara Sementara Pilkada Aceh Utara

Suara Sementara Pilkada Aceh Timur

Suara Sementara Banda Aceh

Suara Sementara Gayo Lues

Waspada/Ist

HJ. Lina Tengku Tam (tengah), HTYusni (kanan), Ismail (kiri) diabadikan bersama warga masyarakat Tamiang usai pelatihan Daur Ulang Sampah yang digelar Rumah Kreasi, Minggu (1/3).

Ragam

A8

WASPADA Rabu 4 April 2012

Saksikan, Jumat 6 April 2012 Di Gedung MITSU-PSP Kampus Hijau STBA-PIA

Malam Kesenian Budaya China-Pesona Xinjiang (Pertunjukan Budaya China Muslim) MUI Medan

Konjen China

LEMBAGA Kerjasama Ekonomi, Sosial dan Budaya Indonesia-China (LIC) Sumatera Utara bekerjasama dengan Majelis Ulama Indonesia (MUI) Kota Medan, Forum Pembauran Kebangsaan (FPK) Sumut,Masyarakat Indonesia Tionghoa Sumatera Utara Peduli Sosial dan Pendidikan (MITSU-PSP) dan Konsulat Jenderal China untuk Indonesia di Medan, menyelenggarakan Malam Kesenian Budaya China–Pesona Xinjiang (Pertunjukan Kesenian Budaya China Muslim Xinjiang) pada Jumat malam (6 /4) mulai pukul 19:00, di Hall Persahabatan Sin Chew Daily Gedung MITSU-PSP Kampus Hijau STBA-PIA, Medan. “Pagelaran tersebut atas arahan Ketua LIC Pusat, Prof. Dr H Sukamdani Sahid Gitosardjono,” ujar Ketua Panitia Juswan Tjoe pada Rapat Internal Pembentukan Panitia Malam Kesenian Budaya China Pesona Xinjiang di Ruang Rapat Gedung MITSU-PSP Kampus Hijau STBA-PIA, kemarin. Selain Juswan Tjoe, turut hadir unsur lain diantaranya Prof DR HM Hatta yang juga Ketua Umum MUI Kota Medan, H. Hasan Matsum M.Ag yang juga Sekretaris Umum MUI Kota Medan, dan Drs H Bahari Damanik yang juga Ketua FPK Sumut, Drs Wan Nabari Ginting, MSi,

Fadjar Suhendra Ketua LIC Sumut yang juga Ketua MITSU-PSP, Ardjan Leo,Benny Mulyadi serta sejumlah unsur dan jajaran Pengurus MUI Kota Medan, FPK Sumut, LIC Sumut dan MITSU-PSP lainnya. Ketua Umum Majelis Ulama Indonesia (MUI) Kota Medan Prof DR H Mohd Hatta dalam kesempatan itu menyambut baik digelarnya Pertunjukan Kesenian Budaya China Muslim Xinjiang, “saya bersama tokoh lintas agama pernah berkunjungan ke Daratan China termasuk Xinjiang yang mayoritas penduduknya beragama Islam”, ujarnya. Untuk itu, kata

Mohammad Hatta, MUI sejalan dengan kesamaan pandangan antar lintas agama sesuai dengan visi dan misinya MUI “Akidah boleh berbeda, persatuan dan kesatuan bangsa harus tetap diperlihara dan dipertahankan untuk kepentingan bersama, tegas Hatta. Pertunjukan malam kesenian Budaya China Muslim Xinjiang yang kaya dengan warna warni seni budaya China bernuasakan Islam ini sepenuhnya kita dukung dalam pertukaran budaya muslim kedua Negara dengan tujuan untuk meningkatkan hubungan budaya islam kedua negara” akhir Hatta.

FPK Sumut

Sementara itu, Ketua FPK Sumut Drs H Bahari Damanik menyatakan FPK merupakan suatu wadah yang diresmikan Gubernur Sumatera Utara yang pengurusnya dari berbagai etnis suku dan sesuai dengan rapat pleno FPK Sumut mendukung sepenuhnya Pertunjukan Kesenian Budaya China Muslim Xinjiang ini Lebih lanjut Damanik berharap dengan diadakannya pertunjukan ini seluruh masyarakat Sumatera Utara khususnya Medan dari berbagai etnis suku dapat mengetahui ternyata di China ada Budaya China Muslim, karena selama ini sebagian mereka yang hanya mengetahui budaya China hanya Cap Gomeh, Imlek, maupun Pertunjukan Barongsai, ujar Damanik. Dengan diadakannya pertunjukan Malam Kesenian Budaya China Pesona Xinjiang, akan membawa rasa persahabatan yang kokoh melalui pertukaran budaya antar kedua Negara, dan membawa dampak positif dalam meningkatkan kebangsaan dalam pembauran diantar etnis suku yang ada di Sumatera Utara, harap Damanik. (rel/rzl )

LIC Sumut

MITSU-PSP

Waspada/Ist.

RAPAT Panitia Persiapan Pagelaran Malam Kesenian Budaya China - Pesona Xinjiang (Pertunjukan Kesenian Budaya China Muslim Xinjiang) yang akan digelar di Gedung MITSU-PSP Kampus Hijau pada Jumat 6 April 2012. Kiri-Kanan: Ketua FPK Drs. H. Bahari Damanik, Ketua LIC Sumut / MITSU-PSP Fadjar Suhendra, Ketua MUI Kota Medan Prof. Dr. H. Moh. Hatta, dan Ketua Panitia Pelaksana Juswan Tjoe.

China Xinjiang Mukam Arts Ensemble

Waspada/Ist

KECERAHAN mengintegrasikan lagu, musik dan tarian dalam satu yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

CHINA Xinjiang Mukam Arts Ensemble didirikan pada tahun 1989, langsung di bawah naungan Departemen Kebudayaan Otonomi Xinjiang Uygur. Komunitas ini merupakan satu-satunya sanggar seni yang bersifat profesional dalam mewarisi, mengumpulkan, menyusun, dan meneliti kesenian Mukam Uyguryang akan ditampilkan di atas pentas. Komunitas ini memiliki 152 pemain dan kru yang terbagi dalam Paduan Sua-ra, Band, Tim Tari, kantor pengembangan dan penelitian, pendesain panggung, pengatur pertunjukan dan kantor administrasi. Komunitas ini juga memiliki Penyanyi, Pemusik, Penari, Pencipta dan Peneliti yang terkenal. Sejak komunitas ini berdiri telah banyak seni Mukam Uygur yang dipentaskan seperti Lagu Rakyat, Tarian Tradisional, Karya Orkestra Nasional, serta berbagai macam karya seni Mukam

Uygur telah diterbitkan dalam bentuk kaset, CD, VCD, DVD termasuk (Qebiyat Mukam) dengan tema pesta besar (Musim Semi Mukam) telah dipentaskan dengan sempurna sehingga menjadi program pertunjukan permanen dari komunitas ini. Komunitas ini juga telah melakuka perjalanan ke utara dan selatan Tianshan dan dilakukan berulang kali ke berbagai pelosok Provinsi dan kota/ kabupaten di China Daratan, bahkan telah melakukan pertunjukan seni dalam rangka pertukaran budaya di luar negeri seperti: Inggris, Pakistan, Jerman, Swiss, Belanda, Belgia, Prancis, Iran, Sudan, Mauritania, Maroko, Tunisia, Jepang, Korea, Uni Emirat Arab, Qatar, Bahrain, Turki, Kazakhstan, Uzbekistan, Taiwan, Hong Kong, Makau, Indonesia, serta negara-negara lain yang selalu mendapatkan sambutan hangat. (rel/rzl)

Waspada/Ist

Tarian Emas Dolan persembahan dari Group Dancer yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

Waspada/Ist

Tarian Tradisional Rakyat Uygur, Populer di daerah Turpan Xianjing. Tarian ini penuh semangat dan humor serta sangat disambut oleh orang dari kelompok etnis yang berbeda.

Waspada/Ist

Kelompok lagu dan tarian, mengekspresikan kebahagian yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

Waspada/Ist

Waspada/Ist

Qebiyat Mukam merupakan set kedua dari lagu-lagu Mukam Dua Belas yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

Qebiyat Mukam merupakan set kedua dari lagu-lagu Mukam Dua Belas yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.Tarian Mangkok di atas Kepala, salah satu kesenian yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

Waspada/Ist

Ini adalah bagian yang menceritakan set ketiga dari selingan Mukam Dua Belas yang akan dipersembahkan China Xianjing Mukam Arts Ensemble.

Luar Negeri

WASPADA Rabu 4 April 2012

A9

Penembakan Di Kampus Universitas AS , 7 Tewas OAKLAND (AP/Antara/Reuters): Penembakan lagi di sekolah Amerika Serikat. Kali ini, seorang pria melepaskan tembakan ke satu perguruan tinggi keagamaan swasta di Oakland, California, sehingga menewaskan tujuh orang dan melukai tiga lainnya sebelum tersangka —yang menurut laporan adalah mantan mahasiswa di sana — ditangkap, kata pihak berwenang. Para pejabat kota Oakland mengatakan mereka menduga pria bersenjata itu telah bertindak sendirian dalam penembakan pagi hari tersebut di Oikos University. Namun pejabat tersebut tak bersedia mengungkapkan identitas tersangka atau memberi alasan bagi aksi itu. Pendiri perguruan tersebut, Pastur Jong Kim, mengatakan kepada Oakland Tribune pria itu ditangkap di satu pertokoan kecil sekitar 8 km dari lokasi Senin (2/

4) itu juga. Sebelumnya pria tersebut, yang adalah mahasiswa perawatan di sana, tapi sudah tak terdaftar lagi. Kim mengatakan diamendengarsebanyak30suara tembakan. Jurubicara kepolisian Oakland JohnnaWatson mengatakan tujuh orang tewas dan tiga orang lagi cedera. Stasiun televisi lokal menayangkan gambar mahasiswa yang ketakutan dan staf yang berlarian dari perguruan itu, yang berada di daerah indsutri

ringan di dekat Bandar Udara Internasional Oakland. Sementara itu tim polisi dan SWAT dengan dilengkapi senapan serang mengepung daerah tersebut. Beberapajamkemudian,dua mayat yang ditutupi lemparan plastik kuning masih berada di daerah berumput di luar sekolah itu, demikian laporan Reuters. Petugas dari US Bureau of Alcohol, Tobacco and Firearms juga berada di lokasi, bersama dengan puluhan polisi setempat. Angie Johnson, 52, mengatakan kepada harian San Francisco Chronicle dia sedang mengerjakan tugas di dekat perguruan itu

saat dia melihat seorang perempuan muda berlari dari dalam, sementara darah mengalir dari lengankanannya.Perempuantersebut berteriak, “Saya ditembak, saya ditembak.” Johnsonmengatakanperempuan yang cedera itu memberitahu dia bahwapenembaknyaadalahseoranglelakidiklasperawatannya. Pria tersebut menembak satu orang dari jarak dekat sebelum memberondongkan peluru ke dalam ruangan tersebut. Keturunan Korea Tersangkapenembakdikampus Oakland, California, itu diyakiniseorangwargaketurunanKo-

rea yang bernama One Goh. Dia menyerahkan diri kepada polisi yangmengejarnya ke kota yang berada di dekat Oakland. Setelah melakukan pembantaiannya, One Goh melarikan diri ke kota lain. Tersangka warga Oakland sudah menyerahkan diri ke polisi di Alameda. Dia adalah warga negara Korea,” ujar kepala polisi Oakland Howard Jordan. Hingga kini, kepolisian juga belum melaporkandenganjelastentangidentitas pria berusia 43 tahun itu, apakahdiaberasaldariKoreaUtara atau Korea Selatan. Sebelumnyakepolisianmen-

Malaysia Alokasikan Subsidi 30 Miliar Ringgit Per Tahun

duga, pelaku adalah mantan mahasiswa dari universitas tersebut, seorang warga keturunan Asia danberusiakuranglebih40tahun. Pada saat peristiwa itu terjadi, tim SWAT pun dikerahkan untuk melumpuhkan tersangka penembakan yang akhirnya melarikan diri. Penembakan ini terjadi hanya berselang satu bulan setelah seorangsiswadiOhiomelepaskan tembakan di kantin sebuah sekolah. Insiden tersebut menyebabkantigasiswatewasdandianggap sebagai peristiwa penembakan palingmematikandiSekolahMenengah Umum AS dalam waktu enam tahun terakhir.(m10)

Sarkozy Biayai Kampanye Dengan Dana Ilegal PARIS (Waspada): Menjelang putaran pertama pemilu presiden Prancis, Nicolas Sarkozy yang maju sebagai calon incumbent terpaksa harus menghadapi kabar negatif. Dia diduga mendapatkan dana kampanye dengan cara ilegal. Beberapa bulan menjelang Pemilu Presiden 2007 lalu, Sarkozy dikabarkan melakukan pertemuan rahasia dengan seorang miliuner pemilik perusahaan kosmetik L’Oreal, Andre Bettencourt. Pertemuan itu pun disinyalir berkaitan erat dengan masalah dana kampanye bagi kemenangan Sarkozy. “Sebuah catatan harian yang dibuat oleh janda Andre Bettencourt, Liliane Bettencourt, menyebutkan bahwa Sarkozy mengunjungi rumah pasangan itu di Neuilly-sur-Seine, sebuah kawasan elite yang terletak di pinggiran Kota Paris pada 24 Februari 2007,” sebut Daily Mail dalam laporannya Selasa, (3/4/2012). Selain itu bukti lain berupa kesaksian seorang mantan supir Bettencourt juga menyebutkan, Sarkozy merencanakan pertemuan dengan mantan majikannya itu untuk meminta sejumlah uang. Tidak hanya itu bahkan salah seorang sahabat keluarga Bettencourt, Francois-Marie Banier, mengutip pengakuan Andre Bettencourt yang membenarkan kabar ini. “Sarkozy datang dan meminta uang lagi. Kemudian saya mengiyakan permintaannya,” tulis Francois-Marie Banier dalam catatan hariannya.Pernyataan Banier ini dinilai mengarah pada barang bukti berupa dokumen yang menunjukkan Sarkozy menerima diperkirakan sekitar Rp9,7 miliar dari Bettencourt. Setengah dari uang itu dikabarkan diserahkan kepada Sarkozy dalam bentuk tunai setelah ditarik dari sebuah rekening bank rahasia di Swiss. MunculnyakabarinisegeramenimbulkanspekulasibahwaSarkozy menikmati dana kampanye yang berasal dari Bettencourt dengan imbalan pemotongan pajak terhadap perusahaan kosmetik raksasa dunia itu. Pihak Istana Elysee yang merupakan kediaman resmi kepresidenan langsung membantah kabar ini dengan mengatakan, kabar yang berhembus itu tidak benar dan tidak pernah terjadi. Menanggapi skandal yang dituding melibatkan rival politiknya itu, calon kandidat presiden Prancis Eva Joly yang juga mantan hakim anti-teroris mengatakan, akibat skandal ini Partai Uni Pergerakan Populer (UMP) pimpinan Sarkozy berada dalam kondisi terpuruk. Sebelumnya Sarkozy juga sempat dikabarkan menerima dana kampanye sebesar GBP42 juta atau sekira Rp614 miliar yang berasal dari mantan penguasa Libya Muammar Khaddafi. Namun pihak Sarkozy tidak menjelaskan lebih lanjut terkait kabar itu.

Polisi Gadungan Culik Walikota Filipina MANILA (Waspada): Pemerintah Filipina melaporkan, seorang bersenjata yang mengenakan seragam polisi menculik Walikota Salug, Jefferey Lim. Perisitiwa itu terjadi ketika Lim sedang memeriksa terminal bus di wilayah selatan Filipina. Lim yang saat itu sedang berada di terminal bus, ditarik oleh sekelompok orang ke dalam mobil van Senin malam. Setelah itu, tersangkayangmelakukanpenculikanterhadapLimhilang.Demikian seperti diberitakan The Associated Press, Selasa (3/4). Pejabat kepolisian Filipina Napoleon Estilles mengatakan, saat ini polisi masih menyelidiki motif dan juga identitas dari tersangka yang mengenakan seragam polisi. Polisi juga menggelar operasi pengepungan untuk menangkap tersangka. Penculikan merupakan hal yang umum terjadi di wilayah selatan Filipina. Para penculik juga kerap meminta tebusan kepada keluarga korban. Sama seperti Thailand, wilayah selatan di Filipina merupakan wilayah yang rawan akan keamanan dan dipenuhi oleh gerilyawan separatis. Kelompok separatis yang sangat terkenal di Filipina adalah Abu Sayyaf. Abu Sayyaf bahkan sering disebut Hybrid karena militan itu tidak hanya dianggap sebagai kelompok teroris. Abu Sayyaf kerap dikategorikan dalam kelompok kriminal yang terorganisir karena kerap melakukan aksi penculikan.(ok)

Pejabat Prancis: Kelompok Islamis Berencana Culik Hakim PARIS (AP): Seorang pejabat Prancis mengatakan kelompok radikal Islam yang ditahan minggu lalu berencana untuk menculik seorang hakim Yahudi. Tuduhan awal telah diajukan terhadap para anggota kelompok terlarang, Forsane Alizza, Selasa (3/4) karena berasosiasi dengan satu kelompok teroris. Itu artinya satu penyelidikan hakim punya alasan kuat untuk diyakini satu kejahatan telah dilakukan namun memungkinkan dilakukannya penyelidikan lebih mendalam. Pejabat yang dekat dengan penyelidikan itu memohon agar jatidirinya tidak disebutkan. Penggerebekan Jumat ituberhasilmenangkap lebih dari 12 orang setelah dilakukan sweeping di seluruh Prancis. Kepala badan kontraspionasePrancismengatakan,kelompoktersebuttidakpunyahubungan dengan warga Prancis berusia 23 tahun yang menurut polisi bertanggungjawab atas pembunuhan di baratdaya Prancis bulan lalu.(m10)

Mesin Rusak, Pesawat Jatuh Menimpa Mal FLORIDA (Waspada): Pesawat kecil mengalami kecelakaan di pusat perbelanjaan Florida, Amerika Serikat (AS). Kecelakaan pesawat itu menimbulkan kebakaran dan melukai lima orang warga. Beberapa warga di Deland, Florida langsung melaporkan insiden ini ke pihak yang berwajib pada Senin kemarin, pukul 19.20 malam waktusetempat.Pesawatkecilitujatuhkekomplekpusatperbelanjaan karena mesinnya yang rusak. Pilot dan satu orang penumpang pesawat itu terluka dan dilarikan ke Rumah Sakit Orlando. “Pesawat kecil berwarna kuning berputar dan jatuh ke atap, ledakan pun muncul. Seluruh bagian dari pesawat itu masuk ke dalam pusat perbelanjaan,” seperti dikutip Daily Mail, Selasa (3/ 4). Saksimata mengatakan, mesin pesawat itu hancur karena menghantam atap pusat perbelanjaan. Namun, Pemilik restoran siap saji di pusat perbelanjaan itu, Marleny Arevalo mengaku, dirinya tidak mendengar dan melihat adanya kecelakaan di dekat tempatnya bekerja. (ok)

KUALA LUMPUR (Antara): Pemerintah Malaysia mengalokasikan subsidi sebanyak 30 miliar Ringgit Malaysia (1 RM setara Rp2.800) tiap tahun untuk membantu meringankan beban hidup warganya. Pada 2012, Malaysia akan menyalurkan subsidi yang diberikan langsung sebanyak hampir tiga miliar ringgit , kata PM Malaysia Najib Tun Razak.Pemerintah berkomitmen untuk melanjutkan kebijakan subsidi atas beberapa produk pangan seperti beras, minyak goreng, dan gandum serta BBM termasuk bensin, solar dan gas, kata Najib seperti dikutip Bernama, Selasa (3/4). Subsidi juga diberikan untuk listrik bagi satu juta rumah tangga dengan pemakaian listrik tidak lebih dari 20 Ringgit per bulan. Total jumlah subsidi untuk semua sektor tersebut mencapai 30 miliar Ringgit per tahun, katanya saat menyampaikan Laporan Tahunan Program Transformasi Ekonomi (ETP) dan Rencana Transformasi Pemerintah (GTP) 2012. Untuk jangka panjang, pemerintah memperkenalkan Skema Perumahan 1Malaysia (PR1MA) untuk membangun rumah murah di kawasan urban untuk kalangan menengah, karena perumahan merupakansalahsatukomponenterbesardalamstrukturbiayahidup. Sementara bagi masyarakat berpendapatan rendah, skema seperti Proyek Perumahan Rakyat yang dilakukan Kementerian Perumahan dan Pemerintah Lokal akan ditingkatkan, kata Najib.Untuk program perumahan di kawasan terpencil, lanjut dia, Syarikat Perumahan Negara menjamin bahwa jumlah rumah yang dibangun untuk masyarakat terpencil mencukupi. PM Razak juga mengatakan, pihaknya tidak melupakan nasib nelayandantelahmengalokasikan300jutaRinggituntukmembangun dan memperbaiki rumah mereka melalui Dana Khusus Perumahan Nelayan. Dalam jangka menengah, Pemerintah Malaysia juga telah menjalankanbeberapaprograminisiatifsepertiKedaiRakyat1Malaysia, Klinik 1Malaysia, Menu Rakyat 1Malaysia, dan penundaan selama lima tahun kenaikan tarif tol Expressway Utara-Selatan, Tol Pantai Timur, serta pencabutan sistem jalan tol untuk beberapa jalur seperti Cheras-Kajang dan Jalan Connaugt. Malaysia baru-baru ini menaikkan gaji antara 7-13 persen bagi 1,4 juta PNS yang pada akhirnya akan memberi manfaat bagi empat juta warga Malaysia. Salah satu langkah jangka pendek yang telah dilaksanakan tahun ini adalah Bantuan Rakyat 1Malaysia (BR1M) sebanyak 500 Ringgit bagi setiap warga berpenghasilan kurang dari 3.000 Ringgit per bulan. Bantuan ini diberikan kepada sekitar empat juta warga Malaysia. DisampingBR1M,Pemerintahjugamelanjutkankebijakanbantuan 100 Ringgit bagi siswa sekolah dasar dan sekolah menengah. Bantuan ini diberikan kepada 5,3 juta siswa seluruh Malaysia. Sementara 1,3 juta siswa sekolah lanjutan diberi bantuan uang buku sebanyak 200 Ringgit/orang.

China Tangkap 22 Orang Setelah Protes Etnis Mongolia The Associated Press

KEPOLISIAN Oakland menutup mayat-mayat yang dibaringkan di lapangan dekat Oikos University di Oakland, California, AS, Senin (2/4). Seorang pria bersenjata melepaskan tembakan di Oikos University di California itu, yang menewaskan sekurang-kurangnya tujuh orang, kata sumber penegak hukum yang dekat dengan penyelidikan itu.

Wanted!

AS Tawarkan Hadiah Bagi Kepala Pemimpin Militan Pakistan Rp83 M

ISLAMABAD (AP): Amerika SerikatmenawarkanhadiahRp83 miliar (AS$10 juta) untuk kepala pendiri kelompok militan yang dipersalahkan melakukan serangan kota Mumbai di India tahun 2008 yang menewaskan 166 orang. Langkah itu dapat mempersulit hubungan AS-Pakistan yang saat ini menegang. HafizMohammadSaeed(foto) mendirikanLashkar-e-Taibapada 1980an,didugadengandukungan Pakistan menekan musuh bebuyutannya India mengenai pertikaian wilayah Kashmir. Pakistan melarang kelompok tersebut pada 2002 di bawah tekanan AS, namun kelompok tersebut terus beroperasidengankebebasanyang relatif. AS mencap Lashkar-eTaiba satu organisasi teroris asing pada Desember 2001. Namun Saeed beroperasi secara terbuka di Pakistan, memberikan ceramah umum dan tampil dalam berbagai acara talk show televisi. Pemerintah AS juga menawarkan lebih dari AS$2 juta bagi deputi pemimpin Lashkar-

e-Taiba, Hafiz Abdul Rahman Makki, yang juga ipar Saeed. Hadiah bagi Saeed itu merupakansalahsatutawarantertinggi oleh AS dan jumlahnya setara denganhadiahbagikepalaTaliban, Mullah Omar. Hanya Ayman alZawahri,yangmenggantikanOsama bin Laden sebagai pimpinan al Qaida, yang bernilai lebih tinggi dari keduanya, AS$25 juta. Tawaran hadiah tersebut dimuat di website Departemen Luar Negeri AS di bagian Hadiah dan Keadilan Senin malam, kata Kedutaanbesar AS di Islamabad Selasa (3/4). Website Kemlu AS itu menyebut Saeed sebagai mantan seorang dosen bahasa Arab dan ‘dalang’ yang mengepalai satu organisasi‘yangberdedikasiuntuk menegakkan kekuasaan Islam di seluruh bagian Pakistan dan India.’Kemlujugamenjelaskanbahwa enam dari korban tewas dalam serangan Mumbai itu berkewarganegaraan AS. Menteri Urusan Luar Negeri India S.M. Krishna menyambut

baikpengumumanASitudengan mengatakan itu akan menjadi isyarat bagi Lashkar-e-Taiba dan its patrons that the international community remains united in fighting terrorism. “Keputusan itu mencerminkankomitmenIndiadanASuntuk menyeret para pelaku serangan teroris Mumbai ke depan pengadilandanmelanjutkanusaha-usaha memerangi terorisme,” katanya. Lagkah tersebut muncul padasaathubunganASdanPakistan beradadalamsuasanategangdan rumit. Parlemen Pakistan saat ini sedangmemperdebatkansaturevisi UU bagi hubungan kedua negara setelah terjadinya serangan udara ASatasduaposdidekatperbatasan Afghanistanyangmenewaskan24 tentara Pakistan. Pakistan membalas dengan mendepak AS keluar dari satu pangkalan yang digunakan oleh pesawat tak berawak AS dan menutup lintas batasnya bagi iringiringan truk pembawa pasokan bagi pasukan NATO di Afghanis-

tan. AS berharap debat parlemen itu akan menghasilkan pembukaan kembali lintasan pasokannyadiPakistanitu.Penutupanlintasan tersebut membuat sakit kepala AS karena pihaknya harus mengeluarkan dana lebih besar untuk menggunakan jalan alternatif melalui AsiaTengah. AS juga membutuhkanjalantersebutuntuk menarikperalatannyajikapasukannya keluar dari Afghanistan menjelang akhir tahun 2014. (m10)

Negara Asia Tenggara Dan China Bawa Masalah Ke KTT PHNOM PENH (AP): Berbagai perbedaan baru dapat mengganjal usaha negara-negara Asia Tenggara dan China untuk menyepakati pakta yang bertujuan mencegah terjadinya konflik yang dapat meletus menjadi konflik, demikian menurut para diplomat Selasa (3/4) pada awal satu pertemuan regional. Pertikaian di Laut China Selatandanrencanapeluncuranroket Korea Utara bulan ini merupakan kecemasan utama yang diperkirakanakanmendominasiKTTdua hari para pemimpin ASEAN di Phnom Penh, Kamboja. Sementaraitu,Myanmartelah mengumpulkanbanyakpujiandari tetangganyakarenatelahmenunjukkankesungguhannyamelakukan pembaruandemokratis.Itumerupakansatupertandabaikdarinegeri itu, yang selama beberapa tahun dikutukkarenamelakukanpelanggaran HAM besar. Presiden Myanmar Thein Sein telah memberikan penjelasan singkat kepada rekan-rekan sejawatnya mengenai pemilihan sela bersejarah Minggu, yang menunjukkan partai ikon prodemokrasi Aung Sann Suu Kyi meraih kemenangan besar. Kambojaberkeinginanuntuk memfokuskan masalah-masalah non-politik yang rawan seperti tujuan mengubah AsiaTenggara menjadi kawasan negara-negara demokrasi, negara sosialis dan monarki menjadi blok semacam

Uni Eropa yang dapat berkompetisi dengan kawasan-kawasan lainnyayangdidominasiolehraksasa yang mulai bangkit seperti China dan India. PM Kamboja memaparkan problem keuangan yang dialami dunia,termasukmeroketnyaharga minyak, yang katanya dapat memperlemah kawasan Asia TenggarajikaparaanggotaASEAN tidak berganden tangan dalam persatuan. Dia tidak menyinggung masalah kontroversial dalam masalah keamanan di antara

negara anggota ASEAN. Masalah Laut China Selatan KTT ASEAN ke-20 resmi dibuka PM Hun Sen di Peace Palace, Phom Penh, Kamboja. KTT ASEAN itu dihadiri oleh pemimpin pemerintahan di 10 negara ASEAN.Wakil Presiden Boediono hadir menggantikan Presiden Susilo Bambang Yudhoyono. Dalam KTT ini akan dibahas beberapaagendayaituimplementasidanperkembanganpencapaian komunitas ASEAN, yang terdiri dari tiga pilar, yaitu politik-

keamanan, ekonomi dan sosial budaya. Tiga pilar integrasi ini diharapkan bisa terwujud di Asia Tenggara pada 2015. Pada KTT ini juga akan dibahas pentingnya perkembangan penanganan masalah laut China Selatanyangmulaimenunjukkan kemajuanpadaPedomanPerilaku (Code of Conduct) di perairan tersebut. (m10)

BEIJING (Reuters): Polisi China menangkap 22 etnis Mongolia setelah ratusan di antara mereka memprotes pencaplokan tanah di Inner Mongolia, kata satu kelompok HAM Selasa (3/4), kasus terbaru pergolakan di bagian utara negara itu. Lebih80polisimelakukan‘tindakanbrutal’ untukmembubarkan aksi demonstrasi yang dilakukan ratusan etnis Mongolia dari desa Tulee di dekat kota Tongliao, kata Pusat Informasi HAM Mongolia yang bermarkas di New York. Kekacauan itu menjadi kecemasan baru bagi China yang sudah menghadapi pergolakan dari minoritas etnis Uighur di bagian barat dandarietnisTibetdibaradaya.DiInnerMongolia,limapengunjukrasa menderitalukaparahsetelahmerekaberkumpuluntukmenghadang satu bulldozer memasuki tanah pertanian mereka, kata kelompok HAM itu dalam satu pernyataan yang dikirim via email. “Polisi dengan kasarnya memukuli para pengunjukrasa dengan pentungan. Sebagian di antara mereka berdarah, sebagian dipukuli sampaijatuhketangan.Wanitadijambakrambutnyadandilemparkan ke kenderaan polisi,” kata kelompok itu mengutip keterangan para pengunjukrasa. Menurut pengunjukrasa, etnis Mongolia dari wilayah di bagian timur, sekitar 600 km dari Beijing, menuntut dikembalikannya sekitar 4.000hektartanahyangmerekakatakanaberusahadikuasaiperusahaan kehutanan.Polisidiwilayahituyangdihubungilewatteleponmengatakan mereka tidak mengetahui adanya aksi unjukrasa, dan seorang pria yangmenjawabteleponitudibirokeamananpublicTongliaomengatakan kantor-kantor tutup karena libur nasional Selasa. Etnis Mongolia, yang jumlahnya kurang 20 persen dari 24 juta pendudukInnerMongolia,mengeluhkantanahpertaniantradisional mereka dirusak pertambangan dan tindakan yang menjadi kawasan itutandus,danpemerintahmencobamemaksamerekadiamsaja.(m23)

Kebakaran Di Pasar Moskow Menewaskan 15 Pekerja Migran MOSKOW (AP): Satu kebakaran yang terjadi di satu pasar di pinggiran Moskow, Rusia, Selasa (3/4) menewaskan 15 pekerja migran yang sedang tidur di satu bagian dari pasar tersebut, demikian menurut departemen pemadam kebakaran kota. Semua korban yang tewas adalah warganegara bekas Uni Soviet di Asia Tengah, kata jurubicara Sergei Vlasov. Beberapa juta migran dariTajikistan, Uzbekistan dan Kyrgyzstan telah datang ke Moskow dalam usahanya mendapatkan pekerjaan. Banyak di antara mereka mendapat pekerjaan di bidang konstruksi atau di pasar kota yang tersebar di banyak tempat, yang menjual segala macam barang mulai dari pakaian sampai material bangunan. Vlasov mengtatakan kebakaran yang terjadi di pasar Kachalovsky pada pukul 05:00 Selasa dinihari memporak-porandakan satu gudang di mana para pekerja migran tersebut tidur. Atap bangunan itu ambruk dalam kebakaran tersebut, katanya. Parapenyelidikmasihterusmelakukantugasnyauntukmemastikan apapenyebabkebakarantersebut.SergeiGorbunov,kepaladepartemen kebakaran di distrik tenggara Moskow mengatakan di televisi Rusia bahwa para pekerja tersebut tidak dapat keluar dari salah satu pintu yang menghubungkan tempat mereka tidur dengan satu hangar penyimpanan barang. Dia tidak menjelaskan mengapa demikian. Dalam insiden terpisah Senin pagi, api melalap lantai bagian atas sebuah bangunan pencakar langit yang sedang dibangun. Bangunan tersebut jika rampung nanti akan menjadi gedung tertinggi Eropa. Tidak ada yang cedera dalam kejadian itu, lapor media negara. Kebakaran di Menara Federasi itu terjadi sebelum matahari tenggelam dan merebak di lantai 66 dan 67 bangunan tersebut, kata RIA Novosti. Bila gedung tersebut selesai dibangun pada tahun 2013, jumlah lantainya sampai 93. Para pejabat mengatakan, isolasi, kain terpaldanmateribangunanlainnyayangtertinggaldilantaiatassebagai penyebab kebakaran, kata kantor berita itu.(m23/m10)

6 Polisi Afghanistan Dan Dua Warga Sipil Tewas Di Selatan KABUL (AP): Para pemberontak membunuh enam polisi dan dua warga sipil di Afghanistan Selatan dalam serangan ganda, termasuk satu penghadangan di satu pos pemeriksaan setelah militan yang diduga meracuni sejumlah petugas yang menangani pos tersebut, demikian kata pihak berwenang Selasa (3/4). Kantor gubernur provinsi Helmand mengatakan dalam satu pernyataannya bahwa ‘para pemberontak telah meracuni’ makanan di satu pos pemeriksaan di distrik Nahri Sarraj dan kemudian menyerang polisi di sana Senin malam. Empat polisi tewsas dan dua lainnya cedera dalam serangan tersebut. Mayat dua warga sipil juga ditemukan di pos pemeriksaan itu. Kantor gubernur tidak menyebutkan apakah korban yang tewas itu akibat diracun atau akibat serangan bersenjata. Jurubicara Taliban Qari Yousef Ahmadi membantah keterangan pemerintah mengenai kejadian tersebut, dan mengatakan para pejuang Taliban menyerang pos tersebut. (m10)

The Associated Press

PARA petugas Pemadam Kebakaran dan Kementerian Darurat memeriksa lokasi pasar bangunan di Kachalovo, Moskow, Rusia, Selasa (3/4). Kebakaran di pasar di pinggiran Moskow itu Selasa dinihari menyebabkan 15 pekerja migran tewas saat mereka tertidur pulas di dalam pasar tersebut. Semua korban adalah warganegara bekas Uni Soviet di Asia Tengah.

Sport

A10

WASPADA Rabu 4 April 2012

BEK asal Portugal, Pepe (3 kiri), terlihat rileks bersama Esteban Granero dan skuad Real Madrid dalam sesi latihan jelang leg kedua perempatfinal Liga Champions melawan APOEL Nicosia di Santiago Bernabeu, Madrid, Selasa (3/4). -AP-

MADRID (Waspada): Real Madrid diprediksi tidak akan menemui kesulitan untuk melaju ke semifinal Liga Champions setelah meraih kemenangan 3-0 di leg pertama atas APOEL Nicosia, 27 Maret lalu. Langkah Madrid pun semakin ringan karena di leg kedua akan menjadi tuan rumah saat menjamu tamunya asal Siprus di Santiago Bernabeu, Kamis (5/4) dinihari nanti. Bintang Madrid, Cristiano Ronaldo, merasa yakin bahwa timnya tak hanya akan lolos ke semifinal, tetapi juga yakin Los Blancos bisa mengawinkan gelar Liga Champions dan La Liga. “Kami berada di jalur yang benar untuk memenangkan La Liga dan Liga Champions. Hasil kami dalam pertandingan melawan APOEL sangat penting. Menang 3-0 di laga tandang adalah hasil yang sempurna,” ujar

pemain yang akrab dipanggil CR7 ini seperti dilansir Goal, Selasa (3/4). Selain itu, Ronaldo juga mengungkapkan besarnya peluang Madrid dalam memenangkan pertandingan di leg kedua melawan APOEL. Menurutnya, Madrid hanya memiliki kemungkinan 90 persen untuk memenangkan laga itu dan lolos ke babak empat besar. Pasalnya, Ronaldo mengaku bahwa apa pun bisa terjadi dalam sepakbola. “Saya tidak ingin munafik. Jadi saya akan mengatakan bahwa kami memiliki 90 persen kemungkinan untuk menang

dan keuntungan bermain di kandang. Kami harus mengambil kesempatan untuk melangkah lebih jauh. Tetapi, masih ada 10 persen dan apapun bisa terjadi dalam sepakbola,” ujar mantan punggawa Manchester United ini. Sementara itu, Marcelo mengklaim Madrid senantiasa menyandang predikat sebagai salah satu favorit utama di seluruh ajang yang mereka ikuti, tak terkecuali Liga Champions. Apalagi bek lincah asal Brazil ini menilai Los Merengues sudah menancapkan satu kaki di semifinal. “Real Madrid selalu menjadi favorit di setiap kompetisi, tapi perjalanan yang mesti ditempuh masih panjang. Saya selalu bertaruh pada Madrid. Pemain mana pun pasti ingin menjuarai Liga Champions dan saya juga demikian,” kata Marcelo.

LEG II PEREMPATFINAL LIGA CHAMPION LEGI 1 Rabu (4/4) Real Madrid (Spanyol) vs APOEL (Siprus) Chelsea (Inggris) vs SC Benfica (Portugal) *RCTI live Kamis dinihari pkl 01:45 WIB

3-0 1-0

Prakiraan Formasi Pemain Real Madrid (1-4-4-2): 1-Iker Casillas; 17-Alvaro Arbeloa, 3-Pepe, 4Sergio Ramos, 12-Marcelo; 5-Nuri Sahin, 6-Sami Khedira, 10-Mesut Ozil; 7-Cristiano Ronaldo, 9-Karim Benzema, 20-Gonzalo Higuain APOEL (1-4-4-2): 22-Dionisis Chiotis; 7-Savvas Poursaitides, 98-Boaventura, 3-Paulo Jorge, 29-Nectarios Alexandrou, 23 Helio Pinto, 26-Nuno Morais, 10-Constantinos Charalambides, 8-Ailton Almeida, 21-Gustavo Manduca, 31-Helder Sousa Namun unggul agregat telak tetap dianggap Marcelo belum menjadi jaminan skuad besutan Jose Mourinho itu bakal mengatasi APOEL dengan mudah. Karenanya, Marcelo enggan meremehkan klub Siprus itu. “Saya pikir mereka bukan

tim yang buruk, kalau tidak bagaimana pun mereka bisa mencapai perempatfinal. Mereka (APOEL-red) mengalahkan Olympique Lyon untuk berada di babak ini dan itulah sebab kami harus menghormati lawan,” tandasnya. (m33/rm/goal/ini)

Buah Kegigihan MU MANCHESTER, Inggris (Waspada): Sir Alex Ferguson mengatakan kemenangan 2-0 atas Blackburn Rovers dalam lanjutan Liga Premier di Ewood Park, Selasa (3/4), bukan karena kualitas teknik atau fisik, melainkan mental. Pada laga itu, gol pertama MU dicetak Antonio Valencia pada menit 81 dan digenapi Ashley Young tepat lima menit sesudahnya. “Ini malam yang panjang, bukan? Kami harus terus gigih dan kini kami mendapatkan ganjarannya. Kami selalu menekan lawan dan mewaspadai serangan balik mereka yang memang kerap berbahaya,” papar Sir Alex. Dengan hasil tersebut, MU menguasai klasemen dengan 76 poin dengan selisih 49 gol. Setan Merah sementara unggul lima angka dari pesaing terdekatnya, Manchester City, yang punya rekor selisih 50 gol. “Kami sudah lebih rajin mencetak gol dan saya pikir itu adalah langkah besar untuk kami

karena kami sempat kalah 18 gol hingga menjadi satu gol. Kami masih punya tujuh pertandingan dan hal yang penting bukanlah total poin, melainkan berusaha dan memenangi sisa pertandingan,” tuturnya. Melawan Rovers, MU mengawali pertandingan dengan baik. Wayne Rooney cs terus menekan dan memaksa tuan rumah hanya mengandalkan serangan balik. Menit 11, MU nyaris unggul andai saja sontekan Javier ‘Chicharito’ Hernandez tidak dihentikan kiper Paul Robinson. Tuan rumah membalas pada menit 18 lewat tembakan jarak jauh David Hoilett. Beruntung bagi tim tamu, karena David De Gea melakukan penyelamatan gemilang. Tampil semangat di hadapan pendukungnya, Rover membombardir gawang De Gea yang dipaksa melakukan lima penyelamatan selama babak pertama. Sayang, kegemilangan kiper muda asal Spanyol itu menjadi

AP

Di Matteo Berharap Ketajaman Torres LONDON (Waspada): Fernando Torres diharapkan akan memimpin serangan Chelsea dalam usahanya meredam Benfica untuk maju keenam kalinya ke semifinal Liga Champions dalam sembilan tahun terakhir. Pada Kamis (5/4) dinihari nanti, Blues akan menjamu Benfica pada leg kedua perempatfinal. Torres, mencetak gol pertamanya dalam Liga Premier Inggris sejak kemenangan 4-2 atas Aston Villa, September lalu, sudah mencetak tiga gol dalam empat laganya terakhir bersama Blues dan diharapkan melanjutkan ketajamannya saat menggantikan Didier Drogba yang terkena cedera. Striker asal Negeri Matador itu memang mempertajam penampilannya dan menolong Chelsea membangun semangat pemain, termasuk ketika memberi umpan untuk Salomon Kalou dalam kemenangan 1-0 pada leg pertama di Benfica pekan lalu. “Striker memberi umpan untuk terciptanya gol tapi selain itu Fernando bermain amat bagus, kendati tanpa gol, karena ia banyak membantu terciptakanya gol dari teman-temannya,” kata Pelatih sementara, Roberto Di Matteo, Selasa (3/4). “Ia bekerja keras untuk timnya dan juga menikmati permainan. Ia penuh percaya diri dan selalu ada senyum di wajahnya,” katanya. Harapan Di Matteo pada Torres dirasa wajar mengingat striker asal Pantai Gading, Drogba, mengalami cedera ibu jari dalam latihan akhir pekan. Belum lagi Chelsea dipusingkan dengan absennya palang pintu mereka, David Luiz. Mantan pemain Benfica itu mengalami cedera pergelangan kaki dan kelihatannya akan digantikan bek asal Inggris, Gary Cahill. Sejak ditangani Di Matteo, Chelsea kalah hanya satu kali dalam delapan pertandingan.

Prakiraan Formasi Pemain Chelsea: 1-Petr Cech; 2-Branislav Ivanovic, 24-Gary Cahill, 26-John Terry, 3-Ashley Cole; 5-Michael Essien, 8-Frank Lampard; 7-Ramires, 10-Juan Mata, 21-Salomon Kalou; 9-Fernando Torres Benfica: 1-Artur Moraes; 14-Maxi Pereira, 4-Luisao, 6-Javi Garcia, 3-Emerson; 28-Axel Witsel, 21-Nemanja Matic, 20-Nicolas Gaitan, 8-Bruno Cesar; 10-Pablo Aimar, 7-Oscar Cardozo Tim London itu menang enam kali dari semua pertandingan dan kelihatannya berusaha memenuhi ambisi juara Liga Champions dan Piala FA, di mana mereka akan bertemu Tottenham Hotspur di semifinal. Selain itu, Chelsea akan berusaha memperpanjang rekor 100 persen laga kandang dengan empat kemenangan di pentas Champions musim ini, saat berhadapan dengan tim asuhan Jorge Jesus yang menggeser Braga dari puncak klasemen Liga Portugal. Dari kubu Benfica, kapten tim Luisao berpendapat bahwa Chelsea tidak layak atas kemenangan di leg pertama. Kepada wartawan, pelatih Jorge Jesus juga menyatakan bahwa Benfica ‘tidak layak kalah’. “Pertandingan di Lisbon meninggalkan ‘rasa asam di mulut’ karena Chelsea tidak pantas untung menang dan itu membuktikan bahwa tim yang bermain baik tidak selalu menang,” kata Luisao. “Meskipun Chelsea memiliki sedikit keuntungan oleh satu gol tandang, saya bersikeras peluang Benfica masih terbuka lebar dan tetap berpeluang merebut tiket semifinal tahun ini,” tambah bek berkepala plontos asal Brazil tersebut optimis. (m33/ant/rtr/goal)

PEMAIN Manchester United merayakan gol kedua yang dicetak Ashley Young (bawah tengah) dalam lanjutan Liga Premier melawan Blackburn Rovers di Ewood Park Stadium, Selasa (3/4). penghalang bagi Morten Gamst Pedersen cs. Setelah kedua tim silih berganti menyerang, MU akhirnya memecah kebuntuan. Antonio Valencia membobol gawang Robinson lewat tembakan kaki kanannya lewat sudut sempit. Gol ini menjadi pemicu semangat pasukan Red Devils. Menit 86, Setan Merah pun menambah keunggulan lewat

Ashley Young. Menerima umpanValencia,Young menundukkan Robinson dengan sepakan kaki kanannya setelah sebelumnya membelakangi gawang. Khusus gol pertama, Sir Alex sumringah dan memuji gol Valencia tipikal cetakan legendaris MU. Hingga akhir pertandingan, pelatih asal Skotlandia itu tak habis melontarkan kekagumannya atas gol winger andalannya

itu.

“Lahir di menit akhir pertandingan, itu adalah sebuah gol penting. Itu adalah tipikal gol legendaris MU. Jika Anda tidak mencoba menembak, Anda tidak akan pernah tahu bisa mencetak gol dengan cara seperti itu. Itu bisa jadi umpan silang atau tembakan, tapi sebaliknya malah menjadi gol indah,” pungkasnya. (m33/ini/espn)

Sevilla Perbaiki Posisi Klasemen

ALVARO Negredo (kiri) membuka gol pertama bagi Sevilla atas Mallorca, Selasa (3/4). -AP-

AP

SEVILLE, Spanyol (Waspada): Sevilla meraih kemenangan 3-1 ketika menjamu Mallorca dalam lanjutan La Liga Primera di Ramon Sanchez Pizjuan, Selasa (3/4). Kemenangan itu praktis memperbaiki posisi Sevilla di klasemen sementara. Sevilla tampil relatif lebih dominan ketimbang tim tamu. Gol pertama Sevilla hadir melalui sundulan Alvaro Negredo di menit 51. Gol tersebut tercipta diawali sepak pojok yang dieksekusi Jose Antonio Reyes. Sundulan Negredo dari sisi se-

belah kiri gawang Mallorca pun gagal dihalau Dudu Aouate. Manu Del Moral memperbesar keunggulan tuan rumah di menit 62. Umpan terobosan Jesus Navas ke dalam kotak penalti diselesaikannya dengan sebuah sepakan kaki kiri. Aouate pun kembali memungut bola dari gawangnya. Navas melengkapi performanya dalam pertandingan ini lewat gol di menit 69. Gol berawal dari operan Navas kepada Reyes yang berdiri di sisi kanan. Reyes kemudian meneruskan-

nya dengan umpan terobosan ke sisi kiri yang kembali diterima Navas. Lewat sebuah sepakan kaki kanan, Navas membuat timnya unggul tiga gol. Satu-satunya gol tim tamu dalam pertandingan ini dihasilkan oleh Tomer Hemed di menit 74. Berkat hasil ini, Sevilla naik satu strip ke urutan delapan klasemen dengan koleksi 42 poin atau sama dengan perolehan Atletico Madrid di urutan tujuh. Mallorca belum beranjak dari posisi 13 dengan koleksi 36 poin. (m33/ant/rtr)

AP

PULIHNYA ketajaman Fernando Torres (tengah) diharapkan membawa tuah bagi Chelsea saat berhadapan dengan Benfica di Stamford Bridge, London, Kamis (5/4) dinihari nanti.

Sport

WASPADA Rabu 4 April 2012

A11

Djohar Dapat Anugerah Sultan Ternate TERNATE (Waspada): Dukungan terhadap kepemimpinan Djohar Arifin Husin di PSSI tidak hanya datang dari insan sepakbola nasional, tetapi juga Kesultanan Ternate yang memberi penganugerahan kepada orang nomor satu di induk sepakbola nasional itu. Sesuai rencana pada Rabu (4/4) ini akan diadakan upacara pemberian penghargaan. Sayang, hingga berita ini diturunkan belum diketahui

nama penghargaan yang akan diberikan kepada Djohar. Hanya saja, Mudafar Sjah yang juga Sultan ke-48 dari Kesultanan Ternate dipastikan memberi penghargaan tersebut. “Alhamdulillah, kami diterima dengan sambutan meriah di Ternate. Mulai dari bandara, kami sudah disambut Gubernur Ternate dan masyarakat setempat yang membawa kami ke istana bertemu sultan melewati barisan kehormatan,” kata Djohar kepada Waspada di

Ternate, Selasa (3/4). Ditambahkan, Gubernur Ternate dengan tegas menyatakan dukungannya kepada PSSI saat ini dan memastikan dukungan serupa dari seluruh warga sepakbola di daerahnya. Termasuk jajaran Pengprov PSSI maupun Pengcab yang ada diTernate. Sultan pun secara khusus mempersilakan Djohar yang didampingi Deputi Sekjen Bidang Kompetisi, Saleh Ismail Mukadar, dan Direktur Media, Tommy R Arief, melihat salah

satu benda pusaka milik KesultananTernate, yakni Mahkota Kerajaan. Sultan, gemar sepakbola, berharap tuah kesakralan Mahkota Kerajaan itu senantiasa menaungi Djohar dalam memimpin PSSI. Di akhir pertemuan, tak lupa Djohar memberi kenang-kenangan berupa buku karangannya dan emblem PSSI kepada Sultan yang tengah merayakan ulang tahunnya ke-77. Djohar dan rombongan pun undur diri untuk membuka Kejuaraan

Piala Suratin U-17 Zona Maluku Utara di Stadion Kei Raha. “Kami datang ke sini bukan sekadar jalan-jalan, tetapi ingin memajukan kembali persepakbolaan Maluku Utara yang merupakan gudangnya pemain. Sejalan fokus PSSI menggalakkan pembinaan usia dini, dalam waktu dekat kami akan mengutus Bert Ventury (pelatih lisensi UEFA asal Belanda) yang menjadi konsultan kepelatihan untuk upgrade pelatih di Ternate,” kata Djohar. (yuslan)

Pereli Sumut Siap Tuai Prestasi Eddy/Adil Bidik Juara MEDAN (Waspada): Para pereli Sumut menyatakan siap tampil dan menuai prestasi di ajang North Sumatera Rally Championship (NSRC) 2012 dan seri I Kejurnas 2012 yang berlangsung Sabtu dan Minggu (7-8/4) di kawasan perkebunan London Sumatera (Lonsum), Kabupaten Langkat. Pasangan pereli Sumut dari tim TSA Indocafe Spectra, Eddy WS/Syariful Adil, adalah di antara kompetitor lokal yang optimis bisa mendulang sukses dalam event memperebutkan trofi Bupati Langkat tersebut. Eddy/Adil akan turun di kelompok GR 2.2 (penggerak dua roda) dan menjadi salah satu

Waspada/Armansyah Th

Pereli tim TSA Indocafe Spectra, siap membawa pulang dua gelar juara NSRC 2012 seri I. favorit juara di kelasnya. Selain itu, tim TSA juga menurunkan Utama Wijaya/M Arif Hutasuhut di atas Suzuki Swift grup N-15 yang juga dipatok juara. Ditemui di Medan, Selasa (3/4), Eddy/Adil yang juga pemegang gelar juara nasional GR 2.2 menyatakan siap memenangkan balapan guna kembali meraih gelar terbaik.

“Kami sangat optimis, mengingat persiapan kendaraan jauh-jauh hari sudah dilakukan. SX4 yang kami andalkan dilakukan penggantian suspensi baru, mengingat trek di Langkat ini berbatu dan bumpy. Untuk lintasan kering ataupun lumpur, kami sudah dibekali ban Swallow Spectra yang cukup menambah keyakinan,” ungkap

Eddy. Adil menambahkan pihak TSA (Trans Sumatera Agung) selaku pemilik tim, bahkan ingin mereka bisa menyodok ke posisi 5 Besar klasemen umum sekaligus bersaing dengan driver grup N lainnya. “Karenanya kami berharap bisa memberi kejutan sekaligus prestasi bagi warga Sumut,”

tutur Adil. Dikatakan, TSA mendukung penuh kiprah mereka kembali berlaga di ajang kejurnas 2012, dan akan ikut di semua seri yang sudah direncanakan. Malah, TSA juga ikut berpartisipasi mensukseskan event dengan mensupport course car (zero car dan double zero) yang dipiloti Agus Suherman/Yorris Tutupoly, serta Andy Limbong/M. Rizky Nugraha, keduanya di atas Suzuki SX4. “Saya juga ingin mendukung kejuaraan, sekaligus merasakan sensasi kejurnas reli, walaupun hanya sebagai driver course,” tambah Agus Suherman, yang dikenal pehobbi otomotif roda dua dan empat. Sekum Pengprov IMI Sumut, Drs H Zulhfizi Lubis, mengatakan pihaknya mendukung penuh NSRC 2012 Seri I, di mana IMI Sumut dipimpin Ketua Umum H Ijeck dan Ketua Panpel John Lubis telah beraudiensi dengan Bupati Langkat H Ngogesa Sitepu SH. Direncanakan, bupati akan membuka NSRC 2012 seri I dalam acara penglepasan di Alun-alun Kantor Bupati Langkat, Stabat, Minggu (8/4). (m47)

Medan Dominasi Atlet Catur PON Target Pertahankan Medali Emas MEDAN (Waspada): Pecatur Kota Medan mendominasi skuad tim catur Sumut ke PON XVIII di Riau pada September mendatang. Ini merupakan kejutan, di mana biasanya tim Sumut didominasi pecatur dari “gunung”. Demikian disampaikan Sekretaris Umum Pengprov Percasi Sumut, Perry Iskandar, Selasa (3/4). Dia mengakui, Pengprov Percasi Sumut pimpinan Parlindungan Purba telah melakukan perubahan. Ini terlihat yang biasanya pecatur berasal dari“gunung” seperti Kabupaten Karo dan Tapanuli Utara yang mendominasi, kini bergeser ke Kota Medan.

Pada kelompok putra, kontingen catur Sumut ke PON seluruhnya diperkuat pecatur asal Medan. Mereka adalah MF Pitra Andika, MF Hamdani Rudin, MN Binsar Marbun, MN Sukarnaedi, dan MP Marihot Simanjuntak. “Ini merupakan sejarah bagi perkembangan catur di Sumut,” ujar Perry didampingi Ketua Pengcab Percasi Medan, Sonny Firdaus SH, yang juga Kabid Pembinaan Prestasi Percasi Sumut. Pada PON di Riau, pecatur Sumut mengikuti kategori beregu dan perorangan. Untuk perorangan diwakili MP Marihot Simanjuntak. Di kelompok

putra, Percasi Sumut target mempertahankan medali emas. Seperti diketahui, pada PON XVII/2008 di Kaltim, pecatur Sumut memperoleh satu medali emas melalui mendiangYohannes Simbolon dann satu perunggu dari beregu putra. Menurut Perry, untuk beregu akan diikuti 10 provinsi. Ke-10 provinsi itu adalah Sumut, Sulut, Kaltim, Bali, Sumsel, Jatim, DKI Jakarta, Jabar, Kalsel, dan tuan rumah Riau. Sementara itu, perorangan putra diikuti 20 pecatur. Tuan rumah Riau mendapat wild card dua pecatur, sedangkan 18 pecatur lolos prakualifikasi PON. Gorontalo meloloskan

Labura Kejutkan Simalungun B Union Cup IV P E M ATA N G S I A N TA R (Waspada): PS Pemkab Labura melaju ke babak 8 Besar dengan menaklukkan PS Pemkab Simalungun B 4-0 dalam lanjutan turnamen sepakbola Union Cup IV Grup C di Lapangan TS Mardjans Saragih Kodim 0207/ Simalungun, Selasa (3/4). Kekalahan Simalungun memang di luar dugaan, mengingat tim yang sukses menaklukkan PS Tebingtinggi 4-1 itu di atas kertas lebih diunggulkan. Sebaliknya, PS Labura yang sebelumnya menelan kalah 04 dari Tebingtinggi diprediksi bakal jadi korban kedua Simalungun. Namun Labura justru membuat kejutan menyingkirkan

Simalingun B untuk melaju ke 8 Besar sebagai runner-up grup mendampingiTebingtinggi yang sama-sama mengemas tiga poin, namun unggul agretivitas gol. Laga kedua kubu sempat ricuh akibat pemain Simalungun B dan Labura tidak bisa menahan emosi. Akibatnya, wasit Sahrial Panggaben terpaksa mengeluarkan Chiko (Simalungun B) yang sengaja menginjak kaki Kapten Labura, Bayu. Tampil dengan 10 pemain, Simalungun sulit mengimbangi anak-anak Labura. Keadaan ini dimanfaatkan Labura untuk mencetak gol di akhir babak pertama. Keunggulan jumlah pemain terus dimanfaatkan Labura yang kembali mencetak

Problem Catur

TTS TOPIK

Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2 8

7

6

5

4

3

2

1 A

B

C

D

E

gol lewati Rudi dan Ardiyanto. Tertinggal tiga gol, Simalungun B semakin bermain kasar dan anak-anak Labura mulai terpancing. Puncaknya saat pemain Simalungun, Iswanto, melakukan tekel keras terhadap Ardiyanto yang langsung dibalasnya. Akibatnya, wasit langsung mengusir Ardiyanto dan Iswanto hanya diberi kartu kuning. Setelah itu, Labura masih mampu menambah gol lewat M Rizky. Babak 8 Besar mulai digelar Kamis (5/4) besok dengan mempertemukan PS Pemko Medan yang diwakili TGM dan Patmi 50 yang menjadi wakil PS Pemkab Batubara. (a30)

F

G

H

dua pecatur, yakni IM Suhendra dan MN Tommy Suprianto. Kaltim menyusul dengan dua pecatur, MN Iqra Musa dan Andi Nurjabal, lalu Octo Dami, Surip (Bali), Uyun Musa (Papua Barat), MP Marihot Simanjuntak (Sumut), MN Ruby Tamono (Sumbar), MN Anasrullah (Babel), MN Zulkhaeri (Aceh), FM Johan Gunawan (Banten), MN Denni Sonjaya (Jabar), IM Ronny Gunawan (Jatim), MN

Sumaryono (Yogyakarta), MN Rahmat (Kalsel), MN Godam Eko H.S (Sumsel), dan Syarif Burhanudin (Kalbar). Di kelompok putri, Sumut meloloskan MNW Tri Handayani, MNW Tuty Rahayu Sinuhaji, Charlely Tessy, Maria Herlina Siahaan, dan Yola Yolanda. Beregu putri diikuti, Kaltim, DKI Jakarta, Banten, Jateng, Jabar, DIY, Jambi, Sumut, Bali, dan Riau. (m18)

Tinju Medan Harus Bangkit MEDAN (Waspada): Sekretaris Umum Pengprov Pertina Sumut, Edi Sibarani, meminta kepada pengurus Pertina Kota Medan yang baru terbentuk untuk membangkitkan kembali kejayaan tinju di Medan yang selama dinilai sudah menurun. “Medan salah satu kota yang menjadi barometer pembinaan tinju di Indonesia. Tidak dipungkuri, banyak atlet tinju asal Medan telah meraih prestasi di kancah nasional dan internasional,” ujar Edi Sibarani saat menerima audiensi pengurus baru Pertina Kota Medan periode 2012-2015 di Sekretariat Pertina Sumut, Jl Tuamang Medan, Selasa (3/4). Namun, lanjutnya, beberapa tahun terakhir ini prestasi tinju Kota Medan mulai menurun. Termasuk pada event tingkat Kejurda, di mana dalam tiga tahun terakhir prestasi petinju Medan mengalami kemunduran. Padahal sebelumnya selalu tampil sebagai juara umum. “Untuk itu, dengan kepengurusan yang baru, kita berharap tinju Kota Medan kembali bangkit. Terlebih di Medan terdapat sedikitnya 14 sasana. Jumlah itu berbeda jauh dari daerah lainnya di Sumut yang rata-rata hanya memiliki dua hingga hingga sasana saja,” ucapnya. Ketua Umum Pengkot Pertina Medan, Binson Simbolon, yang hadir bersama Irianto Bhakti (Ketua Harian), Martua Sinurat ST (Wakil Ketua III), Drs Binner Dabukke (Sekretaris), dan sejumlah pengurus lainnya, mengaku siap mengembalikan kejayaan tinju Kota Medan dengan meningkatkan pembinaan atlet, termasuk mendukung keberadaan sasana di Medan. “Saat ini kami terus melakukan konsolidasi dan merangkul semua pihak untuk bersama membangun olahraga tinji di Medan. Rencananya, kepengurusan Pertina Medan akan resmi dilantik pada 28 April mendatang,” ucap Binson. (m42)

KESEHATAN

Mendatar

1. Pilih: Bekam, Demam atau Keram diatasi dengan obat antipiretik. 4. Pilih: Neuro, Nitro atau Nyeri diatasi dengan obat analgesik. 6. Singkatan Spesialis Saraf. 8. Merek obat meredakan gejala demam dan sakit kepala, produksi PT Bayer. 9. Kehilangan daya ingat, terutama tentang masa lalu. 10. Sakit ingatan; Sakit jiwa. 11. Sepanjang lengan bawah. 12. Singkatan Konsultan Feto Maternal (subspesialis kebidanan-kandungan). 13. Pembantu dokter, bertugas di Puskesmas. 15. Pembusukan atau perusakan pada tulang atau gigi. 18. Fakultas mencetak para dokter; Segala sesuatu yang berhubungan dengan dokter atau pengobatan penyakit. 20. Rambut (Inggris). 21. Pembebat perut berbentuk kemban untuk membuat perut wanita tampak lebih kecil. 22. Tumor ganas. 23. Marah; Berang. 24. Cairan jernih diperlukan manusia, hewan dan tumbuhan. 25. Menstruasi. 27. Usaha menyadarkan atau menghidupkan dengan pernafasan buatan atau

Waspada/Yuslan Kisra

KETUA Umum PSSI, Djohar Arifin Husin, saat membuka kompetisi di Ternate, Selasa (3/4).

Manajemen Percaya Suharto Cs MEDAN (Waspada): Manajemen PSMS Medan akhirnya menetapkan Suharto AD bersama Roekinoi dan Sugiar tetap menjadi tim pelatih skuad Ayam Kinantan pada lanjutan putaran kedua Indonesian Super League (ISL) 2011-2012. Sebelumnya, manajemen PSMS membidik Drs Syafei Pilly menjadi pelatih kepala mendampingi Suharto cs. Namun kubu PSMS sendiri membantah wacana tersebut, begitu juga CEO PSMS Idris SE saat dikonfirmasi. “Kami belum membicarakan sosok pelatih. PSMS sendiri tetap mempertahankan Suharto dan kawan-kawan untuk putaran kedua nanti,” kata Idris di Stadion Kebun Bunga Medan, Selasa (3/4). Putaran kedua ISL sendiri mengalami pergantian jadwal dari semula 16 April menjadi 9 April. Alhasil, Suharto menyebutkan pihaknya terpaksa mempercepat masa libur pemain untuk kembali pada Rabu (4/4) ini guna menjalani persiapan lebih awal. Nantinya, PSMS akan dijamu PSPS Pekanbaru di laga pertamanya, Senin (9/4) mendatang. Awalnya, PSMS dijadwalkan melakoni laga pertama putaran kedua ini pada 16 April menghadapi Persija Jakarta. Dengan perubahan jadwal, Markus Horison cs akan dijamu skuad Macan Kemayoran pada 14 April mendatang. Selama putaran kedua, Ayam Kinantan akan melakoni 10 laga tandang dan tujuh

Waspada/Austin Antariksa

CARETAKER PSMS Medan, Suharto (kanan), dipertahankan manajemen Ayam Kinantan bersama Roekinoi (kiri) dan Sugiar untuk putaran kedua ISL nanti. partai kandang. Menjawab pertanyaan tentang pemain baru, Suharto mengaku hingga sekarang baru nama Fakhruddin yang merapat ke PSMS. Menurut rencana, Fakhruddin yang berasal dari Deltras Sudiarjo sudah berada di Mes Kebun Bunga pekan ini. Suharto juga mengakui telah memasukkan Wiganda Pradika (pemain magang) untuk mengisi kekosongan stok pemain lokal. Guna mengisi posisi yang ditinggal Inkyun Oh dan Choi Dong Soo, pihaknya mengaku butuh dua pemain asing (gelandang) dan satu (striker) lokal. Khusus Choi, sang pemain dikabarkan akan mengikuti seleksi bersama Persipura Jayapura. Selain duo Korea Selatan itu, PSMS juga mendepak empat pemain lainnya. Mereka adalah

Jadwal PSMS Di Putaran Kedua 9 April vs PSPS (tandang) 14 April vs Persija (tandang) 19 April vs Deltras 23 April vs Persidafon 28 April vs Sriwijaya (tandang) 4 Mei vs Persiba (tandang) 8 Mei vs Persegres (tandang) 20 Mei vs Persela 26 Mei vs Arema 30 Mei vs Persiram (tandang) 3 Juni vs Persipura (tandang) 7 Juni vs Persiwa (tandang) 17 Juni vs Persib 23 Juni vs Pelita Jaya 28 Juni vs PSAP 7 Juli vs Mitra Kukar (tandang) 11 Juli vs Persisam (tandang) Sigit Sudarmawan (striker), Jimmy Mak, Masruddin Al Massi (gelandang), dan Eko Prasetyo (bek). (m17)

Klasemen Sementara Tim Sisa Dunia Peluru FC Immortal FC Chaldera United De Bargeszt Bacok FC Adulas Men

5 5 0 0 31-16 15 5 4 0 1 45-22 12 4 3 0 1 31-16 9 5 2 1 2 25-27 7 5 2 0 3 33-27 6 6 1 1 4 29-50 4 6 0 0 6 30-66 0

TIGA pemain De Bargeszt mengepung Hamdani Wibowo (tengah) dalam lanjutan Liga Futsal STIK-P, Selasa (3/4).

-Waspada/Arianda Tanjung-

Gelar TSD Di Depan Mata Liga Futsal STIK-P MEDAN (Waspada): Kemenangan atas juara bertahan De Bargeszt, Selasa (3/4), kian memperkokoh posisi Tim Sisa Dunia (TSD) di puncak klasemen Liga Futsal Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan. Dalam kompetisi yang digelar di Lapangan De Futsal, Jl STM/Suka Aman, TSD meraih kemenangan tipis 6-5. Praktis, raihan tiga poin ini memperbesar kans David Swayana cs mengangkat trofi pada kegiatan yang turut memeriahkan Dies Natalies STIK-P ke-25 tersebut. Butuh kemenangan untuk menjaga peluang menembus tiga besar klasemen, DB bermain dengan semangat juang tinggi. Alhasil, kiper TSD Khairunnas dipaksa memungut bola dari jalanya ketika Andi Arispati menaklukkan alumni angkatan 14 itu. rangsang jantung.

Menurun

2. Tenaga. 3. Sakit kepala disertai rasa nyeri berdenyut pada satu sisi saja, biasanya menyerang wanita. 4. Cairan berbau busuk yang keluar dari bisul. 5. Penyakit yang ditandai rasa nyeri atau radang pada otot, sendisendi atau jaringan-jaringan badan; Encok; Penyakit tulang. 6. Tidak lapang; Sukar bernapas. 7. Istilah kedokteran untuk kejang otot. 13. Terapi dengan pemberian obat medula. 14. Benda cair jatuh menitik; Takaran obat. 16. Kedua bagian tulang, atas dan bawah, dalam rongga mulut tempat gigi tumbuh. 17. Penyakit menular yang berjangkit dengan cepat di daerah yang luas dan menimbulkan banyak korban; Wabah. 18. Jatuh sakit lagi (biasanya lebih parah dari sebelumnya). 19. Bedah. 22. Alat untuk membersihkan rahim. 23. Zat ringan yang sifatnya seperti udara. 24. Lapisan tipis; Diulang artinya plasenta. 26. Singkatan dokter.

Gawang DB yang dikawal Prawira Setia Budi akhirnya bergoyang juga berkat sepakan AustinTumengkol meneruskan bola muntah free kick. Setelah itu, Austin dan David Swayana memperbesar keunggulan tim jawara 2010 tersebut di babak pertama. Kendati hanya bermain dengan lima orang, DB tak kunjung menyerah. Sebaliknya, Andi Arispati lagi-lagi menjebol gawangTSD.Tak tanggung-tanggung, Andi yang juga calon wisudawan tahun ini mencetak seluruh lima gol timnya. Sayang, kegemilangan Andi dipatahkan TSD yang menambah angka melalui duet paling disegani tim lawan, Austin dan David. Dengan tambahan lima gol, Andi sementara menduduki runner-up top skor dengan total 23 gol. Pasalnya, Fiqih mengoleksi tujuh gol untuk Adulas Men

saat dikalahkan Chaldera United 8-10 pada laga terakhir. Meski mengantongi 25 gol, predikat top skor Fiqih masih bisa digagalkan Andi yang memiliki satu pertandingan sisa melawan Immortal FC, Sabtu (7/4) nanti. Selain Fiqih, gol Adulas disumbangkan Andi Ahmad. Sementara itu, 10 gol torehan Chaldera masing-masing diciptakan Thomas Sembiring (4), Yen Sutrisno (3), M Nauri (2), dan Adil Syahputra. Di laga pembuka, Bacok FC gagal mencuri poin setelah ditumbangkan Peluru FC 4-13. Lico Septian membukukan enam gol bagi Peluru yang juga mendapat sumbangan dari Phillip Joseph (3), Christopel (2), Rahmad Hidayat, dan Arif Rahman Hakim. Empat gol Bacok dibagi rata oleh JafarWijaya dan Ahmad Fauzi. (m33)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawaban di halaman A2 kolom 1.

3

7

6 9 4 6 1 7 9 1 7 6 9 5

6

9

9

5 7 9 2 3 9 6 3 5 7 4 1 8 5 7 3 ***426

Sport

A12

WASPADA Rabu 4 April 2012

Beckham Bintangi Iklan Olimpiade LOS ANGELES, AS (Waspada): Meski sudah berusia 36 tahun, pamor David Beckham (foto) tampaknya belum menurun. Ini dibuktikannya dengan membintangi iklan Burger King dan Adidas. Untuk iklan di Burger King, Becks diceritakan sedang membeli minuman baru. Sang pelayan yang sepertinya sangat terkesima dengan Becks hanya bisa terdiam. Di iklan Adidas, Becks memang sudah lama menjadi ikon produsen olahraga asal Jerman tersebut. Dirinya bahkan didaulat menjadi duta Adidas bersama Zinedine Zidane. Kali ini, Becks tampil khusus untuk iklan Olimpiade. Adidas memang sponsor

utama tim Inggris Raya di Olimpiade 2012. Di iklan yang bertemakan ‘Britain Prepares 2012’, bintang Los Angeles Galaxy itu tidak hanya tampil sendirian. Selain Becks, ada Lionel Messi, penyanyi Katy Perry, dan bintang Chicago Bulls, Derrick Rose. Iklan ini sepertinya semakin memperkuat asumsi jika Beckham benar-benar akan tampil di Olimpiade 2012 bersama tim sepakbola Inggris Raya. Pasalnya, Stuart Pearce yang juga Manajer Inggris Raya pernah mengatakan tidak menutup kemungkinan untuk memanggil ayah empat anak itu ke skuad Three Lions. (m33/vvn)

metro

Pedrosa Miliki Lisensi Palsu MADRID (Waspada): Akibat curang dalam ujian lisensi mengemudikan yacht, Dani Pedrosa sempat ditahan oleh pihak kepolisian Valencia di akhir pekan. Demikian dijelaskan pengacara rider MotoGP asal Repsol Honda itu, Selasa (3/4). Kecurangan pebalap Spanyol berusia 26 tahun itu adalah menggunakan sistem canggih berupa earpiece atau alat bantu dengar dan kamera kecil saat ujian lisensi mengemudikan yacht di Universidad Politecnica de Valencia. Seperti dilansir El Pais, pihak kepolisian mengatakan bah-

wa Pedrosa ditanyai bersama sejumlah orang lain. Kasus ini kini tengah dipelajari dan siap masuk ke pengadilan Valencia. Untuk mendapatkan peralatan tersebut, Pedrosa disinyalir mesti membayar antara 2.0002.500 euro (Rp18-22 juta). Biaya tersebut mencakup bimbingan dalam menjawab soal-soal ujian.

Menurut pernyataan salah satu pihak yang berwenang, Paula Sanchez de Leon, ada 21 orang yang ditahan dalam operasi ini, termasuk empat orang yang lulus dalam ujian tersebut. Kini Pedrosa telah dibebaskan pihak kepolisian dan langsung merilis permintaan maaf sembari mengakui bahwa dirinya telah berbuat kesalahan. “Akibat mengikuti saran yang buruk, saya pun membuat kesalahan. Kesalahan bisa diabaikan atau dipelajari dan saya telah belajar dari kesalahan ini,” kata Pedrosa, juara kelas 125cc dan 250cc ini menyesali tinda-

kannya. “Saya mengumumkan permintaan saya kepada fans dan semua orang yang mempercayai saya. Sekarang saya ingin melangkah ke depan. Saya merupakan pembalap motor, kejuaraan dunia akan dimulai akhir pekan ini, dan saya hanya ingin fokus pada balapan Minggu nanti,” urai Pedrosa. MotoGP akan dimulai pada Minggu (8/4) nanti di Sirkuit Losail Qatar. Musim lalu, Pedrosa berada di urutan keempat, setelah absen dalam beberapa seri akibat patah tulang baru. (m33/mgp)

25 Atlet Sumut Berlatih Di China MEDAN (Waspada): KONI Sumut mengirim 25 atlet dari lima cabang olahraga untuk berlatih di Guangzhou, China, sebagai persiapan menghadapi PON XVIII/2012 di Riau pada September mendatang. Keberangkatan para atlet terbagi dalam dua gelombang, didahului 15 atlet wushu plus dua pelatih pada Kamis (6/4) besok. Sedangkan 10 atlet lainnya dari cabor atletik, anggar, judo, dan gulat direncanakan bertolak 15 April mendatang. Ketua Harian KONI Sumut John Ismadi Lubis, Wakil Ketua II Prof Agung Sunarno, Sekum Chairul Azmi Hutasuhut MPd, dan Bidang Luar Negeri Iwan Kwok, melakukan pertemuan dengan para atlet yang akan diberangkatkan itu di Sekretariat KONI Sumut, Jl Pancing Medan, Selasa (3/4). Pada pertemuan yang juga dihadiri pelatih maupun perwakilan Pengprov olahraga, John Lubis menyebutkan pengiriman atlet berlatih atau menjalani Pelatda PON di China, diharapkan memberi perubahan positif, baik soal semangat dan kemampuan serta teknik bertanding yang pada akhirnya diharapkan membuahkan prestasi di PON. Keseriusan dan pengorbanan para atlet memang sangat diharapkan. Bahkan bagi atlet yang beragama Islam, dipastikan tidak bisa merayakan Lebaran Idul Fitri bersama keluarga di tanah air, karena program latihan dijadwalkan berlangsung hingga jelang pelaksanaan PON September mendatang. “Para atlet baru akan kembali dari China jelang PON, dan

nantinya langsung bertolak ke Riau, tempat digelarnya pesta olahraga paling bergengsi di tanah air itu,” ucap Agung Sunarno. Sekum KONI Sumut, Chairul Azmi, menambahkan atlet dituntut siap dan yakin dengan kemampuannya. Jangan cengeng, walaupun program latihan di China pasti jauh lebih berat. “Camkan di hati kalian bahwa keberangkatan berlatih di China ini adalah untuk kalian sendiri, bukan untuk kami para pengurus,” ucap Chairul memotivasi para atlet. Dikatakan, para atlet pantas bersyukur dan bangga, karena kini sudah termasuk kategori atlet elit, berlatih ke luar negeri atas biaya masyarakat Sumut. Iwan Kwok menjelaskan, khusus atlet atletik, anggar, judo, dan gulat nantinya berlatih di Weilun Sports Centre Guangzhou. Sementara itu, wushu taolu ke Xiamen dan sanshou ke Zhengzhou-Henan. Ke-25 atlet yang akan berlatih ke China adalah Aldi Lukman, Heriyanto, Johannes Bie, Lindswell, Dessy Indri Astuti, Eric Losardi (wushu taolu), Harba Sibuea, MeiYulian Nengsih Kurniati, Haulian Gultom, Junita Malau, Hendrik Tarigan, Immanuel Sirait, Moses Milala, Dasmantua Simbolon dan Hotma Dearma Purba (wushu sanshou). Selanjutnya, Zulkarnaen Purba, Edy Haryanto, Nyai Prima Agita,Yogi Triono (atletik), Dian Rahmayati dan Jian Siska (anggar), Denny Zulfendri dan Ricky Ramadhan (judo), Sumurung Siregar dan Eka Maya Sari (gulat). (m42)

SEJUMLAH atlet Sumut yang akan berlatih ke China foto bersama pengurus KONI Sumut, Selasa (3/4).

Tommy Kalah, Taufik-Simon Lanjut SYDNEY, Australia (Waspada): Tunggal putra Indonesia, Tommy Sugiarto (foto), langsung tersingkir di babak pertama turnamen Australia Terbuka Grand Prix Gold di Sydney, Selasa (3/4). Tommy, diunggulkan di tempat keenam, kalah di tangan Hong Ji Hoon (Korsel) 15-21, 9-21. Ini merupakan kekalahan yang menyakitkan buat Tommy yang tampil gemilang di semifinal Axiata Cup, pekan lalu. Apalagi ia sebenarnya telah unggul dalam dua pertemuan sebelumnya menghadapi Ji Hoon. Sebelumnya, Taufik Hidayat dan Simon Santoso tak menemui kesulitan berarti untuk mengalahkan lawan-lawannya. Simon mengalahkan Joe Wu 21-8, 21-13, sedangkan Taufik menyingkirkanWesley Caulkett 21-12, 21-14. “Pertandingan ini lebih saya manfaatkan untuk adaptasi dengan kondisi lapangan, angin, shuttlecock, dan sebagainya. Lapangan sedikit berangin, namun tidak terlalu jadi masalah,” kata Simon mengenai pertandingannya. Sementara itu, Alamsyah Yunus mengikuti sukses dua rekan senegaranya dengan menundukkan Juara Dunia Junior 2011 asal Malaysia, Zulfadli Zulkifli. Meskipun sempat, Alamsyah berhasil menyelesaikan pertandingan 21-17,

Antara

Waspada/ist

AP

Dallas Kalah Telak DALLAS, AS (Waspada): Dallas Mavericks dipaksa menelan malu di hadapan pendukungnya sendiri. Sang juara bertahan tak kuasa meredam LA Clippers yang sukses mengalahkan tim juara bertahan 94-75. Di American Airlines Center, Dallas, Selasa (3/4), Mavericks tidak diperkuat dengan Jason Kidd karena cedera pangkal paha dan Lamar Odom yang terserang penyakit di perutnya. Hasil ini menandai kemenangan keenam secara beruntun yang didapat Clippers untuk pertama kali dalam 20 tahun atau terakhir sejak tahun 1992.

Dirk Nowitzki cs mengawali laga dengan lesu sehingga kalah tertinggal delapan angka di akhir kuarter pertama dengan 17-25 dan semakin tertinggal jauh di periode berikutnya dengan kedudukan 33-47. Di kubu lawan, Clippers cukup konsisten. Dallas bahkan sempat tertinggal hingga dua digit angka di akhir kuarter ketiga dengan skor 54-72. Pada kuarter penentuan, Dallas tetap tidak bisa berbuat banyak untuk mengejar defisit angka dari Clippers. Clippers memenangi pertandingan dengan selisih 19 angka dari lawan. Guard Clippers, Randy

Hasil Selasa (3/4) Milwaukee Bucks vs Washington Wizards Houston Rockets vs Chicago Bulls Memphis Grizzlies vs Oklahoma City Thunder Utah Jazz vs Portland Trailblazers Sacramento Kings vs Minnesota T’wolves LA Clippers vs Dallas Mavericks Foye, bersinar dengan torehan 28 poin. Blake Griffin dan Caron Butler menambah 15 dan 13 angka, sedangkan Chris Paul hanya mendulang delapan angka dan 10 assist. Nowitzki menjadi pemain terbaik Dallas dengan raihan 19 poin. Di Washington, Milwaukee Bucks semakin membuka peluang maju ke babak playoff setelah menggulung Washington Wizards 112-98 di bawah pim-

112-98 99-93 94-88 102-97 116-108 94-75

pinan Monta Ellis dan Mike Dunleavy yang sama-sama menyumbang 17 poin. Brandon Jennings menambah 10 poin, tujuh assist, dan enam rebound, sedangkan Ersan Ilyasova mengoleksi 16 angka 11 rebound untuk Bucks, tim yang tertinggal dua pertandingan dengan NewYork Knicks untuk melakoni babak akhir playoff Wilayah Timur. (m33/ap)

Sumatera Utara

WASPADA Rabu 4 April 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:30 12:43 12:31 12:38 12:37 12:34 12:31 12:26 12:33 12:33

‘Ashar 15:35 15:45 15:35 15:40 15:40 15:42 15:36 15:32 15:38 15:36

Magrib 18:35 18:49 18:36 18:44 18:43 18:39 18:36 18:31 18:38 18:38

‘Isya

Imsak

Shubuh Syuruq

Kota

19:44 19:58 19:45 19:53 19:52 19:47 19:44 19:40 19:47 19:47

04:57 05:09 04:58 05:04 04:04 05:03 04:58 04:54 05:00 04:59

05:07 05:19 05:08 05:14 05:14 05:13 05:08 05:04 05:10 05:09

L.Seumawe 12:36 L. Pakam 12:29 Sei Rampah12:28 Meulaboh 12:40 P.Sidimpuan12:27 P. Siantar 12:28 Balige 12:28 R. Prapat 12:25 Sabang 12:43 Pandan 12:29

06:22 06:34 06:23 06:29 06:29 06:27 06:23 06:19 06:25 06:24

Zhuhur ‘Ashar 15:38 15:34 15:33 15:44 15:36 15:34 15:35 15:32 15:44 15:37

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:42 18:35 18:34 18:46 18:32 18:34 18:33 18:30 18:49 18:34

19:51 19:43 19:42 19:54 19:41 19:42 19:42 19:38 19:58 19:43

05:02 04:56 04:56 05:07 04:56 04:56 04:56 04:53 05:09 04:58

05:12 05:06 05:06 05:17 05:06 05:06 05:06 05:03 05:19 05:08

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:29 12:31 12:41 12:33 12:30 12:37 12:25 12:36 12:29 12:28

18:34 18:36 18:47 18:38 18:36 18:43 18:31 18:41 18:34 18:33

19:43 19:45 19:56 19:47 19:45 19:52 19:39 19:50 19:42 19:42

04:58 04:59 05:07 05:02 04:58 05:04 04:53 05:03 04:57 04:55

05:08 05:09 05:17 05:12 05:08 05:14 05:03 05:13 05:07 05:05

Panyabungan 12:26 Teluk Dalam12:33 Salak 12:31 Limapuluh 12:27 Parapat 12:29 GunungTua 12:26 Sibuhuan 12:26 Lhoksukon 12:35 D.Sanggul 12:29 Kotapinang 12:24 AekKanopan 12:26

06:27 06:21 06:20 06:32 06:21 06:21 06:21 06:18 06:34 06:22

15:37 15:37 15:42 15:40 15:35 15:40 15:31 15:41 15:36 15:33

06:22 06:23 06:32 06:26 06:22 06:29 06:18 06:28 06:22 06:20

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:35 15:43 15:38 15:32 15:35 15:34 15:34 15:38 15:36 15:32 15:32

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:31 18:37 18:36 18:32 18:34 18:31 18:30 18:41 18:34 18:29 18:31

19:39 19:46 19:45 19:41 19:42 19:39 19:39 19:50 19:43 19:37 19:39

04:55 05:02 04:59 04:54 04:57 04:54 04:54 05:02 04:58 04:52 04:54

05:05 05:12 05:09 05:04 05:07 05:04 05:04 05:12 05:08 05:02 05:04

06:20 06:27 06:24 06:19 06:21 06:19 06:19 06:27 06:22 06:17 06:18

Bus Pinang Indah Terbalik 11 Penumpang Luka-luka PERBAUNGAN (Waspada): Bus penumpang CV. Pinang Indah BK 7218 LY jurusan Rantau Parapat-Medan terbalik di Jalinsum Km 43-44, Dusun II, Desa Pasar Bengkel, Kec.Perbaungan, Kab.Serdang Bedagai, Selasa (3/4) dinihari sekira pukul 03:45. Akibatnya peristiwa itu, 11 penumpang luka-luka. Para korban yang umumnya mengalami luka lecet dan terkilir yakni Japri Pais, 48, warga Griya Nusa III, Blok F, No. 2, Jl. Selamat, Medan,Suwito,19, dan Adi Surya, 38, keduanya warga Dusun II,

Sidua-dua, Desa Gunting Sagala, Kec. Aekkanopan, Kab. Labura. Suwito, 19, Rama Br Sinaga, 20, warga Gg. Teratai Dalam, Jl. Pancing, Kec. Sidorejo Hilir, Medan.

Selanjutnya Jamal, 63, Jl. Garu IIA, Medan Amplas, Tulus Bugaring, 42, warga Jl. Binjai, Km 12,5, Kec. Sunggal, Ronal Silalahi, 29, warga Jl. By Pass Rayo Raja, Kec.RantauUtara,Kab.Labuhanbatu, Abu Kosim, 24, warga Kampung Pajak, Rantauparapat, Ramadan Napitupulu, 29, warga Cikampak, Bagan Batu, Mispan, 37, warga Sigambal, Rantauparapat, Robinson, 46, warga Jl. Mandala By Pass, Medan. Informasi dihimpun Waspada, bus penumpang melaju dengankecepatantinggiberusaha

mendahului bus penumpang lainnya di jalan menikung, akhirnya bus Pinang Indah oleng danhilangkendalihinggaakhirnya terbalik. Sopir bus melarikan diri meninggalkan penumpang dan busnya yang ringsek. Petugas Satlantas Polres Sergai yang tiba di TKP langsung mengevakuasi para korban ke RSUTrianda, Pasar Bengkel, Kec. Perbaungan untuk dirawat. Sedangkan bus penumpang diamankan ke Poslantas Sei Jenggi. Korban, Abu Kosim, mahasiswa semesterVIII, Unimed yang

mengalami luka lecet dan terkilir kaki mengatakan, saat itu dia duduk di bangku nomor empat di belakang sopir yang sebelum peristiwabusmelajukencangdan kehilangan kendali hingga akhirnya terbalik,”Akibatnya, kaki saya terkilir dan luka-luka. Saya terpaksaabsenkuliah,”terangnya. KasatlantasPolresSergai,AKP Hasan Basri ketika dihubungi Waspada membenarkan peristiwa terbaliknya bus CV. Pinang Indah dengan korban luka-luka ringan dan perkaranya telah ditangani. (c03)

Rp50 Juta Gaji THL Dinas PU Lenyap Dari Bagasi Sepedamotor

Waspada/Feirizal Purba

DANDIM 0204/DS Letkol Arh.Wawik Dwinanto (tengah) bersama guru dan Kasek SMAN 1 Sunggal, Deliserdang serta siswa berprestasi.

Dandim 0204/DS Kunjungi SMAN 1 Sunggal SUNGGAL (Waspada): Dandim 0204/Deliserdang Letkol Arh. WawikDwinanto,S.Sos,MSimengunjungiSMAN1Sunggal,Deliserdang sekaligus sebagai pembina upacara bendera, Senin (2/4). Upacara tersebut dihadiri Kasek SMAN 1 Sunggal Drs. Ramli Siregar, Camat Sunggal Drs. Sariguna Tanjung, MSi, Danramil Kapten Inf. Imam Karmani, KCD Drs. Agus Salim, para guru dan siswa peserta upacara. Dalam kesempatan itu Dandim bersama Kasek mengalungkan medali emas dan perak kepada siswa Kelas X Saadilah Mursyid yang menjuarai kejuaraan karate antar pelajar SMA yang diselenggarakan Universitas Medan Area. Dandim dalam amanatnya antara lain mengemukakan, upacara iniwujudtanggungjawabKodim0204membantuPemda.Diantaranya membangun karakter bangsa di lingkungan sekolah. “Saat ini banyak anak sekolah yang tidak malu apabila berbuat kesalahan, bahkan menganggap remeh teguran guru. Dulu, murid sangathormatpadaguru,jangankanmelakukankesalahan,berpapasan saja sangat segan,’’kata Wawik Dwinanto. Sebab itu, tambahnya, Operasi Militer Selain Perang (OMSP) diwujudkan dalam pembinaan teritorial terhadap semua instansi dan elemen masyarakat, yang salah satunya bidang pendidikan. Sedangkan Kasek Ramli Siregar dalam sambutannya mengemukakan, kehadiran Dandim 0204 Deliserdang sebagai unsur Muspida di SMAN 1 Sunggal bermakna khusus bagi peserta didik. Camat Sunggal Sariguna Tanjung dalam kesempatan ramahtamah menyampaikan, kedatangan Dandim ini memberi motivasi kepada peserta didik dan guru-guru SMAN 1 Sunggal.(m34)

Kejari Stabat Didemo STABAT (Waspada): Puluhan pemuda tergabung dalam LSM Indonesian Coruption Watch (ICW) Langkat bersama beberapa mahasiswa berunjukrasa di Gedung Kejari Stabat, meminta perkara dugaan korupsi dituntaskan, Selasa (3/4). Massa mengkritik kasus dugaankorupsipenghitunganpajakPNSPPhPasal21yangmelibatkan Sekda Langkat sebagai tersangka sudah bertahun, namun hingga kinibelumditahanbahkanberkasnyabelumdilimpahkankepengadilan. “Kami minta penyidik transparan dan ada kepastian hukum,” kata Dimas saat berorasi di halaman Kejari Stabat. Aspirasi massa diterima Kajari Stabat Asep Nana Mulyana yang baru beberapa pekan bertugas di Langkat. Kajari mengatakan, untuk kasus yang dituntut dalam proses penyidikan.“Ada keterangan dari saksi ahli di Jakarta yang diperlukan untukkelanjutanperkaraini.Anggotasayasedangmenindaklanjutinya, mudah-mudahan dalam sepekan atau dua pekan mendatang sudah ada kesimpulan,” kata Asep. Setelah berorasi di Kejari, massa kemudian berunjuksa mempertanyakanhalserupadiGedungDPRDLangkat.CatatanWaspada, selainkasusdugaankorupsiyangmelibatkanSekdamasihmengambang, adakasus-kasuslainyangjugabelumjelastindaklanjutnyasepertikasus penjualanbeberapalahanasetmilikPTPNIIKwalaBingaiyangkemudian bersertifikat pribadi, melibatkan dua tersangka yakni mantan Kepala BPN Langkat JH dan mantan karyawan PTPN II Kwala Bingai. Penyidikan kasus itu telah bergulir mulai 2010 dan hingga kini belum tuntas. Kedua tersangka juga belum ditahan dan perkaranya belum dilimpahkan ke pengadilan. (a03)

Muscab Partai Demokrat Perbaungan Dan Pegajahan PERBAUNGAN (Waspada): Musyawarah Cabang (Muscab) Pimpinan Anak Cabang (PAC) ke II Partai Demokrat (PD) Kec. Perbaungan dan Kec. Pegajahan, Kab. Serdang Bedagai periode 2010-2015 digelar di wisma Amerta Adolina, Kel. Batang Terap, Kec. Perbaungan, Sabtu (31/3). Musyawarah dihadiri Direktur Eksekutif DPD Partai Demokrat Sumut, Ir. Borkat Hasibuan, Ketua DPC PD Sergai, H. Azmi Yuli Sitorus, SH, Sekretaris, Labuhan Hasibuan, SAg, pengurus DPC PD Sergai, Hj. Susilawati, Ismedi Lubis,Wan Retno Manulang, anggota Fraksi Demokrat Sergai, Fery Haryanto, SH, Riady, pengurus PAC dan Ranting PD se Sergai serta undangan. Direktur Eksekutif DPD PD Sumut, Ir. Borkat Hasibuan dalam arahannya mengatakan Presiden yang merupakan Ketua Dewan PembinaDPPPartaiDemokratsedangdihujat,terkaitrencanakenaikan BBM, sehingga masyarakat serta mahasiswa melakukan demo, bahkan cenderung anarkis, ungkapnya. Sementara Ketua DPC Partai Demokrat Sergai, H. Azmi Yuli Sitorus, SH mengatakan para ketua bersama pengurus yang terpilih diharap segera berbuat dan melaksanakan program kerja, jangan sampai ada terjadi saling sikut-menyikut dalam melaksanakan kerja, buatlah kerjasama yang baik, sehingga masyarakat dapat memahami kerja Partai Demokrat ke depan, paparnya. Terpilih secara aklamasi dalam Muscab, Ketua PAC Partai Demokrat Perbaungan, Imran Rusiadi Nasution, SH dan Ketua PAC Pegajahan, Triono Sumantri, SP yang diharapkan pada Pemilu Legislatif mampu meraih tiga kursi di DPRD Sergai untuk kedua kecamatan.(c03)

TEBINGTINGGI (Waspada): Gaji pegawai Tenaga Harian Lepas (THL) di Dinas Pekerjaan Umum (PU) Kota Tebingtinggi sebesar Rp50 juta lenyap seketika dari bagasi sepedamotor milik bendaharawanDinasPUtersebut. Peristiwa mengejutkan itu terjadi seusai bendaharawan Dinas PU itu pengambil uang dari Bank Sumut,CabangTebingtinggi,Jalan Sutomo, Senin (2/4) sore sekira pukul 15:00. Kejadianitulangsungdilaporkan Heri Aryanto, 40, bendahara Dinas PU ke Polres Tebingtinggi. Dalam laporannya kepada petugas SPK Polres, Heri Aryanto, didampingi Kasubag Keuangan Dinas PU dan staf Rudi menjelaskan, uang Rp50 juta itu untuk membayar gaji honor 24 orang THL di PU. Saat itu ia baru saja mengambil uang dari teller Bank Sumut, lalu keluar dari pintu belakang, karena sore itu bank sudah mau tutup. Sampai di luar tempat parker, ia memasukkan uang yang

dibungkus dalam plastik hitam itu ke dalam bagasi sepedamotor Yamaha Shogun miliknya. Beberapasaatsebelumberangkat ia memasang jeket hitam dari sepedamotornya.“Sayatidaktahu apakah bagasi sepedamotor tersebut saat itu terkunci atau tidak,” ucapnya. Selesai memakai jaket, iapun berangkat seorang diri dengan sepedamotornya langsung menuju kantor Dinas PU Jalan Gunung Lauser BP 7. Sampai di kantor, ketika membuka bagasi sepedamotornya, uang yang disimpan di dalamnya sudah lenyap. “Saya tidak tahu dimana hilangnya, namun kemungkinan terjadi saat saya memakai jaket di tempat parkir kenderaan di Bank Sumut,” tuturnya kepada petugas. Heri mengaku sering mengambiluangmilikdinasPUkebank, terkadang ditemani teman sekantor, dan terkadang langsung ditemani Kadis PU bila uangnya dalam jumlah yang lebih besar.

KasubagKeuanganDinasPU didampingi staf Rudi, yang turut mendampingi bendahara membuat laporan pengaduan itu mengatakan,pembayaran gaji THL itu bersumber dari APBD sebesar Rp600.000 per orang. “Kalau pegawai PNS masing-masing mengambil gajinya langsung ke bank, sedangkan untuk THL diambilkan oleh Bendahara Dinas,” ucapnya. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi,SIk ketika dikonfirmasi melalui Kasubag Humas AKP Ngemat Surbakti, Selasa(3/4) mengatakankasusini masih dalam penyelidikan. BendaharawanPUitukinitengah dimintai keterangan petugas Reskrim. “Nanti setelah diselidiki akan diketahui kebenaran dan sebabsebab hilangnya uang dalam bagasi sepedamotor tersebut. Biasanya setiap sudut ruangan bank ada kamera CCTV, nanti akan terlihat,” jelasnya. (a11)

Bangunan Pagar Di Lahan Sengketa Resahkan Warga PERBAUNGAN (Waspada): Bangunan pagar setinggi dua meter lebih yang dibangun AM warga Medan yang mengklaim sebagai pemilik tanah di atas lahan sekitar 3,5 hektar, meresahkan sekitar 22 kepala keluarga (KK) warga Kel. Tualang, Kec. Perbaungan, Kab. Serdang Bedagai yang mengaku telah menduduki tanah tersebut turun temurun sejak 1924. Salah seorang warga, Dra. Maryam SPdI, 54, mengatakan dia telah menguasai tanah warisan turun temurun dari ibunya Surip (almh) yang lahir tahun 1935. “Namun 24 Juli 2011 datang AM bersama WJ warga Lubuk Pakam, serta dua orang lainnya mengklaim keseluruhan tanah itu miliknya,” papar Maryam. Menurut Maryam, 24 Februari 2012 AM tiba-tiba memagar bagian depan tanahnya, termasuk tanah milik warga lainnya sebagai upaya menguasai lahan tersebut. Perbuatan AM ini dilaporkan ke pihak Polres Sergai, no: STPL/C5/II/2012/Sergai. Ironisnya lagi dialami Seniwaty, 57, pemilik lahan sekitar 4 rante (1600 M2) yang digantirugi dari Jaya Rohanum tahun 1998, hingga terbit Surat Keterangan No. 77/470/TL/2004, tanggal 11 Maret 2004 dikeluarkan Lurah Tualang Suyatno (alm). Atas hak tersebut AM mempidanakannya dengantuduhanpemalsuansurat dan penyerobotan tanah ke PN

Lubuk Pakam, 11 April 2007. “Putusan PN Lubuk Pakam saya dinyatakan bersalah dan dipidana kurungan satu tahun tiga bulan, kemudian banding ke Pengadilan Tinggi (PT) Medan, putusannya semakin berat denganpidanapenjaraduatahun, hingga akhirnya kasasi ke Mahkamah Agung (MA) dengan putusanno:522K/Pid/2008,sayadibebaskandarisegaladakwaan,”kenang Seniwaty yang sempat menjalani kurungan selama tiga bulan. Hinggasaatini,lanjutSeniwaty, AM tetap terus memperkarakan Perdata atas objek tanah itu kembali ke PN Lubuk Pakam. “Saya tetap bertahan, siapa sebenarnya pemilik sah,” tegasnya. Sementara pemegang kuasa warga, M. Syahril Matondang yang juga Ketua Himpunan MasyarakatAdat(Himasdat)Kab. Sergai, mengharapkan Polres dan Pemkab Sergai jangan berpihak, tentu dengan mempelajari faktafakta yang ada baik dari masyarakat maupun dari pihak AM. Dia menilai banyak kerancuan atas alas hak atau dokumen milik AM. “Anehnya pihak KPT Sergai mengeluarkan Surat izin Mendirikan Bangunan (SIMB) pendirian tembok kepada pihak AM, padahal jelas-jelas lokasi masih dalam sengketa. Di sini terbukti, Pemkab Sergai berpihak,” tegasnya Syahril. Sedangkan Amrick ketika dihubungi menerangkan, luas

tanah keseluruhan sekitar 10 hektar, atas dua kepemilikan yang dibelinya dari T. Ataillah tahun 1985 yang sudah disertifikatkan di BPN atas nama dirinya, dan sebagian lagi lahan dibeli dari Ali Susanto. “Saat itu di atas lahan hanya ada 8 penggarap dan bangunan guguk, serta rumah-rumah darurat yang mengelola lahan dengan cara sewa yang pembayarannya dengan padi kepada T. Ataillah. Setelah berpindah tangan sempat membayar sewa kepada saya,” ungkap Amrick. Kakan KPT Kab. Sergai, Hendrik Suharto ketika dikonfirmasi Waspada tidak berada di kantor, saat dihubungi melalui telepon selulernya tidak menjawab. Sebelumnya Kakan BPN Sergai, Dani Sudiarta, ST melalui Kasubsi Perkara Pertanahan, Sofyan Hadi Syam, SH ketika dihubungi menerangkan pihak BPN SergaibelummengeluarkanSertifikat di lahan bersengketa, walau pun kedua belah pihak telah mengajukan usulan ke BPN Sergai. Sedangkan Kasat Reskrim Polres Sergai, AKP Danny Boy Panggabean melalui KBO, Iptu E Panjaitan membenarkan pengaduan Maryam terhadap Amrick atas pemasangan pagar, namun sebaliknya Amrick juga mengadukan Maryam, sehingga kedua belah pihak saling mengadukan.Keduakasustengahdiproses, terangnya.(c03)

Waspada/Edi Saputra

BUS CV. Pinang Indah, BK 7218 LY yang terbalik di Jalinsum Km 43-44, Dusun II, Desa Pasar Bengkel, Kec. Perbaungan, Kab. Segai.

Limbah PT ACA Cemari Lingkungan PATUMBAK(Waspada):Pembuanganlimbah asap PT Alfo Citra Abadi (ACA) di Jalan Pembangunan, Dusun X, Desa Marindal I, Patumbak, Deliserdang mencemari lingkungan dan meresahkan warga sekitar. Menurut masyarakat kepada Waspada, Senin (2/4) sore, pembuangan limbah asap batubara melalui corong menimbulkan bau menyengat bercampur debu sehingga menyebabkan gangguan pernafasan dan batuk-batuk. “Pembuanganlimbahasapbatubarainisudah berlangsungbertahun-tahunlaludansudahbanyak warga yang mengalami gangguan pernapasan akibat setiap hari menghirup udara kotor dari PT Alfo Citra Abadi,” ujar Awaluddin, warga sekitar. Hal senada dikatakan Kusnadi. Selain itu, air di sekitar pemukiman juga tercemar. “Beberapa waktu lalu warga sudah melaporkan pencemaran yang dilakukan PT Alfo Citra Abadi ke Bapedalda yang langsung ditanggapi dengan menurunkan tim guna mengambil sample air. Namun hingga kini tidak ada lagi tindak lanjut dari Bapedalda,” kata mereka.

Masyarakat berharap, dalam waktu dekat pihak PT Alfo Citra Abadi memperbaiki mesin pembuangan limbah asap dan instalasi terkait lainnya dalam waktu sebulan. “Jika dalam waktu sebulan masih juga mencemari lingkungan, warga akan mengambil tindakan sendiri dengan menahan mobil bahan baku yang masuk dan memblokir akses jalan masuk ke PT Alfo Citra Abadi. Selain itu, warga juga akan mengadukan masalah ini ke DPRD Deliserdang dan instansi terkait, serta melakukan upaya hukum,” tegas Reksa Karo-karo dan Iswanto, juga warga sekitar. Humas PT Alfo Citra Abadi Junhendrik mengaku, tidak dapat menjamin kapan limbah asap yang mencemari lingkungan sekitar dapat diatasi. “Namun, begitu pun keluhan warga akan disampaikan kepada atasan,” sebutnya. Terpisah, Camat Khairul Saleh Siregar mengatakan, akan segera menyurati Bapedalda Deliserdang agar segera menurunkan tim guna meninjau pencemaran lingkungan yang berasal dari pembuangan limbah PT Alfo Citra Abadi.(c02)

Polres T. Tinggi Periksa Kadishub TEBINGTINGGI (Waspada): Kepala Dinas Perhubungan (Kadishub) Kota Tebingtinggi DjR, BE, Senin (2/4), diperiksa Satuan Tindak Pidana Korupsi (Tipikor) PolresTebingtinggi. Pemeriksaan itu terkait dugaan korupsi sejumlah proyek di dinas bersangkutan pada tahun anggaran 2011, di antaranya pembangunan gedung pengujian kendaraan bermotor. Informasi diperolehWaspada, pemeriksaan dilakukanterkaitsejumlahtemuanpenyimpangan pembangunan ruangan PKB, pengerasan jalan ke gedung PKB dan perluasan ruang Kadishub. “Dari pemeriksaan inspektorat, kerugian negara untuk tiga proyek itu Rp161,604 juta,” ujar sumber internal di Dishub. Ketiga proyek dari APBD TA 2011 itu, masingmasing pembangunan ruangan PKB senilai Rp382,735 juta, dikerjakan CV NE Medan, pengerasan jalan gedung PKB senilai Rp350 juta olehCVCK,MedandanperluasanruangKadishub

Rp149,800 juta dikerjakan CV BK Medan. Selain itu, muncul pula isu dugaan penyimpangan pada proyek perawatan traffic light senilai Rp98 juta dilaksanakan CV CT. KapolresTebingtinggiAKBPAndiRianRDjajadi SIK, melalui Kasubbag Humas, AKP Ngemat Surbakti, saat dikonfirmasi wartawan, membenarkan pemanggilan Kadishub DjR, BE. “Memang betul kita ada melakukan pemanggilan untuk dimintai keterangannya sebagai saksi,” ujar Ngemat Surbakti. Namun, status yang bersangkutan masih sebagai saksi. Sedangkan Kadishub DjR, BE membenarkan dia dipanggil pihakTipikor Polres KotaTebingtinggi untuk dimintai keterangan terkait adanya dugaan kasus korupsi di dinas yang dipimpinnya. “Memang betul saya dipanggil pihak Tipikor untuk dimintai keterangan terkait dugaan kasus korupsi dimulai jam 10:00 hingga pukul 13:00,” terangnya kepada wartawan. (a09)

Bupati Sergai:

Analisa Jabatan Dan Beban Kerja Menentukan Kebutuhan PNS SEI RAMPAH (Waspada): Penyusunan analisa jabatan dan analisis beban kerja merupakan tolak ukur menentukan jumlah kebutuhan pegawai negeri sipil (PNS) untuk lima tahun ke depan, termasuk penataan organisasi (rightsizing) dan PNS dalam kerangka pelaksanaan reformasi birokrasi. Hal ini diungkapkan Bupati Serdang Bedagai Ir. HT. Erry Nuradi, M.Si dalam sambutan dibacakan Sekdakab Sergai Drs. H. Haris Fadillah, M.Si sekaligus membuka acara Sosialisasi Analisis Jabatan, Analisis Beban Kerja dan Evaluasi Jabatan di lingkungan Pemkab Serdang Bedagai Tahun 2012diaulaSultanSerdang,komplekkantorBupati Sergai, Sei Rampah, baru-baru ini. Hadir Asisten Pemerintahan Umum H. Rapotan Siregar SH, M.AP, staf Ahli Bupati bidang Kemasyarakatan dan SDM Drs. Mangadar Marpaung, M.AP, narasumber dari Pusat Pendidikan dan Pelatihan BKN RegionalVI Medan Drs. Subekti Agus Irianto dan Kusen Kusdiana,

SIP, SH, Kepala SKPD dan camat se-Sergai dan peserta sosialisasi diikuti 55 pejabat eselon IV dari SKPD terkait. Lebih lanjut disampaikan, dengan keluarnya Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi No: 26 Tahun 2011 tentang Pedoman Perhitungan Jumlah Kebutuhan Pegawai Negeri Sipil Untuk Daerah, diharapkan kepada pemerintah daerah harus terlebih dahulu menghitung jumlah kebutuhan PNS berdasarkan analisis jabatan dan analisis beban kerja sehingga dapat diproyeksikan kebutuhanPNSselamalimatahunkedepan,sesuai kemampuan keuangan daerah. SebelumnyaKetuaPanitiaDra.IndahDwiKumala melaporkan,sosialisasiinidilaksanakanuntukmemberi pengetahuan dan pemahaman kepada seluruh peserta, agar dapat menyusun serta melaksanakan perhitungan kebutuhan PNS selama 5 (lima) tahun ke depan, termasuk pengadaan PNS tahun 2012 sampai tahun 2016.(a08)

Dua Rumah Rubuh, Pemkab Langkat Lapor Kemenpera

Waspada/Edi Saputra

KETUA Himasdat Sergai, M. Syahril Matondang (paling kanan) bersama sebagian warga Lk.VI, Kel. Tualang, Kec. Perbaungan menunjukkan bangunan pagar di atas tanah sengketa.

LANGKAT (Waspada): Pemkab Langkat telah melaporkan insiden rubuhnya dua bangunan rumah permanen untuk masyarakat nelayan di Kel. Sei Bilah Kec. Sei Lepan, kepada Kementerian Perumahan Rakyat (Kemenpera). “Kita sudah laporkan dan pihak Kemenpera telah menyatakan akan membangun kembali rumah yang rubuh sekaligus menegur kontraktor,” kata Kabag Perekonomian, Basrah Pardomuan yang dihubungi via telpon seluler, Minggu (1/4). Bupati Langkat, Ngogesa Sitepu, katanya, memberi perhatian penuh terhadap rubuhnya bangunan perumahan dengan melakukan komunikasi secara intens kepada Kemenpera. Bagaimana pun, program peningkatan kualitas kehidupan nelayan menjadi perhatian bupati, ujarnya. Ia menjelaskan, Pemkab Langkat melalui upaya yang dilakukan bupati berhasil meyakinkan

Kemenpera untuk melaksanakan program pembangunan rumah dengan mekanisme usulan yang dipersiapkan bagian Perekonomian, termasukpenyediaanlahan”Dalamhalpenyediaan anggaran maupun penentuan rekanan yang dilakukan melalui proses tender, hal itu sepenuhnya kewenangan dari Kemenpera,” tukas Basrah. Jika terjadi sesuatu hal termasuk terkait masalah kualitas pembangunan, kata Basrah, Pemkab Langkat melalui Dinas Pekerjaan Umum (PU) selaku salah satu tim pengawas memiliki kewenangan untuk memberikan saran masukan guna perbaikan. Kabag Perekonomian menegaskan, Kemenpera telah menginstruksikan kepada kontraktor agar mereview ulang kekuatan seluruhbangunan,termasukmembangunkembali yang rubuh sehingga tidak ada kecemasan masyarakat menempati rumah tersebut.(a02/a01)

Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasaa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Sekdakab L.Batu Ingatkan Masyarakat Hati-hati Calo CPNS RANTAUPRAPAT (Waspada): Plt Sekdakab Labuhanbatu H. Ali Usman Harahap, SH mengingatkan seluruh lapisan masyarakat, khususnya para tenaga honorer, untuk berhati-hati terhadap calo Calon Pegawai Negeri Sipil (CPNS) yang akan diangkat pada Kategori II tahun ini. Ali Usman mengingatkan itu pada rapat Sosialisasi Verifikasi Tenaga Honorer Kategori II di Ruang Data dan Karya Kantor Bupati, Selasa (3/4) yang dihadiri para Kepala Sub Bagian Kepegawaian SKPD, Kepala SKPD, para camat dan Kepala Bagian Setdakab L.Batu. Dia menambahkan, biasanya modus yang dilakukan para calo itu adalah dengan menjanjikan mampu meloloskan jadi CPNS dengan mencatut beberapa nama pejabat Pemkab L.Batu. “Urusan kelulusan danhasilseleksitenaga honorer Kategori II ini merupakan kewenangan penuh Kementerian Pemberdayaan Aparatur Negara dan Reformasi Birokrasi,sementaraPemkabL.Batu sebatasmemberikandata,”jelasnya. AliUsmanjugamenjelaskan,penyelesaianmasalahtenagahonorer harus dilakukan dengan cermat agar permasalahan tenaga honorer tidak berlarut-larut. “Oleh sebab itu jangan ada yang coba-coba melakukan manipulasi data, karena dampak hukumnya sangat berat baik kepada CPNS sendiri maupun kepada pejabat yang menandatangani data tersebut,” ungkapnya. Asisten Administrasi Umum yang juga Pembina PNS Pemkab L.Batu Ahmad Muflih, SH menuturkan, hasil verifikasi terbaru tenaga honorer kategori II yang dilansir di berbagai website belum bisa dipastikan kebenarannya. “Kita masih terus melakukan koordinasi dengan Kementerian Menpan dan BAKN untuk memastikan hasil akhir dari data yang kita kirim,” kata Muflih. Terkait dugaan adanya oknum yang mencoba memancing di air keruh dengan dilakukan verifikasi CPNS ini, Ahmad Muflih mengatakan, jangan coba-coba melakukan, karena Pemkab L.Batu tidak akan bertanggungjawab terhadap atas hal itu. (a18/c07)

WASPADA Rabu 4 April 2012

Pembangunan Rel KA

Sembilan Rumah Ibadah Terancam Kena Gusur LIMAPULUH (Waspada): Sebanyak sembilan rumah ibadah terdiri dua masjid, dan tujuh gereja di sepanjang jalan Simpang Inalum-Pabrik Peleburan PT Inalum Kuala Tanjung terancam digusur akibat terkena lintasan/sentuhan rel kereta api (KA) yang akan dibangun pemerintah. Sembilan pengurus rumah ibadah tersebut telah menyampaikan keluhan kepada Forum Kerukunan Umat Beragama (FKUB) Kab. Batubara. “Untuk menjaga kerukunan umat beragama, kami sudah turun ke lapangan melakukan verifikasi sehubungankeluhanjemaahdan jamaat di sana, Maret lalu,” kata Tauhid, S.Ag Ketua FKUB Batubara, Selasa (3/4). Berdasarkan hasil verifikasi, menurut Tauhid tercatat ada sembilan rumah ibadah yaitu

Masjid Almanar Kuala Tanjung, Musholla Al Hikma Desa Lalang, gereja HKI Brohol/gereja Katolik/ gereja GKII/gereja GPI Desa Pakam Raya Selatan, gereja GMI Desa Pakam Raya, dan gereja GKLI/gereja GPDI Marantha, di Kuala Tanjung terkena lintasan/ sentuhan rel KA yang akan dibangun pemerintah Bahkan Masjid Almanar termasuk dalam lokasi pembangunan rel KA. Menindaklanjuti aspirasi umat yang rumah ibadahnya kena lintasan KA, pihak FKUB

Batubara ditandatanganiTauhid, S.Ag (Ketua), H. Dainuri (Sekretaris) mengirimkan surat kepada Bupati Batubara 2 April lalu, tentanghasilverifikasidilapangan tembusan surat ke DPRD Batubara, Ka. Kemenag Batubara, Bappeda, Otorita Asahan, Camat Medangderas,CamatSei.Suka,Ka. KUASeiSuka,KUAMedangderas, BKAG Batubara, FKUB Sumut. Verifikasi dilakukan berdasarkan peraturan bersama Menteri Agama dan Menteri Dalam Negeri No.9 dan No.8 Tahun 2006 dan peraturan Bupati Batubara No.15 Tahun 2011, peraturan Gubsu No.13 Tahun 2011.Karenaitudiharapkanpihak Pemerintah Pusat dan Pemkab Batubara diupayakan mencari solusiuntukpemindahantempat/ lokasi rumah ibadah tersebut.(a12)

DPRD Desak Pemko Tinjau Ulang Swalayan Indomaret TANJUNGBALAI (Waspada): KomisiBDPRDKotaTanjungbalai meminta agar Pemerintah Kota meninjau ulang keberadaan swalayan Indomaret, karena menjual makanan tanpa label halal. “Kami mendesak agar keberadaan swalayan Indomaret dan sejumlah toko ditinjau ulang. Sebab keberadaannya telah meresahkan masyarakat terutama terhadap temuan makanan impor tanpa label halal,” ujar Ketua Komisi B, H. Hamdayani didampingi anggota H. Ridwan kepada Waspada, Senin (2/4). Dikatakan Hamdayani, hak para konsumen harus dilindungi apalagimayoritaspendudukKota Tanjungbalai beragama Islam. Diterangkan komisi yang menangani bidang perdagangan itu, pihaknya belum mengetahui darimana masuknya produk imporitusebabT.Balaitidakmemiliki izin untuk mengimpor makanan dari luar negari. “Kita akan coba telusuri dari mana produk luar

negeri itu masuk,” pungkas Hamdayani. Di tempat terpisah, salah seorang sumber menyebut, swalayan Indomaret kini bak cendawan di musim hujan, menjamur di Kota Tanjungbalai. Umumnya, swalayan itu menyewa bangunan milik masyarakat dan mengalihfungsikannya menjadi sebentuk supermarket. Akibatnya, pedagang tradisional merasa dirugikan karena masyarakat lebih memilih berbelanjadiIndomaretdaripadapasar, toko apalagi warung. Menyikapi informasi masyarakat itu, Hamdayani menegaskan dalam waktu dekat akan melakukansidakkeswalayandan toko-toko termasuk Indomaret bersama dengan Majelis Ulama Indonesia (MUI) T.Balai, juga menyertakan Kabag Hukum dan Dinas Perindustrian dan Perdagangan (Disperindag). “Kita akan susun dulu agendanya dan mudah-mudahan dalam waktu

dekat akan terlaksana,” tegas Hamdayani. Di tempat terpisah, Ketua Majelis Ulama Indonesia (MUI) T.Balai melalui anggota Ust. Syahron Sirait menegaskan, seharusnya semua makanan dan minuman baik produk dalam negeri maupun impor harus mencantumkan label halal. Hal itu dimaksudkan guna melindungi hak konsumen terutama yang beragama Islam. “Saya akan sampaikan dulu kepada ketua untuk dimusyawarahkan,danjikamemangdiperlukan, kami akan turun langsung meninjau dan mengawasi produk tersebut,” kata Syahron. Sebelumnya, dua warga Kota Tanjungbalai menemukan sejumlah produk tanpa mencantumkan label halal di sejumlah swalayan dan toko. Di antara produktersebutumumnyaterdiri dari makanan dan minuman impor kendati sebagian kecilnya ada juga produk kosmetik. (a32)

MUI Teluknibung Siap Bantu Polres Tegakkan Hukum TANJUNGBALAI (Waspada): Majelis Ulama Indonesia (MUI) Kec. Teluknibung, Kota Tanjungbalai siap menjadi mitra Kepolisian Resort Tanjungbalai untuk menegakkan hukum dalam hal Amar Ma’ruf Nahi Munkar. Demikian ditegaskan Ketua MUI Kec. Teluknibung, Ustadz TaufikAzhardalamsambutannya pada malam peringatan Maulid Nabi Muhammad SAW 1433 H, di Masjid Islamiyah, Kel. Kapias Pulau Buaya, Kec. Teluknibung, baru-baru ini. Menurut Ust. Taufik, saat ini kejahatan yang paling mudah dijumpai di Kota Tanjungbalai, terutama di Teluknibung, adalah kenakalan remaja seperti menghirup lem kambing hingga kencanduan. Selain itu, adanya perbuatan amoral pasangan pria dan wanita, serta peredaran dan penyalahgunaan narkoba yang

Waspada/Rasudin Sihotang

Wakapolres Tanjungbalai Kompol Junaidy juga mendominasi. “MUI Teluknibung siap berada di garda terdepan guna memerangi kejahatan bersama dengan Kepolisian demi me-

nyelamatkanwargaTanjungbalai, terutama generasi penerus bangsa,” tegas Ustadz Taufik. Wakapolres Tanjungbalai Kompol Junaidy yang turut hadir dalam acara itu mengucapkan rasa terima kasihnya kepada MUI Kec. Teluknibung, atas komitmennya membantu Kepolisian. Dalam kesempatan tersebut dia berharap kepada seluruh komponen masyarakat tetap bekerjasama menjaga kondusifitas Kota Kerang itu. “Kami berkomitmen menindak setiap kejahatan seperti judi, narkoba, prostitusi dan segala sesuatu yang memicu konflik antar umat beragama tanpa pandang bulu, baik masyarakat biasa maupun oknum Kepolisian,” pungkas Wakapolres, sembari menambahkan tugas Polisi tak akan efektif tanpa bantuan masyarakat. (a32)

Medangderas Juara Umum MTQN Batubara Airputih Dan Seisuka Juara FSN INDRAPURA (Waspada): Kec. Medangderas berhasil menjadi juara umum MTQN tingkat Kab. Batubara ke 5 berlangsung di lapangan Indrasakti Indrapura Kec. Airputih yang berakhir, Senin (2/4) malam. Sedangkan Kec. Airputih berhasil menjuarai Festival Seni Nasyid (FSN) golongan putri dan Kec. Seisuka juara putra. Pengumuman juara MTQN/ FSN Batubara itu dilangsungkan pada acara penutupan Senin malam, yang disampaikan Ketua Koordinator Dewan Hakim/Juri Drs. M. Noordin yang juga KTU Kantor Kemenag Batubara didampingiSekretarisDrs.Lahuddin Hasibuan Zulhasmi Zein, SPd. MTQN/FSN ditutup resmi Bupati Batubara diwakili SekdakabT. Erwin, SE.Turut hadir Ketua DPRD Batubara Selamat Arifin, SE, MSi, Kepala Kemenag Batubara Drs. H. Sainik BR, Ketua PanitiaDrs.TMSyafii,MPd,Ketua MUI Batubara Ghazali, LC. Hasil di beberapa nomor, Juara I, II, III dan harapan masingmasing, Tartil putra Farhan Ilham Ahmadi (Medangderas), AhmadTantowiSiagian(Seibalai), Mukhlis Ainan (Tanjungtiram) dan Sultan Farhan Zein (Seisuka). Putri, Khoirotus Silmi (Limapuluh), Ernifah (Tanjungtiram)Dina Khairani (Medangderas), Tiara Kami (Seibalai). Tilawah anakanak putra, Alfin Qodri Hafiz

(Limapuluh), Habib Alwi (Tanjungtiram), Ilham Fikri (Talawi) dan Huda Pratama (Seibalai). Putri, PitriHumairaAhmadi(Medangderas), Rafiah Aini Samosir (Limapuluh), Nuraini (Talawi) dan Annisa Putri (Seisuka). Remaja putra, Qurrata A’yunin (Tanjungtiram), Ashari (Seibalai), Rizki Akbar Sinaga (Limapuluh) dan Mhd Hafiz (Medangderas). Putri, Fahrun Nisa (Airputih), Desi Arum Sari

(Medangderas), Ade Galuh Alqorina (Seisuka) dan Khairul Bariah (Talawi). Dewasa putra, Badrus Samak (Limapuluh), Fadli (Medangderas), Samsul Bahri AMK (Seibalai) dan Nurman Syafrizal (Airputih). Putri, Latifah Sudarmi (Seibalai), Zainab (Tanjungtiram), Rahmayani (Talawi) dan Alfi Sahrina (Airputih). Cacat netra putri, Khoirun Nisa (Medangderas), dan Eka Sri Handayani (Airputih). (c04)

Waspada/Sahril

SEKDAKAB Batubara T. Erwin, SE menyerahkan piala juara umum kepada Camat Medangderas Ramlis, SH.

Waspada/Sapriadi

SEJUMLAH anak usai sekolah terlihat sedang bekerja di atas sampan yang bersandar di pajak penjualan ikan Kec. Medang Deras, Kab. Batubara.

Fenomena Daerah Perbatasan Kian Tertinggal KISARAN (Waspada): Fenomena daerah perbatasan selalu tertinggal dalam pembangunan selalu menjadi masalah. Akibatnya, masyarakat terpaksa bertahan dengan keterbatasan meskipun nasib mereka kurang diperhatikan pemerintah. Hal itu terungkap hasil pantauan Waspada di daerah perbatasan Kab. Batubara-Serdang Begadai. Kondisinya kian memprihatinkan, padahal wilayah itu mempunyai potensi untuk menambah APBD. Contoh yang paling mendasar Kec. MedangderaswilayahterujungdiKab.Batubaraberbatasan dengan Kab. Serdang Bedagai. Dilihat geografis wilayah itu mempunyai dua potensi yang cukup menghasilkan yaitu sektor pertanian dan laut. Namun kenyataannya wilayah itu tetap tertinggal. “Untuk wilayah pertanian di Desa Sidomulyo ada ribuan hektar, namun hingga saat ini irigasi tidak menyentuh ke wilayah kami, sedangkan jalur transportasi rusak, sehingga untuk mengangkut hasil panen agak kesulitan,” ujar Bakri, warga Desa Sidomulyo, Kec. Medangderas, Kab. Batubara, ditemui Waspada, Senin (2/4). Oleh sebab itu selama puluhan tahun sawah di Desa Sidomulyo tetap menggunakan sistem

tadah hujan. Kata Bakri, akibatnya musim tanam hanya dilakukan setahun sekali. Tapi terkadang petanidiwilayahituharusmengambilresikountuk “balik damen” (menanam dua kali) bila stok air menggenangi sawah, karena cuaca ekstrim (curah hujan tidak menentu). Berbeda dengan wilayah pesisir, tepatnya di Kelurahan Pangkalan Dodek, masih banyak masyarakatyangtinggaldibantaransungai.Wilayah itu tergolong kumuh, dan yang lebih menyayat hati banyak anak putus sekolah dan bekerja. “Kita akui banyak anak yang putus sekolah, disebabkan minimnya kesadaran masyarakat untuk pentingnya pendidikan dengan mengutamakan kebutuhan materi. Sehingga bila kita berjalan ke pajak penjualan ikan, maka akan kita temukan banyak anak usia sekolah yang bekerja. Bahkan ada juga yang ikut menjadi nelayan,” ujar M Soleh, warga Kelurahan Pangkalan Dodek. Fenomena ini adalah gambaran masyarakat dalam kegagalan orangtua yang dalam memberikanpendidikanyangdidasarikurangperhatiannya pemerintah kepada masyarakat. Akibatnya fenomena ini terus berlanjut dari generasi ke generasi. (a15)

Tiang Listrik Tumbang LIMAPULUH (Waspada): Akibat sambaran petir yang menggelegar di Limapuluh, Selasa (3/ 4) sekira pukul 13:00, tiang PLN di Jalinsum Limapuluh - Kisaran tumbang dan memacetkan jalan hingga belasan kilometer. Pantauan Waspada di lokasi kejadian, Simpang Marto, tepatnya di Desa Sumber Padi, Kec. Limapuluh, Kab. Batubara, tiang listrik yang patah pada pangkalnya, mencapai badan jalan dan materialnya berserakan di jalan. Pengguna jalan yang melihat kabel listrik

berseliweran di jalan tak berani melintas, khawatir jika kabel itu masih bertegangan listrik. Lebih - lebih ujung tiang menghalangi jalan. Puluhan kenderaan yang datang dari arah Medan menuju Kisaran dan sebaliknya praktis tak dapat bergerak. Akibatnya antrean kenderaan mencapai belasan kilometer. Hingga petugas kepolisian lalu lintas mengatur kenderaan dan petugas PLN mematikan listrik. Sekitar pukul 15:00 kemacetan baru terurai. (c05)

Waspada/Agusdiansyah Hasibuan

PETUGAS PLN melucuti material tiang listrik yang tumbang akibat disambar petir di Jalinsum Limapuluh - Kisaran.

Bocah Korban Pencabulan Dirawat KISARAN (Waspada): Seorang putri berumur delapan tahun terpaksa dirawat medis, karena mengalami pendarahan akibat dicabuli oleh pria dewasa, Senin (2/4) siang. Informasi dihimpun Waspada, korban warga Kec. Simpang Empat, saat pulang sekolah sendirian, namun ada seorang pria menggunakan sepedamotor membawa paksa bocah tersebut ke kebun sawit kemudian menggauli layaknya suami istri, dan meninggalkannya begitu saja. Akibatnya, anak yang di bawah umur tersebut mengalamipendarahan,meskidiaberusahasendiri pulang ke rumah. Orangtuanya spontan terkejut sehingga

membawanya untuk menjalani perawatan medis. Sedangkan masalah itu telah dilaporkan ke pihak berwajib untuk mencari pelakunya. Kapolres Asahan AKBP Yustan Alpiani, dikonfirmasi Waspada melalui Kapolsek Simpangempat AKP Rudi Candra, Selasa (3/4) membenarkan laporan itu, dan hingga saat ini masih melakukan penyidikan untuk mencari tersangkanya. “Kita masih mendalami kasus ini dengan mengumpulkan keterangan korban yang kini masih dirawat medis. Polisi akan berusaha keras untuk mengungkap kasus ini, tentunya dengan bantuan masyarakat yang memberikan informasi,” ujar Rudi. (a15)

DPRD Labusel Diminta Serius Jalankan Tupoksi KOTAPINANG (Waspada): Anggota DPRD Kab. Labuhanbatu Selatan (Labusel) diminta serius dalammenjalankantugaspokokdanfungsisebagai perwakilanmasyarakatLabusel.JikaditubuhDPRD sendiri terjadi disharmonisasi, dikhawatirkan akan berdampak pada pembangunan di Labusel. Hal itu diungkap sejumlah tokoh masyarakat Labusel pada Rapat Dengar Pendapat (RDP) antara DPRD dengan tokoh masyarakat, Senin (2/4). RDP itu terkait mosi tidak percaya yang digulirkan 21 anggota DPRD untuk mengganti tiga pimpinan DPRD beberapa waktu lalu. Dalam RDP itu, salah seorang tokoh masyarakat, H. Alwi berharap kepada DPRD untuk menyelesaikan permasalahan internal secara arif dan bijaksana, sehingga permasalahan internal DPRD tidak berkembang menjadi permasalah eksternal. “Dalam tatanan hukum tidak ada sikap mosi tidak percaya. Permasalahan internal diselesaikan secara arif dan bijaksana sehingga tidak mencuat kemasyarakat. Dalam melakukan tugas dan fungsinya di antaranya hak interpelasi. Bila masyarakat disakiti dan lembaga ini tidak berfungsi, maka masyarakat secara otomatis melakukan menunjukan sikap,” kata Irwansyah, tokoh masyarakat lainnya. Menanggapi harapan tersebut, Wakil Ketua DPRD Labusel, Rahmadi, SE mengatakan, ketika

tiga pimpinan DPRD mencoba menyikapi permasalahan yang ada, terkait sikap mosi tidak percaya yang telah dilayangkan kepada sejumlah lembaga itu dengan melakukan rapat pimpinan, namun pelaksanaan rapat tidak pernah memenuhi qorum. “Secara internal telah dua kali kita mencoba menyelesaikan permasalahan ini, tapi tidak pernah memenuhi qorum,” kata Rahmadi. Oleh sebab itu, dia mengimbau kepada seluruh anggota DPRD untuk instropeksi diri, sehingga tugas dan fungsi yang diamanahkan masyarakat Labusel dapat dilaksanakan dengan baik. Jappar Sidik Nasution, anggota DPRD Labusel dari Partai Bulan Bintang (PBB) mengatakan, secara tegas bahwa surat mosi tidak percaya yang ditandatanganinya adalah asli dan benar adanya. Dia juga menjelaskan bahwa surat itu telah mereka layangkan ke tiga lembaga hingga ke Gubernur Sumut. “Surat itu asli dan sudah kita sampaikan ke sejumlah lembaga,” katanya. Oloan Sihotang dari PPRN mengatakan, penandatanganan surat mosi tidak percaya yang ia tandatangani dikarenakan adanya anggota DPRD menyodorkan padanya. Namun dia mengakui, dirinya menandatangani surat itu dengan harapan adanya perbaikan kinerja DPRD.“Kepada saya disodorkan dengan embel-embel di belakangnya demi perbaikan DPRD,” katanya. (c18)

Sumatera Utara

WASPADA Rabu 4 April 2012

B3

DBD Serang Gunungtua, Dua Bocah Terjangkit GUNUNGTUA (Waspada): Penyakit Demam Berdarah Dengue (DBD), menyerang warga Lingkungan IV Pasar Gunungtua, Kec. Padangbolak, Kab. Padanglawas Utara (Paluta). Dua dari empat warga yang menderita demam, dinyatakan positif terserang DBD. Demikianinformasidiperoleh Waspada dari Dinas Kesehatan Paluta, Selasa (3/4). Dua warga lingkungan IV Pasar Gunungtua dinyatakan positif terserang DBD yakniMursal,5,danIndahPratiwi (1 tahun 2 bulan). Pelaksana Tugas (Plt) Kepala Dinas Kesehatan Paluta Darwin

Harahap melalui Kabid Pengendalian Masalah Kesehatan (PMK) Dinkes Paluta dr. Arnalom Sitorus membenarkan dua bocah warga Lingkungan IV, Kelurahan Pasar Gunungtua, Kec. Padangbolak, dirawat karena menderita demam. “Memang ada dua bocah

mengalami demam dan panas tinggi. Kedua pasien itu dirujuk ke RSU Padangsidimpuan, dan baru-baru ini kami telah menjenguknya. Menurut diagnosa terakhir dan hasil uji sampel darah, Indah Pratiwi dinyatakan suspect DBD. Bocah berusia di bawah lima tahun itu mengalami demam sangat tinggi selama beberapahari.Trombositnyapun semakin menurun. sedangkan Mursalobservasidemam.”terang Arnalom. Saatini,lanjutArnalom,Indah berangsur membaik, dan telah dibawa pulang keluarganya. Menyikapikemunculanserangan

DBD ini, pihaknya sudah menerjunkan tim untuk melakukan pengasapan di rumah penderita dansekitarnya.“Tindakan fogging yang kami lakukan untuk membasmi wabah DBD yang telah menyerang warga Pasar Gunungtua,” jelas Arnalom. Ditempat terpisah, pengurus IAKMI, (Ikatan Ahli Kesehatan Masyarakat Indonesia) Cabang Padanglawas Utara, Ganti Paruntungan Pulangan, SKM mengimbau masyarakat untuk lebih meningkatkan perilaku hidup bersih dan sehat serta melakukan gerakan 3M plus, yakni menutup, menguras dan

mengubur tempat-tempat yang diduga tempat berkembangnya nyamuk, seperti tong penampung air, ban, dan tumpukan botol mineral dan barang-barang yang digenangi air. Dijelaskan Ganti, DBD merupakan salah satu penyakit yang dapat menimbulkan kematian sehingga tingkat kesadaran masyarakat perlu terus ditingkatkan. Bagi warga yang mengalami gejalaakibatgigitannyamukDBD itu, diminta segera melaporkannya ke Puskesmas terdekat, agar segera dapat ditangani dan tidak menyebabkan kematian bagi penderita. (a35)

STKIP Juara OSN Kopertis Wilayah I P. SIDIMPUAN (Waspada): Sekolah Tinggi Keguruan Ilmu Pendidikan(STKIP)‘TapanuliSelatan’Padangsidimpuanmendominasi juara Olimpiade Sains Nasional (OSN) bidang Fisika, Matematika, dan Biologi diselenggarakan Kopertis Wilayah I Aceh-Sumut akhir bulan kemarin. “OSN bidang Fisika dan Matematika diselenggarakan 19-21 Maret, dan Biologi 26-28 Maret. Alhamdulillah, mahasiswa STKIP mendominasi juara pada OSN tersebut,” kata Ketua STKIP ‘Tapsel’ Padangsidimpuan, DR Ali Pada Harahap MPd, Selasa (3/4). Mereka yang meraih juara, Rini Anggraini Pakpahan juara pertama OSN bidang Fisika, Darman Hasudungan Siagian juara pertama Matematika, dan Nenni Suryani juara harapan dua Biologi. Pasca menjuarai OSN tingkat KopertisWil Aceh-Sumut ini, ketiganya akan diutus ke OSN tingkat nasional di Jakarta. Dijelaskannya, pada OSN tahun lalu Anggraini yang kini duduk di tingkat empat bangku perkuliahan juga meraih juara pertama bidang Fisika. Nenni Suryani yang satu tingkat dengannya meraih juara dua bidang Biologi. Sementara Dicky Juliansyah meraih juara harapan tiga Matematika dan Asriani Hasibuan meraih juara dua mahasiswa berprestasi. Menyikapi prestasi yang diraih mahasiswanya, DR Ali Pada Harahap memberikan apresiasi. Karena prestasi tersebut merupakan bukti nyata dan hasil kerja keras seluruh komponen kampus mulai dari pimpinan, dosen, pegawai, dan mahasiswa selama ini. “Prestasi ini juga menunjukkan bahwa STKIP ‘Tapsel’ Padangsidimpuan yang berada jauh dari Medan selaku ibukota propinsi, ternyata mampu bersaing dengan perguruan tinggi lainnya di Sumut dan Aceh,” ujarnya. Ketua Yayasan Al-Iman sebagai pemilik STKIP ‘Tapsel’ Padangsidimpuan, H. Syahrul Hadi Lubis, juga menyampaikan apresiasi tinggi atas prestasi yang di raih para mahasiswa. Prestasi ini, menurut Syahrul Lubis, merupakan rahmat dan sekaligus buah dari kerja keras semua elemen kampus yang selama ini telah menunjukkan dedikasinya. “Semoga mahasiswa ini mampu berkiprah dan berprestasi di tingkat nasional,” harapnya. (a27)

Panwaslukada Apresiasi Rahmat Nasution P. SIDIMPUAN (Waspada): Panitia Pengawas Pemilu Kepala Daerah (Panwaslukada) Kota Padangsidimpuan, mengapresiasi H. Rahmat Nasution, S.Sos, karena hingga kini tetap kooperatif terhadap aturan yang telah ditetapkan. Apresiasi muncul dari Ketua Panwaslukada Padangsidimpuan, Hetty Br Ritonga, saat ditanya pendapatnya tentang Rahmat Nasution yang mengirim timnya berkoordinasi tentang redaksi kalimat yang layak dipajang pada baliho atau spanduk jelang Pemilukada tahun ini. “Kita mengapresiasi kooperatifnya Rahmat Nasution tentang aturan yang ditetapkan tentang baliho atau spanduk. Tapi tolong apresiasi kita ini jangan dipolitisir, karena Panwaslukada itu wajib netral alias tidak memihak,” ujar Hetty Br Ritonga, Senin (2/4). Disebutkannya, pada Sabtu (31/3) kemarin Muhammad Sunhaji yang mengaku dikuasakan Rahmat Nasution, mendatangi kantor Panwaslukada. Dia membawa kertas bertuliskan kalimat yang akan dipajang pada baliho dan spanduk milik Rahmat Nasution.Tujuannya utuk diseleksi Panwaslukada, tentang mana yang boleh dan tidak. Hal ini dilakukan, karena sebelumnya Panwaslukada telah memberitahu bahwa setiap orang atau pasangan orang yang memiliki niat maju sebagai peserta Pemilukada Padangsidimpuan tidak boleh memuat kalimat berbau Pemilukada dalam baliho, spanduk, maupun media lainnya, sebelum KPUD membuka pendaftaran. Pantauandilapangan,setiaporangataupasanganorangyangterlanjur memajangbalihodengankalimatberbauPemilukada,saatinisebagian kalimat-kalimattersebuttelahdicoretdanditutupidenganlakban.Namun masih ada juga yang dibiarkan begitu saja. (a27)

BMKT Era PD II Terkesan Diabaikan TG TIRAM (Waspada): Bahan Muatan Kapal Tenggelam (BMKT) pada era Perang Dunia (PD) II di perairan Kec. Tanjungtiram, Kab. Batubara terkesan diabaikan. Padahal bahan muatan tersebut bernilai tinggi karena berasal dari kapal peninggalan penjajah yang tenggelam konon dihantam mortir di masa itu. Selain muatan bahan jadi berupa karet/getah, juga benda berharga lain dan tidak menutup kemungkinan emas batangan. “Setahu kita masalah ini sudah diupayakan untuk diangkat dan di laporkan Diskanla Batubara kepada instansi terkait maupun panitia nasional di Jakarta, namun sampai sekarang belum ditindaklanjuti dan terkesan diabaikan,” tukas beberapa tokoh dan nelayan di Tanjungtiram kepada Waspada, Minggu (1/4). Nelayan mengaku beberapa tahun silam menemukan bahan muatan kapal ketika melakukan penangkapan ikan di laut. Namun, karena keterbatasan peralatan yang dimiliki, hal itu tidak dapat dilakukan sepenuhnya. Sehingga, kini diperlukan langkah kordinasi sesama instansi terkait dalam upaya pengambilan bahan berharga dari dalam kapal, karena berpeluang di jarah oleh orang yang tidak bertanggungjawab. (a13)

Wali Kota Sibolga Sampaikan Dua Masalah Kepada Gubsu

Waspada/Sori Parlah Harahap

TUMPUKAN botol mineral ditempat barang rongsokan di daerah Gunungtua dikhawatirkan menjadi salah satu tempat berkembangnya nyamuk DBD yang sewaktu-waktu dapat menjangkit warga sekitar.

Mantan Napi Jadi Kadis PU Madina Berlawanan Dengan Visi Misi Bupati PANYABUNGAN(Waspada): BadanPertimbanganJabatandan Kepangkatan (Baperjakat) seharusnya memperhatikan rekam jejak PNS sebelum mengangkatnya sebagai pejabat publik, khususnya pada posisi yang langsung melayani masyarakat. “Jika seorang mantan narapidana diimpor kemudian dipromosikan menempati posisi trategis, sama saja mencederai PNS lain yang sudah lama mengabdi dan memiliki kinerja baik. Keputusan tersebut jelas berlawanan dengan semangat pemberantasan korupsi di Madina, sesuai visi misi HidayatDahlan saat kampanye,” ujar Dekan Fakultas Hukum Universitas Muhammadiyah Sumatera Utara(UMSU)FaridWajdikepada Waspada, Selasa (3/4) melalui telepon selular, ketika dimintai tanggapannya tentang pengangkatan Parlaungan Lubis, mantan narapidana (Napi) menjadi Plt Kadis PU Madina. Diingatkan, mantan Napi sudah masuk kategori mempunyai cacat sosial, dan dari konteks

moralitas dalam dirinya sudah juga terjangkit cacat moral karena pernah terjadi pergolakan perilaku jahat dalam dirinya yang kemudian dimenangkan oleh nafsu jahat sehingga terjadilah tindakan yang melanggar norma hukum, agama, sosial dan etika. “Orangyangakanmelakukan tindak kriminal yang masuk kategori korupsi (suap menyuap, mark up, dll.) yang umumnya dilakukan pejabat negara, pada umumnya yang bersangkutan sudah menyadari bahwa tindakannya tidak benar dan jika ketahuan akan ditindak secara hukum. Namun kenyataannya pejabat publik tersebut dengan berbagai cara berusaha untuk menilep uang negara. Manusia sepertiinisudahtidakmempunyai moralitas berbuat baik,” ujarnya. Menurut Farid, hal ini dapat diterjemahkan bahwa penghayatan terhadap agama yang dianut jugarendahsehinggarakyatpantas meragukan integritas dan moralitasnya. Jika orang yang sudah tidak mempunyai integritas dan moralitas berbuat korupsi, lanjut

dia, kemudian terbukti dan dihukum,setelahmenjalanihukuman kemudianlangsungsangmantan Napi koruptor dapat menjadi pejabatpubliklagi,kemudianbisa korupsi lagi, begitu seterusnya, apa jadinya negeri ini?. Diingatkannya, pejabat publikitupemimpin,danpemimpin adalah panutan rakyat yang dipimpin.Pemimpinharusdapat menjadi contoh dan teladan baik tutur katanya dan tindakannya. Menjadi pejabat publik adalah suatu kehormatan sehingga yang dipertaruhkan adalah nama baik dan kehormatan. “Nah, jika pemimpinnya ternyata mantan napi, kehormatan dan kebanggaan apa yang akan didapat dari rakyat. Apakah mantan napi kriminal menjadi pejabat publik akan membanggakan rakyatnya? Apakah kita sebagai rakyat akan bangga jika misalnyawakilrakyatadalahmantan napitindakkriminalpemerkosaan, pembunuhan, bandar narkoba, koruptor,bandarjudi,perampok?” ujar Dekan Fakultas Hukum tersebut. (a26)

Azran Siregar Ketua IPK Paluta GUNUNGTUA (Waspada): Ketua DPD Ikatan Pemuda Karya (IPK) Sumatera Utara (Sumut), Nelson Diapari Simanjuntak melantik kepengurusan IPK Kab. Padanglawas Utara, priode 20122017 di aula Hotel Mitra, Kecamatan Padangbolak, Minggu, (1/4). Pengurus yang dilantik yakni Ketua Azran Siregar, Sekretaris Irham, dan Bendahara Syafaruddin. Turut hadir dalam acara tersebut, Bupati Padanglawas Utara Drs. H. Bachrum Harahap, Ketua KNPI Paluta Akhirul Siregar, Ketua MUI Paluta, Ketua DPD IPK Kabupaten/Kota seSumatera Utara, Polsek Padangbolak,OKP,Ormasdanundangan lainnya. Ketua DPD IPK Sumut, Nel-

son Diapari Simanjuntak dalam sambutannya mengatakan, IPK bukan organisasi partai politik, melainkan sebuah organisasi untuk mencetuskan karya-karya yang mempunyai nilai kemanusiaan serta pembangunan. Pemuda dituntut berkarya melaluikemampuanbidangmasingmasing. Ketua IPK Kabupaten Paluta yang baru dilantik, Azran Siregar menyampaikan, agar seluruh kader pemuda IPK yang dilantik selalu menjaga kekondusipan serta menjauhkan diri dari perbuatan anarkis seperti kriminalitas. “Mari kita membangun hubungan silaturahmi yang baik terhadap orangtua, masyarakat danPemkabPadanglawasUtara,”

ujar Siregar. Bupati Paluta Drs. H. Bachrum Harahap juga berpesan agar pengurus IPK Paluta yang baru saja dilantik harus menjadikan IPK sebagai organisasi kepemudaan yang mandiri. KetuaKNPIPalutamengungkapkan, selaku perkumpulan organisasi, KNPI dengan tangan terbuka menyambut baik hadirnya kembali IPK di hadapan masyarakat Kab. Paluta. Diharapkan IPK dapat bergandeng tangan dengan Pemkab Paluta dan harus bisa menjadi pemuda yang tegap dalam mengawal pembangunan di Kab. Padanglawas Utara agar percepatan peningkatan ekonomi rakyat bisa tercapai. (a35)

Proyek PNPM Di T. Tiram Terbengkalai LIMALARAS, Batubara (Waspada): Proyek PNPM-2011 hampir Rp500 juta dialokasikan untuk perkerasan jalan di Dusun V dan pembuatanjalanrabatbetondiDusunIIDesaLimalaras,Tanjungtiram, Kab. Batubara diduga bermasalah, seperti pada perkerasan jalan yang terbengkalai. “Apapun alasannya kami mendesak pihak Pemkab Batubara c/q BPMPD Kab. Batubara supaya menyelesaikan pekerjaan perkerasan jalan yang terbengkalai tersebut,” sebut warga Dusun V Limalaras, Senin (2/4). Warga mengatakan, pekerjaan perkerasan jalan bernilai Rp300 juta lebih sudah delapan bulan berlangsung tak kunjung selesai. Di lokasi sesuai bestek panjang jalan 3.000 meter. Kenyataannya, yang dikerjakan hanya 500 meter ditumpuk batu padas berserakan. Warga mengeluhkan batu padas bertimbulan, yang membuat sulit dilintasi kenderaan pengangkut hasil pertanian. Sementara Fakhrul, selaku suplayer, Senin (2/4) mengaku, dia menderita kerugian akibat kinerja TPK yang diketuai Badiuzzaman amburadul, di antaranya diduga memalsukan tanda tangan guna pencairan dana. Sampai Senin (2/4), pihak TPK belum melunasi harga permintaan barang, antara lain batu padas, tanah timbun, semen, pasir beton, kerikil split, bis bernilai Rp65 juta lebih. (a12)

Waspada/Alam Tanjung

GUBSU Gatot Pujonugroho,Wali Kota Sibolga Syarfi Hutauruk dan Ketua DPRD Kota Sibolga Syahlul U Situmeang saat melakukan ziarah dan tabur bunga ke makam pendiri Kota Sibolga di kompleks Mapolres Sibolga Kota.

SIBOLGA (Waspada): Wali Kota Sibolga Drs. HM Syarfi Hutauruk menyampaikan dua hal kepada Plt Gubsu Gatot Pujonugroho, yang sudah lamamenjadipermasalahanditengahmasyarakat Kota Sibolga. “Permasalahan pertama yakni kerusakan JalinsumSibolga-Tapteng-Tarutungyangmenjadi kendala utama sektor transportasi dalam rangka peningkatan tingkat perekonomian. Juga permasalahan perluasan Kota Sibolga,” ujar HM Syafri Hutauruk dalam acara Hari Ulang Tahun (HUT) ke-312 Kota Sibolga. Pesta kembang api, Selasa (3/4) dinihari tepatnya pukul 00:00 memecahkan suasana sekaligus meriahkan HUT ke 312 Kota Sibolga ditandai dengan sirene disaksikan unsur Muspida Plus Kota Sibolga dan ribuan masyarakat. Sebelumnya, pada rapat paripurna istimewa DPRD Kota Sibolga dipimpin Ketua DPRD Syalul Umur Situmeang, Senin (2/4), Plt Gubsu Gatot Pujonugroho mengatakan, Kota Sibolga sudah sejak lama dikenal sebagai pintu gerbang dan pusat pertumbuhan ekonomi regional di wilayah pantai barat Sumatera Utara. “Keberadaan pusat pertumbuhan akan dapat

bertahan jika daerah mempunyai daya saing ekonomiyangtinggiyangdibangunmelaluiinsentif dan terobosan dari pemerintah daerah diikuti perbaikan infrastruktur. Kota Sibolga merupakan kota memiliki wilayah administrasi yang relatif kecil namun Kota Sibolga memiliki potensi besar di berbagai sektor seperti sektor perikanan dan pariwisata,” katanya. Wali Kota Sibolga Drs. HM Syarfi Hutauruk mengatakan, rangkaian acara yang dilaksanakan dalam rangka menyambut sekaligus memeriahkan HUT ke 312 Kota Sibolga meliputi olahraga yang melibatkan sejumlah kab/kota se- Provsu di antaranya futsal, volley pantai, tenis lapangan dan sepakbola, olahraga tingkat nasional dan internasional di antaranya triatlon, lari marathon 10K dan renang diperairan Teluk Tapian Nauli. Juga pameran pembangunan. Acarapuncakinidilanjutkandenganpenaburan bunga dan ziarah ke makam pendiri Kota Sibolga TuanKuDorongHutagalungdikompleksMapolres SibolgaKotadiJalanDrFLTobingSibolgakemudian perlepasan karnaval dan penyerahan bantuan dan penandatanganprasastiyangdipusatkandikompleks rumah dinas wali kota. (a24)

Advokat Tabagsel Sambut Baik MoU Peradi Dan Polri P. SIDIMPUAN (Waspada): Ketua DPC PerhimpunanAdvokatIndonesia(Peradi)Tapanuli Bagian Selatan (Tabagsel), H. Ridwan Rangkuti, SH, MH menyambut baik dan mengapresiasi penandatanganan nota kesepahaman bersama (MoU) antara Kapolri Jenderal Pol. Drs. Timor Pradopo dengan Ketua Umum DPN Peradi, DR. Otto Hasibuan, MM di Jakarta, kemarin. “Langkah ini meningkatan kerjasama dan koordinasi pelaksanaan tugas, fungsi, dan kewenangan masing-masing secara efektif.Yakni sesuai peraturan dan perundangan tentang polisi dan advokat,” katanya di Padangsidimpuan, Selasa (3/4). Ada beberapa butir penting dalam MoU tersebut yang patut diapresiasi tinggi. Antara lain Pasal 3 ayat (1), yang menegaskan untuk proses pemanggilan kepada advokat dalam hal berkaitan profesi, baik sebagai saksi maupun tersangka, harus melalui Peradi setempat, terdekat, atau DPN Peradi. “Dalam hal pemanggilan ini, penyidik harus melampirkan uraian singkat tentang kasus dan posisi tindak pidana yang mengaitkan advokat tersebut,” jelas Rangkuti yang juga Ketua PDC Ikatan Advokat Indonesia (Ikadin) Tabagsel. Kemudian Pasal 3 ayat (2), yang menegaskan bahwasetelahmendapatsuratpanggilanpenyidik,

Peradi segera memproses masalah advokat yang bersangkutan. Selanjutnya memberikan hasil pemeriksaan itu kepada penyidik paling lambat 14 hari, dan menghadirkan advokat tersebut kepadapenyidik.“PadaPasal4MoUitujugaditegaskan bahwa penyitaan dokumen dan surat yang berada dalamkekuasaanadvokat,harusmelampirkansurat penetapan penyitaan dari pengadilan,” terang Rangkuti. Peradi tidak akan memberi izin pemanggilan terhadap advokat, baik sebagai saksi maupun tersangka, jika tindak pidana tersebut berterkaitan dengan profesi advokat atau sumpah jabatannya. Setiap advokat yang mengalami hal seperti ini dapat mengundurkan diri jika ditetapkan sebagaisaksi,karenaadvokatwajibmenjagarahasia kliennya. Tapi jika ternyata advokat tersangkut kasus tindak pidana yang tidak terkait Pasal 19 UUAdvokatatauPasal4huruf(h)KodeEtikAdvokat Indonesia. Maka Peradi mengizinkan penyidik memeriksanya sebagai saksi maupun tersangka. Rangkuti menilai MoU antara Polri dan Advokat tetap mengedepankan ketentuan perundangan yang berlaku. Paling penting, MoU tersebut merupakan suatu bentuk pengakuan Polri bahwa advokat yang berhak beracara dan mendampingitersangkaharuslahadvokatanggota Peradi. (a27)

Bank Sumut Bina 3.000-an Kelompok Masyarakat SIBOLGA (Waspada): Hingga saat ini sudah 3.000 an kelompok masyarakat kecil sudah dibina oleh PT Bank Sumut, disebut sebagai program Sumut sejahtera 1 dengan jumlah anggota 71 ribu lebih. Hal itu dikatakan Direktur PT Bank Sumut H. Gus Irawan Pasaribu saat menjawabWaspada, Sabtu (31/3) saat akan melakukan pertandingan eksebisi sepakbola liga Tapanuli di stadion Horas Sibolga. Dikatakan, secara umum di PT Bank sumut punya program ekonomi kerakyatan itu bersifat umum dan bukan melalui sektor atau wilayah dankhususnyakaumperempuandibentuksecara berkelompok- kelompok. Diakui Gus Irawan, untuk Kota Sibolga sudah 1.400 anggota kelompok yang dibina oleh kantor cabang Bank Sumut Sibolga dengan berbagai macam jenis usaha kecil dengan secara bertahap mulai dari Rp500 ribu sampat Rp1 juta. Dalam pencairan dana pinjaman ini apabila sudah dilakukan survei dan memang sangat layak

untuk dibantu maka akan diberikan pinjaman tanpa agunan. Bila tahap pertama kelompok ini berhasil dan melunasinya maka akan dilajutkan pada tahap ke 2 maksimal pinjaman Rp2 juta dan hingga tahap ke 5 maksimal pinjaman Rp5 juta. MenyinggungprogramlainnyaGusmengakui, secara konperhensif ekonomi mikro yakni usaha yang terkecil kelas masyarakat terbawah tanpa agunan disebut Sumut sejahtera I, dan pinjaman dari Rp5 juta sampai Rp50 juta disebut Sumut sejahtera II, sedangkan pinjaman Rp50 juta hingga Rp500 juta disebut KUR Sumut sejahtera. Dikatakan Gus dengan modal Rp500 juta apalagi pantai barat Sumut ini rata-rata nelayan sudahbisamemanfaatkannyadenganmelengkapi alat-alat tangkap ikan dalam meningkatkan hasil penangkapan dan peningkatan taraf ekonomi. Ditanya tentang kesiapannya maju sebagai balon Gubsu Gus Irawan mengakui dirinya sudah siap maju dan mengakui hal itu didasarkan atas permintaan masyarakat. (a24)

Journalis Gathering Bersama PT SM

Waspada/Sori Parlah Harahap

KETUA DPD Ikatan Pemuda Karya (IPK) Sumatera Utara,Nelson Diapari Simanjuntak menyerahkan bendera pataka kepada Azran Siregar pada acara pelantikan pengurus IPK Kab. Padanglawas Utara, priode 2012-2017 di aula Hotel Mitra, Kecamatan Padangbolak.

PANYABUNGAN (Waspada): PT. Sorikmas Mining (SM) mengadakan kegiatan pelatihan jurnalistik (Journalis Gathering), Selasa (3/4) pukul 13:30 di Aula Hotel Rindang Dalan Lidang – Panyabungan. Acara diikuti sekitar 60 orang wartawan dari media cetak dan elektronik. Sedangkan narasumber berasal dari PT. SM yang memiliki latar jurnalistik yakni Nurul Fazrie selaku Humas and Media Relations Superintendent, serta Lia Ratna Palupi Nasution juga staf pada Media and Relation. Kedua narasumber di acara itu secara bergantian membagi pengalaman ilmu dan juga teknik jurnalis dalam mencari dan menciptakan sebuah berita yang menarik,

mengkritik, dan mendidik yang disampaikan dengan gaya berita yang menjunjung etika jurnalis. Di samping wawasan jurnalistik, Nurul Fazrie juga berbagi ilmu di bidang pertambangan mulai dari proses izin tambang, tahapan eksplorasi, eksploitasi, dan istilah ilmiah dalam pertambangan. Syaifuddin Lubis, seorang wartawan, mengucapkan terima kasih kepada PT. SM yang telah mensponsori acara yang sangat positif, dan diharapkan bisa berkesinambungan. Karena acara journalis gathering selain menambah wawasan juga mempererat silaturahmi antara perusahaan dengan rekanrekan wartawan di Madina. (c14)

Sumatera Utara

B4

WASPADA Rabu 4 April 2012

MA Kuatkan Putusan Bebas PN Simalungun

Empat Pengurus Kelompok Tani Gugat Balik PTPN IV MEDAN (Waspada): Empat pengurus Kelompok Tani Sei Borhu Sejati dan Mawar Sei Bamban, akan menggugat balik pihak PTPN IV Kebun Bukit Lima Nagori Marihat Tanjung, Kec. Bosar Maligas, Kab. Simalungun, ke pengadilan. Menurut kuasa hukum Husni Thamrin Tanjung, SH dan Ruslan Purba, SH kepada Was-

pada di Medan, Selasa (4/4), ke empatkliennyaituadalahAhmad Sitorus,Saipul,SamiadiManurung

Anggaran PJU Tumpang Tindih PAKPAK BHARAT (Waspada): Anggaran Penerangan Jalan Umum (PJU) Kabupaten Pakpak Bharat tumpang tindih. Hal tersebut diketahui sesuai konfirmasi dengan Kepala Ranting PLN Salak Pakpak Bharat Pangeran Pohan, Jumat (30/3) melalui pesan singkat.Ternyata, diperoleh informasi, proses pembayaran PJU dilakukan oleh pihak Pemkab Pakpak Bharat melalui bank ke PLN Pusat. Lebih jauh saat ditanya jumlah KWH beban Lampu Penerangan Jalan Umum Pakpak Bharat, Pangeran Pohan terkesan menghindar dengan menyebutkan bahwa terkait LPJU adalah urusan langsung dengan pihak PLN Cabang dan disarankan untuk konfirmasi ke pihak PLN Cabang. Saat ditanya tujuan kutipan PJU melalui rekening listrik warga yang mencantumkan biaya PJU, lagi-lagi Pohan berkelit dengan menyebutkan, hal tersebut harus ditanya ke PLN Pusat karena, katanya, tagihan listrik dikelola bank dan bukan PLN. (csb)

Hanmars, Pelihara Fisik Prajurit PEMATANGSIANTAR (Waspada): Kegiatan hanmars (jalan kaki) dilaksanakan untuk meningkatkan dan memelihara kemampuan fisik prajurit guna mendukung tugas pokok serta membangun semangat kebersamaan dan mempererat hubungan silaturahim antar sesama prajurit dengan harapan semangat kebersamaan dapat memotivasi para prajurit meningkatkan etos kerja. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menyebutkan, kegiatan Hanmars sejauh 5 km itu dilakukan saat penutupan kegiatan Minggu Militer prajurit Makorem 022/PT dan dinas jawatan jajaran Korem 022/PT, baru-baru ini. Program Minggu Militer pada Maret 2012 di Makorem 022/ PT, imbuh Kapenrem, diisi dengan berbagai kegiatan, antara lain Uji Terampil Perorangan dengan materi UTP Umum (Pengenalan Jat, Ilmu Medan, Long Ma Lap, Pionir, BDM, Hukum HAM dan Humaniter) dan Buku Pedoman Umum Prajurit (BPUP) yang sudah dilaksanakan pada 26-27 Maret 2012. Mengenai hanmars itu, Kapenrem menyebutkan start dari Makorem 022/PT menuju Jalan Ragi Pane, lapangan sepak bola Rambung Merah, terus ke Pasar I Rambung Merah, Jalan Melati, Kantor Camat, KomplekVeteran, AsramaMakorem 022/PT, kemudian finis di Makorem 022/PT. (a30)

alias pak Agus dan Sumarwan Saragih alias Marwan, semuanya warga Dusun I Pengkolan Nagori Parbutaran, Kec. Bosar Maligas, Kab. Simalungun. Mereka, pada 21 November 2008 sekira jam 12:00 siang ditangkap dengan tuduhan mencuri 108 tandan buah kelapa sawit yang ditaksir seharga Rp1. 134.000 milik PTPN IV Kebun Bukit Lima Nagori Marihat Tanjung, Kec. Bosar Maligas. DalampersidangandiPengadilan Negeri Simalungun, jaksa menyatakan ke empatnya terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana‘pencuriandalamkeadaan memberatkan’, melanggar pasal 363 ayat (1) ke-4e KUHPidana. Karena itu menuntut agar ma-

sing-masing terdakwa dihukum 1 tahun penjara potong tahanan, dengan perintah tetap ditahan. Tapi Pengadilan Negeri Simalungun dengan Ketua Majelis Hakim, Binsar Gultom, SH, SE, MH serta hakim anggota Atok Dwinugroho, SH dan Halida Rahardhini, SH, M.Hum, dalam sidang 25 November 2009 memutuskan membebaskan ke empatnya dari dakwaan jaksa. Pengadilan menyatakan mereka tidak terbukti secara sah dan meyakinkan bersalah melakukan tidak pidana sebagaimana dakwaan jaksa penuntut umum. Memulihkan hak-hak ke empat terdakwa dalam kemampuan, kedudukan, harkat dan martabatnya semula. Begitujugapadatingkatkasasi

Pakpak Bharat Terapkan e-KTP SALAK (Waspada): Sesuai ketentuan Undang-undangan No. 23 Tahun 2006, Perpres No. 26 Tahun 2009 dan Perpres No. 35Tahun 2010 tentang kependudukan, Pemkab Pakpak Bharat terapkan program Kartu Tanda Penduduk Elektronik (e-KTP). “Seiringdengandicanangkannyaprogramsatuidentitaskependudukan secara nasional yang dikenal dengan nama e-KTP, maka Pemkab Pakpak

Bharat melalui Dinas Kependudukan dan Pencatatan Sipil berupaya maksimal melaksaksanakan program ini sebaik-baiknya,” ungkap Kepala Dinas Kependudukan dan Catatan Sipil Papak Bharat Drs. Parulian Sinaga kepada wartawan di Salak, Selasa (3/4) di Salak. Dikatakan Parulian, dengan kemampuan sumber daya yang ada dan besaran jumlah penduduk yang tidak sebanyak daerah

Warga Persit KCK Ziarah Ke TMP PEMATANGSIANTAR(Waspada):Warga PersitKCKmelaksanakan ziarah ke Taman Makam Pahlawan (TMP) Pematangsiantar, Senin (2/4) dalam kaitan memperingati HUT ke-66 Persit KCK. Ziarah dan tabur bunga dipimpin Wakil Ketua Persit KCK Koorcab Rem 022 PD I/BB Ny. Feby Anton Irianto Popang dan diikuti ibu-ibu Persit KCK yang lain. Ziarah rombongan diawali dengan penghormatan kepada arwah para pahlawan, hening cipta dan dilanjutkan peletakan karangan bunga di tugu pahlawan, kemudian tabur bunga di pusara. Kegiatan itu sebagai simbol penghargaan terhadap jasa-jasa para pahlawan yang sudah rela mengorbankan jiwa dan raganya demi Bangsa dan Negara, sebut Kapenrem 022/PT Mayor Caj Drs. Prinaldi. Menurut Kapenrem, kegiatan ziarah itu memiliki arti sangat penting, di samping sebagai penghormatan kepada para pahlawan yang sudah mendarmabaktikan jiwa raganya kepada nusa dan bangsa, juga sebagai wujud kepedulian kepada para pahlawan. “Bangsa yang besar merupakan bangsa yang mau menghargai para pahlawannya. Untuk menyambut HUT ke 66 Persit KCK itu, sudah dilaksanakan berbagai kegiatan antara lain lomba bernyanyi dantarisertalombaPosyandu.Sedangkegiatanyangakandilaksanakan yakni anjangsana ke Panti Asuhan dan diakhiri dengan syukuran HUT Persit ke66 pada 12 April 2012,” sebut Kapenrem. Hadir dalam pelaksanaan ziarah terdiri ketua cabang, Ranting dan anak ranting Persit KCK jajaran Koorcab Rem 022 PD I/ BB beserta anggota Persit KCK. (a30)

di Mahkamah Agung, Majelis Hakim diketuai Ketua Muda Mahkamah Agung, Djoko Sarwoko, SH, MH, serta Hakim Agung Dr. H. Andi Abu Ayyub Saleh, SH, MH dan Hakim Agung Prof. Dr. Surya Jaya, SH, M.Hum sebagai anggota, dalam sidang 7 Oktober 2010 memutuskan, tidak dapat menerima permohonan kasasi jaksa penuntut umum pada Kejaksaan Negeri Simalungun. “Karena telah adanya putusan incraht dari Mahkamah Agung, maka kami segera melakukan upaya hukum dengan menggugat balik pihak PTPN IV KebunBukitLimaNagoriMarihat Tanjung, baik secara pidana mau pun perdata,” tegas HusniThamrin Tanjung, SH.(m21)

Waspada/Saut Boangmanalu

PEMKAB Pakpak Bharat laksanakan sosialisasi e-KTP. Dari kiri: Kadis Dukcatpil Drs. Parulian Sinaga, Wakil Bupati Ir. H. Maju Ilyas Padang dan narasumber dari Catpil Provsu.

lain, Disdukcatpil Pakpak Bharat diharapkan mampu menyukseskan program e-KTP. Program tersebut merupakan penerbitan Kartu Tanda Penduduk berbasis Nomor Identitas Kependudukan (NIK) secara nasional yang memiliki spesifikasi dan format nasional dengan sistem pengamanan khusus yang berlaku sebagai identitas resmi. Dengan adanya e-KTP,setiappendudukyangtelah memenuhi syarat akan mendapatkan identitas dan identifikasi jatidiri secara benar dan akurat. Lebih jauh diterangkannya, e-KTP tersebut juga dapat digunakan untuk identifikasi dalampelayananpubliksehingga terjadi efisiensi dan efektivitas pelayanan publik. “Masyarakat Pakpak Bharat tidak perlu takut tidak terlayani secara baik dan benar dalam penerbitane-KTPkarenaPemkab Pakpak Bharat tetap konsisten mengutamakan pelayanan publik seiring dengan telah diterapkannya Sistem Manajemen Mutu ISO 9001:2008 untuk pelayanan publik,” terang Parulian Sinaga. (csb)

Kerusakan Jalan Membuat Stres SIMALUNGUN (Waspada): Ruas jalan kabupaten dari Kerasaan menghubungkan Pematangbandar terus ke Serbelawan, Kab. Simalungun, sekira 20 km, kondisinya kini semakin rusak parah. Akibatnya, para pengemudi dan penumpang angkutan umum jurusan Kerasaan – Medan menjadi stres, karena waktu tempuh diperjalanan semakin lama. Bukan hanya itu, kekesalan juga dirasakan masyarakat, terutamayangtinggaldisepanjang jalandimaksud,karenasepanjang hari bila panas terik mereka mandidebu,sedangkanbilahujan turun mereka ‘mandi lumpur’. “Kondisijalaninibenar-benar sudah memprihatinkan, butuh perbaikan pemerintah. Apalagi

jalan ini merupakan jalan vital menuju ibukota Provinsi Sumut, Medan,” tandas M Ridwan Damanik, warga Bandar Huluan. Masyarakat menilai, pihak Pemkab Simalungun lamban menyikapi keluhan masyarakat, padahal kerusakan jalan tersebut sudah cukup lama. “ Keadaan ini bukan hanya menimbulkan keluhan berkepanjangan bagi pengguna jalan dan masyarakat yang tinggal di sepanjang ruas jalan tersebut, tetapi warga juga telah banyak dirugikan secara materil,” tambah Ridwan. Pengemudidanparapenumpang angkutan umum jurusan Kerasaan-Medan juga mengeluh. Menurut mereka, waktu tempuh perjalanan menuju Medan bertambah lama. “ Untuk

menempuh jalan Kerasaan ke Pematangbandar terus menuju Serbelawan yang hanya sekira 20 km tapi dibutuhkan waktu 1,5 sampai 2 jam. Ini akibat parahnya keadaan jalan,” sebut Marbun, salah seorang pengemudi angkutan umum KUPJ. Kepala Dinas Binamarga Simalungun,JohnSabidenPurba, yang dihubungi mengatakan, tahun ini Pemkab Simalungun telah mengalokasikan anggaran perbaikan jalan sekira Rp120 miliar lebih yang ditampung dalam APBD 2012. “Kita sudah alokasi angaran perbaikan jalan sekira Rp120 miliar, termasuk untuk biaya perbaikan jalan Kerasaan – PematangbandarBahapal dan Serbelawan,” terang Purba. (a29)

Pembangunan Masjid Taqwa Masih Butuh Bantuan

Waspada/Edoard Sinaga

WAKIL Ketua Persit KCK Koorcab Rem 022 PD I/BB Ny. Feby Anton Irianto Popang meletakkan karangan bunga di TMP Pematangsiantar, saat ziarah rombongan dalam memperingati HUT Persit KCK ke 66 Tahun 2012.

DPC Gerindra Laksanakan Rapimcab Dan Rakercab KABANJAHE (Waspada): Dewan Pimpinan Cabang (DPC) Partai Gerindra Kabupaten Karo, Senin (2/4) melaksanaka Rapat Pimpinan Cabang (Rapimcab) dan Rapat Kerja Cabang (Rakercab) dihadiri peserta dari masing-masing kecamatan yang ada di Kab. Karo serta DPD Sumut di Berastagi. “Kegiatan Rapimcab dan Rakercab bertujuan untuk kelancaran jalannya roda organisasi Partai Gerakan Indonesia Raya (Gerindra) di wilayah Kabupaten Karo,” kata Ketua Panitia Pelaksana Antonius Purba, SE kepada wartawan di sela-sela kegiatan. Dikatakan, konsolidasi partai juga dapat mempererat dukungan untuk bersama-sama guna mendukung Prabowo Subianto menjadi Presiden pada 2014 mendatang. Kegiatandiikutipesertadari16kecamatan,kataSentosaSinulingga, yang menjabat sebagai wakil ketua bidang OKK kepada wartawan menyampaikan, konsolidasi yang dilakukan saat ini hingga ke tingkat ranting agar para kader mampu dan lebih bersemangat memperjuangkan kepentingan rakyat. Ketua DPC Kabupaten Karo Kol. Inf Abednego Sembiring di sela-sela kegiatan mengatakan, Partai Gerindra yang ada di Kabupaten Karo berupaya memberi kontribusi kepada masyarakat di bidang pembelajaran politik. (c10)

PEMATANGSIANTAR (Waspada): Pembangunan Masjid Taqwa di Jalan Merdeka, Kota Pematangsiantar yang direnovasi secara total 2005, sampai kini masih membutuhkan uluran tangan para dermawan, baik dari pemerintah daerah, instansi pemerintah lainnya, instansi swasta, para pengusaha dan khususnya umat Islam. Ketua panitia pembangunan Sofyan Rizal saat bincangbincang di lokasi Masjid Taqwa, Selasa(3/4)menyebutkan,Masjid Taqwa didirikan 1930 dan terletak di pusat kota. Karena perkembangan zaman dan pertambahan penduduk, harus direnovasi dan

Pimpinan Daerah (PD) Muhammadiyah beserta jajarannya sepakat merenovasi secara total bangunan masjid itu. Akhir2005,Sofyanmengisahkan, peletakan batu pertama renovasi masjid itu dilakukan Drs. H. Imal Raya Harahap yang merupakanWakilWali Kota saat itu. “Bangunan masjid berlantai dua dengan ukuran 23 x 23 meter dianggarkan berbiaya Rp4 miliar lebih.Pekerjaanfisiksaatinimasih sekira 40 persen. Meski dalam keadaan darurat, di lantai pertama tetap dilaksanakan sholat fardu berjamaah dan sholat Jumat, sedang lantai dua sudah dicor dan tiang-tiang penyangganya

Waspada/ist

BANTUAN pembangunan Masjid Taqwa Pematangsiantar diserahkan Pimpinan Cabang Asuransi Jasindo Mohammad Isnaeni (kiri) kepada Ketua Panitia Sofyan Rizal (kanan) disaksikan para pengurus PD Muhammadiyah di lokasi masjid, baru-baru ini.

sudah berdiri kokoh.” Bagi yang ingin menyumbang, berwakaf, berinfak dan bersedekah untuk kelanjutan pembangunan MasjidTaqwa itu, Sofyan menyebutkan dapat diantarkan kepada panitia yang senantiasa ada di sekretariat MasjidTaqwa serta dapat melalui rekeningBankMuamalatdengan nomor rekening 0169174051 atas nama Sofyan Rizal cq Panitia PembangunanMasjidTaqwaMuhammadiyah Pematangsiantar dan Bank Sumut dengan nomor rekening220.02.04.0091167-7atas nama Panitia Pembangunan Masjid Taqwa Muhammadiyah Pematangsiantar. Selain infaq dan iuran tetap dari anggota/simpatisan Muhammadiyah dan donator untuk pelaksanaan pembangunan Masjid Taqwa itu, bantuan terus mengalir dari berbagai penjuru. Seperti baru-baru ini, atas persetujuan BUMN Asuransi Jasindo Cabang Pematangsiantar melalui Pimpinan Cabang Mohammad Isnaeni menyerahkan bantuan berupa cek Rp25 juta. Ketua Panitia Sofyan Rizal menerima langsung bantuan itu dan disaksikan Wakil Ketua PD Muhammadiyah Zainal Siahaan, SE, Sekretaris Sugiharto Hadi, SH serta Ketua Majelis Pustaka dan Informasi Zulhanif Al. Selain itu, saat pelantikan PD Pemuda Muhammadiyah Pematangsiantar, Ketua PP Pemuda Muhammadiyah DR. H. Saleh Daulay, M.Ag, M.Hum secara spontan berinfak ke Masjid Taqwa Rp2 juta. (a30)

Waspada/Edoard Sinaga

UCAPAN selamat disampaikan Danrem 022/PT Kolonel Inf Karsiyanto didampingi Ny. Desy Karsiyanto kepada para perwira yang naik pangkat di aula Makorem 022/PT.

Tujuh Periwira Korem 022/PT Naik Pangkat PEMATANGSIANTAR (Waspada): Tujuh perwira Korem 022/PT naik pangkat periode 1 April 2012, sedang kenaikan pangkat Bintara dan Tamtama untuk UKP PDW mencapai 64 orang. Kenaikan pangkat Bintara dan Tamtama ini terdiri Pelda ke Peltu 12 orang, Sertu ke Serka 13 orang, Serda ke Sertu 11 orang, Koptu ke Kopka lima orang, Kopda ke Koptu 19 orang, Pratu ke Praka 2 orang dan Prada ke Pratu 2 orang serta UKP Pusat sebanyak 134 orang terdiri Serma ke Pelda 34 orang, Serka ke Serma 56 orang dan Praka ke Kopda 44 orang. “Kenaikan pangkat merupakan wujud pengakuan, kepercayaan dan penghargaan atas dedikasi, loyalitas, prestasi, kapabilitas seseorang dalam pengabdiannya kepada organisasi,” tegas Danrem 022/PT Kolonel Inf Karsiyanto dalam laporan korps kenaikan pangkat perwira dan lainnya jajaran Korem 022/PT di aula Makorem 022/PT, Senin (2/4). Karena itu, lanjut Danrem, kenaikan pangkat harus mampu meneguhkan komitmen dan tekad personel yang bersangkutan untuk terus meningkatkan kualitas pengabdiannya kepada organisasi di mana ia ditugaskan. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menyebutkankenaikanpangkatitudapatdijadikan wahana introspeksi untuk meraih kearifan dan

mewujudkan keutamaan serta kemuliaan hidup sebagaiprajuritSaptaMargayangmengedepankan kepentingan tugas di atas kepentingan pribadi. Perwira yang mendapat kenaikan pangkat, sebut Kapenrem, dari Kapten ke Mayor yakni Pasilog Slog Rem 022/PT Mayor Kav Robinson Octovianus Bassie dan Pabung Dim 0209/LB Rem 022/PT Mayor Agus Praminto. Dari Lettu ke Kapten yakni Dantim Intel Rem 022/PT Kapten Czi Januliston, Danramil 07 Dim 0209/LB Kapten Inf Abdul Latip Siregar dan Danramil 16 Dim 0204/DS Kapten Arm Hasian Tamba. Dari Letda ke Lettu yakni Paur Prod Penrem 022/PT Lettu Inf Yulieti Nazara dan Danton Kom Kima Yonif 126/KC Lettu Inf FE. Putra Irawan. Danrem 022/PT pada saat kenaikan pangkat itu turut memberikan bantuan pembangunan perumahan prajurit, khususnya kepada Kompi AYonif 126/KC. Saat ini perumahan prajurit yang selesai dibangun dan siap huni sebanyak empat unitdandirencanakanlimaunitlagiakandibangun dalam waktu dekat ini. Bantuan itu diterima langsung Danyonif 126/ KC Letkol Inf Victor Tampubolon. “Mudahmudahan kerja keras dan upaya Danrem 022/ PT untuk mensejahterakan prajurit dapat terlaksana dengan baik dan mendapat ridho dari Tuhan Yang Maha Esa,” harap Kapenrem. (a30)

Masjid Nurul Awwaliyah Butuh Dana Renovasi KABANJAHE (Waspada): Masjid Nurul Awwaliyah yang terletak di Desa Payung Kec. Payung, Kab. Karo membutuhkan bantuan dana renovasi dari pemerintah maupun masyarakat. Masjid berdiri tahun 1989 dengan dana swadaya masyarakat Islam dari berbagai kalangan baik dari pemerintah maupun dari masyarakat, baik dari Kab. Karo maupun dari luar daerah. Seiring dengan perkembangan dan pertambahan jumlah umat Islam di Desa Payung yang sekarang sekitar 150 kepala keluarga (KK) maka pengurus masjid dan umat merasa perlu melakukan renovasi dengan memperluas bangunan menjadi 8 x 8 meter dan teras dari 2 meter menjadi 4 meter, serta melakukan perbaikan sisi bangunan lainnya yang sudah

termakan usia. Menurut Camat Payung Tony Sembiring, SH sebagai salah satu pelindung untuk renovasi masjid kepada Waspada di kantor Bupati Karo Jalan Djamin Ginting. S, Kabanjahe, diperkirakan biaya renovasi masjid Rp171 juta. Sementara ini dana yang terkumpul dari swadaya umat dan masyarakat lainnya baru sekira Rp20 juta, dengan kekurangan Rp151 juta. Bagidonatordimanapunberadayanghendak memberikan bantuan biaya, pihak panitia telah membukarekeningatasnamaBadanKemakmuran MasjidDesaPayungKecamatanPayungKabupaten Karo Nomor : 5279-01-399-53-6 melalui BRI unit Tiganderket, dengan kontak person M Yusup Sitepu,S.Pdi HP 0852 7553 0155. (c09)

Peran Perempuan Pakpak Bharat Ditingkatkan PAKPAK BHARAT (Waspada): Untuk meningkatkan peran-serta dan kualitas perempuan di Kabupaten PakpakBharat,TimPenggerak PKK ( TP PKK) Provinsi Sumatera Utara upgrade TP Kabupaten Pakpak Bharat yang dilaksanakan melalui kegiatan supervise mulai tingkat desa hingga tingkat Kabupaten Pakpak Bharat. Acara tersebut diselenggarakan di aulaPemkab Pakpak Bharat, baru-baru ini, dengan narasumber berasal Waspada/Saut Boangmanalu dari TP-PKK Sumut dihadiri TIM Supervisi TP PKK Provinsi Sumatera Utara pada acara Ny. Bidasari Bachrumsyah Kegiatan Supervisi TP PKK Pakpak Bharat beberapa waktu lalu selaku ketua tim dengan para di aula Pemkab Pakpak Bharat. anggotaJunaidarRistanto,Dra. Kaniah dan Ny. Farida Kalsum Washington benar-benar serius mengikuti kegiatan ini karena akan berguna jika diaplikasikan untuk diri sendiri, Tambunan. Para narasumber tersebut memberikan keluarga dan masyarakat. Pada kesempatan tersebut Kepala Bidang supervisi terhadap keseluruhan pokja yang ada pada PKK serta memberikan muatan adanya Pemberdayan Perempuan Maranatha M Padang, kegiatan berskala nasional termasuk perlombaan S.Pd, M.Si mengutarakan, kegiatan ini sejalan dengan visi dan misi Kabupaten Pakpak Bharat –perlombaan bagi ibu-ibu PKK. Dalam sambutannya ketua TP-PKK Pakpak sebagaimana sering disampaikan Bupati Pakpak Bharat Made Tirta Kusuma Dewi, S.Sos yang Bharat Remigo Yolando Berutu, MBA yaitu disampaikan oleh Wakil Ketua TP PKK Ibu H. peningkatan dan penguatan peran perempuan Idahliani Sagala meminta seluruh peserta agar dalam pembangunan. (csb)

Aksi Bajing Loncat Di Jalinsum Langkat Dan Binjai Meresahkan LANGKAT (Waspada): Aksi bajing loncat di Jalinsum Langkat dan Binjai kian meresahkan sopir truk. Pelaku yang mengendarai sepedamotor dengan piawai melompat dari belakang truk kemudian menjarah barang-barang bernilai ekonomis dari truk yang lagi melaju. Seperti yang dialami, Mastura, sopir truk BL 8879 AA. Truk yang bermuatan pupuk ini, Minggu (1/4) tengah malam, yang truknya disatroni bajing loncat dan kejadian ini telah dilaporkan sopir ke kepolisian setempat di P.Brandan. Aksi bajing loncat ini tidak hanya merugikan pemilik barang, tapi juga meresahkan bagi pengguna jalan yang kebetulan sedang melintas. Pelaku seenaknya mengambil barang dari dalam truk dan melemparkan ke sisi jalan tanpa mempedulikan keselamatan pengguna jalan. Menurut sopir, peta daerah rawan bajing

loncat mulai dari kawasan Jalinsum Securai, Gebang, Tanjungpura, Hinai, sampai ke Jalan Megawati, Binjai. Sementara, eskalasi kejahatan serupa di daerah perbatasan Sumut-Aceh, tepatnya Besitang diakui sopir belakangan ini cenderung menurun. Sopir yang enggan disebutkan identitasnya itu mengatakan, untuk mengantisipasi aksi bajing loncat, mereka terpaksa menempatkan kernet di atas barang. “Pelaku bajing tidak berani melompat ke atas truk kalau melihat ada kernet yang berjaga,” ujarnya meminta polisi agar meningkatkan patroli. Kapolsek P.Brandan, AKP HM Kosim Sihombing ketika hendak dikonfirmasi Waspada terkait adanya pengaduan sopir yang menjadi korban bajing loncat tidak dapat dihubungi, sebab handphone yang bersangkutan tidak aktif. (a02)

Ekonomi & Bisnis

WASPADA Rabu 4 April 2012

B5

Pakai Premium, Mobil Dinas Siap-Siap Terima Sanksi JAKARTA (Waspada): Pemerintah akan menerbitkan aturan yang melarang kendaraan dinas pemerintah menggunakan Bahan Bakar Minyak (BBM) bersubsidi. Aturan ini dibuat agar terjadi penghematan di tubuh Kementerian Lembaga (K/L). Menteri Koordinator Bidang Perekonomian Hatta Rajasa mengungkapkan, saat ini aturan tersebut tengah dikembangkan. Nantinya, sekretaris kabinet akan mematangkan melalui Instruksi Presiden (Inpres) atau Peraturan Presiden (Perpres). “Itu nanti disusun. Kendaraan dinas tidak lagi (menggunakan premium). Sehingga

nanti ada penghematan,” ungkap Hatta di Kantor Presiden, Jalan Medan Merdeka Utara, Jakarta, Selasa (3/4) Maksud Hatta, dengan tidak diizinkannya kendaraan dinas menggunakan premium dan adanya pemotongan anggara pada K/L maka akan menekan perjalanan dinas. “Oleh karena itu maka perjalanan (dinas) pun

akan berkurang,” tambah dia. Meski begitu, dia mengatakan di beberapa daerah memang kendaraan dinas masih diizinkan menggunakan premium karena belum tersedianya pertamax. “Kalau itu ya kita harus maklumi. Tidak mungkin, masa dia berhenti beroperasi. Penghematan itu tidak perlu diatur tapi melekat pada diri kita,” jelas Hatta. Dengan adanya aturan tersebut, maka mobil dinas yang masih menggunakan premium nantinya bisa terkena sanksi. “Kalau level pemerintah, kita bisa memberikan sanksi soal itu,” tukas Hatta Hak Mereka Hatta menambahkan, har-

Mobil Mewah Beralih Ke Premium MEDAN (Waspada) : Melejitnya harga bahan bakar minyak (BBM) jenis Pertamax sebesar Rp650 ke level Rp10.200 per liter dipastikan akan menyebabkan terjadinya lonjakan pada konsumsi BBM bersubsidi. Saat ini pemilik mobil mewah di Kota Medan kini lebih memilih menggunakan bahan bakar minyak jenis premium karena harga Pertamax yang semakin melangit. Pantauan Waspada, Selasa (3/4), di beberapa stasiun pengisian bahan bahar untuk umum (SPBU) tampak menonjol deretan mobil-mobil mewah dari berbagai merek antri mengisi Premium. Beberapa diantaranya mengisi Premium bersubsidi seharga Rp4.500 per liter dan dicampur dengan Pertamax. Saat ditemui, Wawan salah satu pemilik mobil Honda Jazz mengatakan harga Pertamax kini melambung tinggi mencapai Rp10.200 per liter jadi dirinya kini beralih ke jenis Premium karena harganya murah hanya Rp4.500 per liter. “Sampai sejauh ini tidak ada larangan bagi kami untuk ikut membeli BBM Premium yang diperuntukkan bagi golongan menengah ke bawah tersebut. Berarti siapa saja boleh membeli, Itu kan sifatnya hanya himbauan bukan larangan,” ujarnya saat melakukan pengisian di SPBU Jalan Brigjen Katamso Medan.

Hal senada diakui Jimmy, salah satu pemilik mobil Honda CR-V, saat melakukan pengisian di SPBU Jalan Pasar Merah Medan. Dikatakannya, pengisian ini boleh dilakukan oleh siapa saja yang memiliki kendaraan. Tapi jika pemerintah memberikan sangsi kepada pemilik mobil mewah jika ketahuan mengisi premium, maka dirinya akan menaati aturan tersebut. “Sebelumnya pemerintah hanya menghimbau saja mengenai hal tersebut, namun tidak melarang. Jadi, ya sah-sah saja menurut saya,” ujarnya. Sebelumnya, pihak Pertamina mengusulkan pembatasan kendaraan yang boleh menggunakan BBM subsidi. Kendaraan yang bermesin 2.000 cc dan keatasnya rencananya dilarang menggunakan BBM subsidi. Demikian dipaparkan Direktur Pemasaran dan Niaga Pertamina Ahmad Faisal dalam RDP dengan Komisi VII di Gedung MPR/DPR, Jakarta beberapa waktu lalu. Mekanisme pembatasannya dilakukan dengan memberi tanda pada plat nomor kendaraan. Selain itu, Pertamina juga mengusulkan pembatasan konsumsi BBM untuk kendaraan tertentu berdasarkan tahun pembuatannya. Namun ia tidak menyebutkan mulai tahun berapa kendaraan yang akan dibatasi penggunaan BBM subsidinya. (Cdu).

Tren Intermediasi Perbankan Sumut Meningkat MEDAN (Waspada): Aset perbankan di Sumatera Utara terus mengalami peningkatan yang dipicu dengan pertumbuhan dana pihak ketiga (DPK) dan penghimpunan kredit perbankan. Pada Februari 2012 tercatat aset perbankan mencapai Rp160,20 triliun, meningkat 1,36 persen dibandingkan bulan sebelumnya sebesar Rp158,05 triliun. “Meningkatnya aset perbankan menunjukkan proses intermediasi perbankan Sumatera Utara berada pada tren yang meningkat pula,” kata Kepala Bidang Ekonomi dan Moneter Bank Indonesia (BI) Regional Sumut-Aceh Mikael Budisatrio, kemarin. Mikael menjelaskan, aset sebesar Rp160,20 triliun itu terdiri dari aset bank konvensional Rp153,68 triliun dan bank syariah Rp6,52 triliun. Sementara itu, dana pihak ketiga (DPK) perbankan Sumut juga mengalami peningkatan sebesar 01,49 persen (mtm) menjadi Rp128,05 triliun dibanding Januari sebesar Rp126,17 triliun yang dihimpun bank konvensional Rp123,54 triliun dan bank syariah Rp4,51 triliun. “Pertumbuhan ini tidak terlepas dari peningkatan pada komponen DPK terutama tabungan,” katanya.

DPK Februari 2012 itu terdiri dari, tabungan sebesar Rp53,42 triliun, naik 2,30 persen dibanding posisi Januari sebesar Rp53,42 triliun. Deposito Rp52,03 triliun, naik 0,56 persen dibanding Januari sebesar Rp51,74 triliun. Giro sebesar Rp21.37 triliun, naik 1,71 persen dibanding bulan sebelumnya Rp21,01 triliun. Meski saat ini perbankan Sumut didominasi perbankan konvensional (96,48 persen dari total DPK), namun pertumbuhan DPK perbankan syariah dibanding tahun lalu juga mengalami peningkatan cukup pesat hingga mencapai 54,55 persen. “Tren penurunan suku bunga terutama untuk komponen tabungan dan deposito tidak berpengaruh signifikan terhadap penghimpunan DPK perbankan,” jelasnya, seraya mengatakan, hal ini menunjukkan instrumen tabungan dan deposito masih menjadi pilihan masyarakat kendati terjadi penurunan tingkat suku bunga atau imbal hasil. Faktor keamanan dalam instrumen tersebut diperkirakan menjadi pertimbangan penting bagi masyarakat untuk menyimpan dana. Mikael menambahkan, seiring dengan tren penurunan suku bunga kredit perbankan, maka penyaluran kredit me-

ngalami peningkatan dibanding bulan sebelumnya.Tingkat suku bunga perbankan pada priode ini tercatat sebesar 11,69 persen, lebih rendah dibanding dengan rata-rata tingkat suku bunga pada kurun waktu dua tahun terakhir tercatat sebesar 12,05 persen. Nilai nominal penyaluran kredit pada Februari sebesar Rp106,04 triliun, meningkat 0,92 persen (mtm) atau 16,46 persen (yoy). Share perbankan konvensional sebesar 95,31 persen dan share perbankan syariah terhadap total kredit/pembiayaan adalah 4,69 persen. Kualitas kredit perbankan masih terjaga dengan baik yang terlihat dari rasio gross non performing loans (NPLs) pada posisi Februari 2012 tercatat hanya sebesar 2,32 persen. Sementara itu, LDR perbankan Sumut tercatat sebesar 82,81 persen. Dukungan kredit perbankan terhadap sektorsektor ekonomi di Sumut masih menunjukkan peningkatan terutama untuk sektor perdagangan, hotel dan restoran yang mengalami peningkatan tertinggi sebesar 4,57 persen. “Hal ini menunjukkan masih tingginya kinerja sektorsektor ekonomi di Sumut,” pungkas Mikael Budisatrio. (m41)

Sumut Masih Krisis Gas MEDAN (Waspada): Pengusaha yang tergabung dalam Asosiasi Pengusaha Indonesia (Apindo) maupun Asosiasi Perusahaan Pemakai Gas (Apigas) Sumatera Utara menolak keinginan pemerintah yang akan merelokasi proyek terminal penerima gas terapung atau Floating Storage Receiving Unit (FRSU) Belawan ke Lampung. “Kadin dan Apindo jelas keberatan jika proyek FRSU itu dipindahkan ke Lampung karena Sumut sendiri masih krisis terhadap gas,” kata Ketua Apindo Sumut Parlindungan Purba, Selasa (3/4). Parlindungan Purba yang merupakan anggota Dewan Perwakilan Daerah (DPD) RI asal Sumut ini mengaku terkejut dengan rencana pemindahan proyek FSRU Belawan ke Lampung. Padahal, kata Parlindungan, dalam audiensinya ke Kementerian Energi Sumber Daya Mineral pada 8 Maret 2012, Dirjen Migas Kementerian ESDM Evita Legowo masih menyatakan FSRU Belawan itu merupakan solusi mengatasi krisis gas di Sumut.

Dia mengatakan, pembangunan FSRU Belawan merupakan amanat dari Instruksi Presiden Nomor 1 Tahun 2010 tentang Percepatan Pelaksanaan Prioritas Pembangunan Nasional Tahun 2010. Inpres juga mengamanatkan pembangunan FSRU Teluk Jakarta, FSRU Jawa Tengah. Parlindungan mengatakan, bahkan saat itu Evita menegaskan pemerintah pusat telah membentuk satuan tugas (task force) yang khusus tentang pengadaan FSRU sehingga dapat dipastikan pembangunannya dan akan beroperasi mulai tahun 2013. “Saya akan pertanyakan lagi dan berharap apapun permasalahannya yang penting krisis gas di Sumut harus sudah bisa diatasi pada tahun depan sesuai janji pemerintah,” katanya. Selaku Ketua Apindo Sumut dan anggota Komite II DPD RI yang membidangi sumber daya alam dan sumber daya ekonomi, Parlindungan juga akan menyurati Menteri BUMN Dahlan Iskan agar proyek FRSU itu jangan dipindahkan ke Lampung. Dia bahkan akan

mengatur pertemuan dengan Menteri BUMN di Jakarta untuk membicarakan masalah ini. Alasannya, menurut Parlindungan, krisis gas sampai sekarang masih menjadi masalah dan akan terus berlanjut hingga tahun 2013 apalagi dengan tidak adanya FRSU di Belawan. “Proyek yang sudah ada dipindahkan, tentu akan membuat Sumut makin krisis gas,” tegasnya. Kalau dipindahkan ke Lampung menurutnya, pasokan gas ke Sumut membutuhkan waktu lama dan biaya besar. Padahal kebutuhan gas di daerah ini cukup besar, terutama untuk industri keramik dan sarung tangan. Memang menurut Parlindungan, pemerintah memberikan solusi dimana Pertamina diminta melaksanakan revitalisasi terminal LNG Arun dan membangun pipa gas ArunSumatera Utara yang harus rampung akhir tahun 2013. Untuk itu, ia juga minta Pertamina menjelaskan kepada masyarakat kalau gas Arun, ya untuk kebutuhan daerah itu, sedangkan FRSU Belawan buat Sumut.(m41)

ga Pertamax kembali melambung akibat tingginya minyak dunia. Hal ini, tentu saja membuat disparitas antara Pertamax dan Premium makin tinggi. Hasilnya, beberapa mobil mewah lebih memilih premium ketimbang Pertamax. Menanggapi hal ini, Menteri Koordinator Bidang Perekonomian Hatta Rajasa mengungkapkan, dalam Undang-Undang (UU) memang dibenarkan pengisian premium tersebut. “Mereka memiliki hak untuk menggunakan itu. Kita sudah mencoba BBM dinaikkan agar tidak ada migrasi, tapi karena semua mengatakan tidak perlu naik dan APBN-P ditetapkan. Maka peluang perpindahan (Pertamax ke Premium) itu besar sekali,” ungkap Hatta di Kantor Presiden, Jalan Medan Merdeka Utara, Jakarta, Selasa (3/4). Hatta mengungkapkan, dengan adanya bukti di media massa mengenai premium yang

digunakan oleh mobil mewah, makin menegaskan jika subsidi tidak tepat sasaran. “Karena subsidi ratusan triliun digunakan oleh masyarakat yang sebenarnya mampu, tidak perlu disubsidi,” tegas dia. “Nah sekarang kita harus, terutama media, memberikan sosialisasi supaya masyarakat melihat, masa iya mobil mewah menggunakan BBM bersubsidi,” tukas Hatta. Diberitakan sebelumnya, semakin tingginya disparitas harga dengan BBM nonsubsidi diyakini bakal membuat konsumsi BBM bersubsidi semakin tinggi. Konsumsi bahkan diperkirakan melebihi kuota dalam APBN-Perubahan 2012. Semakin lebarnya disparitas harga, kata dia, dikhawatirkan mendorong konsumsi BBM bersubsidi yang dalam APBNP 2012 asumsi volumenya ditetapkan sebesar 40 juta kiloliter (kl). (okz)

Rumah Murah Dibangun Di 50 Kabupaten/Kota JAKARTA (Waspada): Pemerintah menugaskan Perusahaan Umum Perumahan Nasional (Perum Perumnas) untuk membangun rumah murah dan sederhana sebanyak 100 ribu unit di 50 Kabupaten/Kota di seluruh Indonesia. Pembangunan tersebut sejalan dengan program yang dicanangkan Presiden Susilo Bambang Yudhoyono untuk mendorong penyediaan rumah murah bagi masyarakat berpenghasilan rendah maupun PNS, TNI, dan Polri. “Perumnas sanggup dan siap melaksanakan tugas membangun rumah murah dan sederhana di seluruh Indonesia. Hal ini sejalan dengan visi misi Perumnas untuk menjadi pelaku utama perumahan dan sebagai pengembang properti terbesar di Indonesia,” ujar Direktur Utama Perumnas, Himawan Arief Sugoto saat ditemui di Kementerian Dalam Negeri, Jakarta, Selasa (3/4). Himawan mengharapkan, pembangunan rumah murah dan sederhana seperti di Kabupaten Pidie, Aceh Tenggara, Nias, Tapanuli Tengah, Bengkulu Selatan, Kapuas, Temanggung, Purworejo, Pacitan, Malang, Banyuwangi, Karangasem, Kota Batam, Kota Samarinda, Kota Tarakan, Kota Balikpapan, Kota Palu, Kota Kendari, Kota Kupang, Kota Mataram, Kota Ternate, Gorontalo, Majene, Halmahera, dan Kota Palembang tersebut dapat dilaksanakan dalam waktu dekat ini. “Pertengahan 2012 dan direncanakan dapat selesai dua tahun ke depan,” kata Himawan. Kerjasama Pemda Dia menambahkan, dalam mendukung program rumah murah di 50 Kabupaten/Kota, Kementerian Perumahan Rakyat meminta Perumnas bekerja sama dengan pemerintah daerah. “Nantinya, Kementerian Perumahan Rakyat akan memberikan bantuan penyediaan sarana prasarana umum sehingga Perumnas hanya ditugaskan menyediakan bangunan fisik rumah di atas lahan yang sudah matang dan siap bangun yang telah disediakan Pemerintah Daerah,” kata Himawan. Himawan menjelaskan, rumah murah yang dibangun Perumnas bertipe 36 meter persegi dengan luas minimal 60 meter persegi. “Sedangkan untuk penentuan harga jual akan dilakukan koordinasi antara Kemenpera, Perumnas dan Pemda,” tuturnya. (vvn)

Harga Minyak Melandai SINGAPURA (Waspada): Minyak mentah berjangka ditutup turun dibawah 105 dolar AS per barel, setelah naik tajam di sesi sebelumnya, disokong data manufaktur dari Amerika Serikat (AS) dan Cina, dua konsumen minyak terbesar di dunia. Minyak mentah West Texas Intermediate (WTI) untuk pengiriman Mei turun 33 sen ke 104,90 dolar AS per barel, setelah sempat melonjak 2,21 dolar AS ke 105,23 dolar AS per barel. Sementara minyak mentah Brent London untuk pengiriman Mei merosot 32 sen menjadi 125,11 dolar AS per barel, setelah naik 2,55 dolar AS pada 125,43 dolar AS per barel. Mengutip Reuters, Selasa (3/4), Indeks Institute for Supply Management dari aktivitas pabrik AS naik menjadi 53,4 pada Maret dari 52,4, melampaui ekspektasi ekonom dan tetap berada di atas angka 50, mengindikasikan adanya ekspansi di sektor ini. Produsen minyak utama Inggris BP (BP.L) mengatakan, pihaknya telah menutup platform Valhall di Laut Utara pekan lalu. Penutupan ini, menyebabkan penundaan pasokan salah satu dari empat aliran minyak mentah yang digunakan untuk patokan harga global. Energy Information Administration mengatakan, permintaan minyak AS pada bulan Januari memang lebih tinggi dengan 169.000 barel per hari (bph) dari perkiraan sebelumnya, masih 4,46 persen dari target 853.000 barel per hari. Selain itu, Menteri Perminyakan India, S. Jaipal Reddy, mengatakan India akan mengimpor lebih banyak minyak dan gas dari Qatar. Setidaknya tiga perusahaan Jepang, termasuk dua penyuling minyak, tidak akan mengambil minyak dari Iran pada April karena adanya tekanan dari AS untuk membatasi pembelian. (okz)

Bank Bukopin Luncurkan Program Tabungan Berhadiah MEDAN (Waspada): PT Bank Bukopin Tbk meluncurkan Program Tabungan SiAga Bukopin Berhadiah BMW 320i dan Honda Scoopy dihadiri para nasabah dan nasabah prioritas di Pendopo Hall Medan Club, Selasa (3/4). Program ini merupakan aktivitas marketing komunikasi guna mensosialisasikan kepada seluruh masyarakat Indonesia karena serentak dilakukan di seluruh cabang provinsi. Pemimpin Cabang Bank Bukopin Medan Agus Gunarto menyebutkan, periode program tersebut mulai berjalan dari 1 April hingga 30 November 2012. Bank Bukopin setiap bulannya memberikan hadiah 1 unit mobil BMW 320i dan 42 motor Honda Scoopy kepada nasabah pemegang Tabungan SiAga melalui mekanisme undian. Program Tabungan SiAga Bukopin behadiah dengan Tagline “Program Really Love SiAga, Never Leave Bukopin”, sebagai apresiasi kepada penabung Tabungan SiAga Bukopin yang memiliki loyalitas tinggi dan mengajak nasabah untuk membiasakan menabung dan bertransaksi melalui fasilitas e-Banking. “Target pasar program ini adalah komunitas di kalanganYoung Profesional seperti pelajar dan eksekutif muda dalam rangka mengembangkan customer based,” papar Agus Gunarto. Program Tabungan SiAga Bukopin kali ini dibagi dalam dua kategori undian, yang pertama Undian berhadiah BMW 320i dapat diikuti seluruh nasabah yang memiliki minimal salah satu dari produk Tabungan SiAga Bukopin, Tabungan SiAga Bukopin Kerjasama, Tabungan SiAga Bukopin Bisnis Perorangan, Tabungan SiAga Bukopin Premium dan Tabungan Rencana Bukopin. Kedua, undian berhadiah Honda Scoopy diperuntukkan bagi nasabah yang memiliki salah satu produk Tabungan SiAga Bukopin, Tabungan SiAga Bukopin Kerjasama, Tabungan SiAga Bukopin Bisnis Perorangan. (m41)

Waspada/Armansyah Th

Regional Operation Manager PT GMI Phillo Arihta Tarigan (kiri) pose disamping Chevrolet Orlando, usai peluncuran di Medan, kemarin.

MPV Chevrolet Meluncur Di Medan MEDAN ( Waspada): PT General Motors Indonesia (GMI) bersama Mega Autoworld meluncurkan kendaraan penumpang (MPV) New Chevrolet Orlando dan All New Chevrolet Colorado di Medan, Selasa (3/4). Chevrolet Orlando adalah kendaraan jenis MPV (Multi PurposeVehicle) medium pertama yang dibuat General Motors, sedangkan Chevrolet Colorado merupakan kendaraan pick-up ringan (double cabin). Regional Operation Manager PT GMI, Phillo Arihta Tarigan mengatakan kemarin, Medan merupakan kota kedua di Tanah Air sebagai tempat peluncuran Chevrolet Orlando, setelah Jakarta, yang mengindikasikan kota ini sebagai salah satu pasar potensial di luar P. Jawa. Orlando, katanya, merupakan MPV 7 seaters, yang mobil

konsepnya telah diperkenalkan pada 2008. Dengan mengusung banyak kelebihan dibanding kompetitor di kelasnya, Phillo yakin kalau Orlando bakal menjadi pilihan lain dan disukai konsumen. Namun, katanya, Orlando, yang menggendong mesin 1.800 cc akan bermain sendiri di pangsa pasar yang diciptakan. Phillo didampingi Branch Manager Mega Autoworld (dealer di Sumut) Afri Sianturi, dan Agusta Sirait selaku PR & Media Relation Specialist GMI mengakui, pertumbuhan pasar di kelompok MPV medium to high masih terbilang kecil, yakni hanya 5 persen. Namun, seiring perkembangan pasar dan permintaan konsumen, diyakini kendaraan jenis ini akan semakin berkembang. “Dengan hadirnya Orlando, semakin lengkaplah jajaran kendaraan General Motors di

Tanah Air. Apalagi, sekarang juga sudah tersedia Colorado untuk kebutuhan off road,” tambahnya. Malah disebutkan, jajaran kendaraan MPV Chevrolet dipastikan lagi bertambah tahun depan, saat pabrik milik GMI di Bekasi rampung, di mana pabrikan AS ini juga telah mempersiapkan kendaraan penumpang PM7 ((People Mover 7-Seater) untuk bersaing di jajaran low MPV atau sekelas Xenia-Avanza. “Kita akan mengaktifkan kembali pabrik di Bekasi, yang rencananya siap di akhir 2012 dan di 2013 PM7 sudah bisa diproduksi,” tambah Agusta Sirait. Di Me d a n , C h e v r o l e t Orlando dibandrol Rp349,9 juta, sedangkan Colorado masingmasing Rp 289,9 untuk tipe extended cabin, Rp348,9 untuk double cabin LT dan varian tertinggi double cabin LTZ seharga Rp 368,9 juta. (m47)

BPK Catat 318 Kasus Korupsi Rp33,87 T JAKARTA (Waspada): Badan Pemeriksa Keuangan (BPK) mencatat dalam kurun waktu 2003-2011 terdapat 318 kasus korupsi dengan potensi kerugian negara Rp33,87 triliun. Ketua BPK Hadi Poernomo mengatakan, 318 kasus tersebut telah diserahkan kepada instansi berwenang. Dalam hal ini Kepolisian, Kejaksaan, dan Komisi Pemberantasan Korupsi (KPK). “Mereka telah menindaklanjuti 186 kasus berupa pelimpahan kepada jajaran atau penyidik lainnya sebanyak 37 kasus, ekspos, telaahan atau koordinasi sebanyak 21 kasus,” kata dia dalam sidang Paripurna

DPR RI, Senayan, Jakarta, Selasa (3/4). Selain itu, sebanyak 30 kasus telah masuk proses penyelidikan, 10 kasus telah ditangani penyidik, dua kasus masuk proses sidang dan sebanyak 11 kasus masuk ke dalam penuntunan. Sedangkan untuk vonis, banding ataupun kasasi tercatat sebanyak 64 kasus dan SP 3 sebanyak 11 kasus. “Sisa kasus yang belum ditindaklanjuti atau tidak ada data tindak lanjutnya sebanyak 132 kasus,” pungkasnya. Diberitakan sebelumnya, dalam Ikhtisar Hasil Pemeriksaan Semester (IHPS) semester II2011, BPK menemukan 12.612

kasus penyimpangan dengan total nilai Rp20,25 triliun. Dari total temuan pemeriksaan BPK tersebut, sebanyak 4.941 kasus senilai Rp13,25 triliun merupa-kan temuan ketidakpatuhan yang mengakibatkan kerugian, potensi kerugian, dan kekurangan penerimaan. Adapun temuan pemeriksaan berupa ketidakhematan, ketidakefisienan, dan ketidakefektifan sebanyak 1.056 kasus senilai Rp6,99 triliun. Selain itu, BPK menemukan adanya penyimpangan administrasi dan kelemahan Sistem Pengandalian Interen (SPI) sebanyak 6.615 kasus. (okz)

RUU Pangan Dinilai Hambat Iklim Investasi JAKARTA (Waspada): Pengusaha nasional menilai, rancangan Undang-Undang (RUU) tentang Sediaan Farmasi, Pangan Olahan, Perbekalan Kebutuhan Rumah Tangga, dan Alat Kesehatan akan menghambat iklim investasi di Indonesia. Perwakilan US-ASEAN Business Council Rachmat Hidayat mengatakan, saat ini RUU itu masih dalam bentuk draft yang dibahas Badan Legislatif (Baleg). Lalu akan dibahas di DPR RI. Kemudian, setelah final, kata dia, akan disampaikan ke Presiden dan menugaskan Menteri terkait untuk membahasnya lebih lanjut. “Kami berharap, keberatan dan masukan kami bisa dipertimbangkan. Dalam hal ini, semoga Menteri Perdagangan bisa menyuarakan kekhawatiran kami karena aturan itu tidak

mungkin diterapkan. Apakah BUMN siap kalau diberlakukan,” kata Rachmat di Jakarta, Senin (2/4) malam. Dia menambahkan, pihaknya telah diundang oleh Baleg untuk memberikan masukan terkait RUU tersebut. “Dan, kami melakukan konsultasi dengan Kementerian Perdagangan (Kemendag), yakni dengan Dirjen Kerjasama Perdagangan Internasional Imam Pambagyo. Intinya, dalam dua pertemuan itu, kami menyampaikan, RUU itu akan merusak tatanan bisnis di Indonesia,” ujarnya. RUU, lanjutnya, mengatur mengenai pengadaan dan pembuatan pangan olahan untuk anak yang berumur di bawah lima tahun hanya bisa dilakukan oleh Badan Usaha Milik Negara (BUMN) dan semua pembuatan, pengadaan,

dan kegiatan usaha di bidang farmasi hanya bisa dilakukan BUMN. “Namun, ada pasal lagi yang mengatur, perusahaan lain bisa melakukan kegiatan usaha di sektor-sektor itu, asalkan mendapat izin dari Kementerian BUMN,” ucapnya. Dia menilai, hal tersebut membingungkan. “Selama ini, sektor-sektor itu kan sudah regulated, mulai dari BPOM dan Kementerian Kesehatan. Sekarang, ditambah lagi dari BUMN,” tuturnya. Saat ini, kata dia, banyak perusahaan asal Amerika Serikat (AS) yang bergerak di sektor pangan olahan, alat kesehatan, dan farmasi di Indonesia. “Keberatan serupa juga sudah disampaikan oleh Gapmmi dan asosiasi perusahaan nutrisi ibu dan anak,” terangnya. (okz)

BI Diminta Segera Eksekusi Bank Mega JAKARTA (Antara): Kuasa hukum Elnusa, Dodi S Abdulkadir, meminta Bank Indonesia segera mengambil tindakan terhadap Bank Mega dengan memerintahkan mengembalikan dana milik Elnusa sebesar Rp111 miliar atau mengeluarkan surat izin penyitaan aset bank itu. “Pengadilan sudah menetapkan penyitaan aset Bank Mega berupa kantor di Jalan Kapten Tendean. Untuk eksekusi kami tunggu keputusan BI apakah segera memerintahkan Bank Mega membayar dana Elnusa atau mengeluarkan izin penyitaan aset,” katanya di Jakarta, Senin (3/4) malam. Ia berharap dalam dua pekan pertama April 2012, BI sudah melaksanakan tindakan tersebut. Pada kesempatan sama pejabat Inspektorat Pemerintah Kabupaten Batubara, Sumatera Utara, Suhada, juga meminta BI mencairkan dana Bank Mega

untuk mengembalikan deposito berjangka kabupaten itu sebesar Rp80 miliar yang juga raib. Lebih lanjut Dodi mengatakan, pada 22 Maret 2012 PN Jakarta Selatan mengabulkan gugatan PT Elnusa dan memerintahkan Bank Mega segera mengembalikan dana deposito Elnusa senilai Rp111 miliar yang raib. Bank Mega juga dibebani kewajiban membayar bunga sebesar enam persen per tahun hingga putusan berkekuatan tetap. Majelis hakim berpendapat, terhadap dana nasabah, pihak perbankan wajib mengganti kerugian yang dialami nasabah. Jika Bank Mega gagal bayar, maka majelis hakim yang diketuai Ari Jiwantara juga memerintahkan dilakukannya sita jaminan kantor pusat Bank Mega di Jalan Kapten Tendean 12-14A Jakarta Selatan. Terkait upaya banding Bank Mega, Dodi yakin putusan

pengadilan banding, bahkan kasasi, tidak akan berubah karena deposito Elnusa yang raib bukan dicairkan pihak Elnusa dan dokumen pencairannya pun terbukti palsu. “Upaya hukum tak akan mengubah dokumen palsu jadi asli. Proses banding hanya mengulur waktu untuk melaksanakan kewajibannya,” kata Dodi. Dodi juga mengatakan, pihaknya segera mengirim surat ke BI terkait putusan PN Jaksel yang ia yakini juga sudah diketahui BI.“Saya yakin BI akan peka dan melakukan tindakan untuk mencegah potensi kerugian negara dan mencegah kejahatan perbankan,” katanya. Terkait dua kasus itu, sebelumnya BI sudah mengenakan sanksi terhadap Bank Mega serta memerintahkan bank itu untuk membentuk “escrow account” senilai dana Elnusa dan Pemkab Batubara yang pencairannya dilakukan dengan persetujuan BI.

B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

PROMO DAIHATSU TERIOS, XENIA PICK UP ANGSURAN MULAI 2 JT-AN DAPATKAN POTONGAN HARGA UTK PEMESANAN BULAN INI HUB. 0812.653.1129

# PROMO ASTRA DAIHATSU #

Dapatkan New XENIA dgn Cicilan 2 Jutaan TERIOS Cicilan 3 Jutaan, PICK UP DP 7 Jt-an Hub. ANANDA 0853.6165.8235 24 Jam siap melayani

DAIHATSU Sedan Charade Classy Thn. 94. Biru metalik cat asli, AC, CD, P. Steering, P. Window. Central Lock. Orisinil BK Asli Medan. Rp. 34Juta/Nego. 0812 6578 790

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Baleno Th. 1998. Warna merah, AC/Tape/BR/VR, mulus. Hub. 0821 6461 6552 SUZUKI Carry Extra Thn. 92. Alexander Minibus, warna hijau tua. Harga Nego. Hub. 0813 61357 361

TOYOTA BARU

AVANZA, INNOVA, FORTUNER

PURBA : 0813 9789 4633

!!! TOYOTA Innova,READY Fortuner, Avanza, Yaris, Camry, Dyna BARU Rush, Proses Cepat. Hub. 0853 7388 3777 TOYOTA Corolla Altis Th. 2003 Matic, W. Hitam, AC, Tape, VR, BR, BK Asli Medan, jarang pakai. Mobil sehat, orisinil. Hrg. 145Jt/damai. Hub. 0853 6018 2414

DAIHATSU 100% BARU Ready Stock: Xenia Terios, Grand Max PU/MB. Luxio, Sirion. Data dijemput. Proses Cepat. Hub. 0812 6305 0708

TOYOTA Kijang LX 1.8 Bensin Thn. 2004. AC, VR, PS, CL, Jok kulit, silver, plat BM, Rp. 105Jt. Hub. 0812 6594 2789

BELI DAIHATSU DISINI TEMPATNYA

TOYOTA Kijang Krista Diesel Thn. 2003. Hitam, BK Rp. 152Jt. Hub. 0852 7538 3218

Promo DAIHATSU, Xenia, Terios, Luxio, Barang Ready, Disc Gede. Hub. HASIBUAN 0812 6362 4634

OVER KREDIT: Kijang Innova Type E Tahun 2011, bensin, hitam, terawat, sisa credit 1 thn. Cicilan 8,5Jt. per bulan. Minat Hubungi: 0821 6032 7757

DAIHATSU “APRIL DP SUPER RINGAN”

TOYOTA Kijang Thn. 96 Dijual. Warna abu2 metal asli. Ada AC- Tape. Hub. 0812 6014 8035 - 061.7354 679 TOYOTA New Vios, Yaris, Altis, Fortuner, Dyna, Bisa Tukar Tambah. Hub. Khadafi. 0812 6029 0887 TOYOTA Kijang Commando Short thn. 92 Dijual. Jarang pakai, original, warna hijau. Hub. 0852 7083 3002

Xenia, Terios, Sirion...DP 20 Jt-an /Angs. 2 Jt-an Luxio, Gran Max, Pick Up...DP 10 Jt-an & 8 Jt-an Hub. RIAN 0812 6383 691 / HARRY 0811 600 1946 Proses Cepat, “Dapatkan Penawaran Khusus” DAIHATSU Xenia XI Sporty Dijual. Hitam Thn. 2004. Mobil pribadi, mulus, mesin terawat. 115jt Nego. Honda Mega Pro 2010 Hitam, mulus, terawat, BK Panjang 1 tangan. 16 Jt Nego. Hub. 0852 7518 7773 - 0813 6230 3828

TOYOTA Kijang Grand Extra 1.5 Thn. 1995. Orisinil, mutasi Jakarta Rp. 69Jt. Nego. Jl. Puri No. 153. HP. 0853 6205 6834 / 0812 6358 9272

ISUZU Panther Th. 2001, Wrn Biru metalik Tua. Hrg. 100Jt. Nego. AC, Tape, Velg Racing. HP. 0813 6212 2339 ISUZU Panther Total Assy 95 Hijau metalik Hrg. 52Jt. HP. 0853 7394 6872

TOYOTA Kijang Komando NCH Th. 92/93 Dijual. W. Biru metalic, AC, Velg Krista. BR, Tape, sangat mulus (nego). Hub. 0853 7088 8210

MITSUBISHI ETERNA 90 BK Medan, Warna hijau lumut, original, kondisi mulus. Hub. 0821 6399 3022

TOYOTA Kijang Super G Th. 1995/1996. Short 1800cc, BK X Mutasi W. Biru met. Tape, AC, SLK. Mulus, Rp. 65 Juta Nego. Hub. 0813 6227 1115. Jl. Amaliun Dpn SD Kartini No. 146

MITSUBISHI 100% BARU Mobilnya juragan cari untung. Pajero Sport, Strada Triton, T120, L300, Colt Diesel dan Fuso PROMO DAHSYAT !!! Kepada yang berminat Bpk/Ibu Calon Juragan silahkan menghubungi: Ayub Supriadi Meliala : 0853 5923 2999 -0813 9773 2729 - 0857 6309 9387

TOYOTA Rush 1,5 S, Th. 09. Warna silver, 1 tgn dari baru, mobil cantik sekali Rp. 185Jt. 0813 6089 4043

NISSAN Livina XR Manual Thn. 2008. Biru met, BK Rp. 132Jt. Hub. 9132 7433 NISSAN READY STOCK

Dapatkan Nissan Xtrail DP Murah 50 Jt-an atau Angsuran 7 Jt-an + Kredit s/d 5 tahun. Hub. 0821 6766 3019 - 0856 6403 0019

SUZUKI Carry th. 97 Adiputro dijual. W. Abu2 metalic, VR, BR, Tape, kondisi mulus Rp. 29,5Jt (Nego). Hub. 0853 6172 0189

SUZUKI Katana GX Tahun 1993, Abu-abu metalik, VR, Ban besar, BK Medan, AC, PS, Tape Pioneer, Kembali 17,5 Jt Net Sisa 17 kali @ 1,9Jt. Hub. 0877 8146 5758

TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th. 2002, Silver Gold, sgt mulus, VR 17 Import, BR, PS, PW, CL, RMT, E. Miror, AC DB, Full sound, Pake TV, ada 3. Harga 132Jt Nego Abis. Hub. 0812 6324 8577

FORTUNER Matic Th. ‘07. Bensin, wrn silver met, pakai TV, Power komplit, 1 tangan dari baru, Rp. 278Jt. Depan Sekolah Eria No. 200. 0815 337 33688 / 7851402

BURSA BUTUH DANA BUTUH DANA Jaminan BPKB mobil, Pick-Up, truck, intercooler, data lengkap. Proses cepat. Hub. 0853 597 11000 BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

Rp. 91.000 Rp. 104.000

DANA CEPAT....!

Pencairan 1Juta - 10 milyar. Tanpa Usaha. Proses Max. 1 Hari Cair, Jaminan: SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk (Bantu Pelunasan BPKB). Hub. RAY 0813 7044 6633, 0813 7044 6668

SUZUKI MOBIL BARU

Carry Pick Up, Ertiga, APV Arena Cash/Credit DP Rendah, Angsuran Ringan. Hub. 0852 7084 7017

DAIHATSU Zebra 1.3 Thn. 96. Pintu belakang, biru/silver, AC Dingin, Tape, jok kulit, mesin sehat, cocok buat usaha. Rp. 22,5Jt/Nego. Hub. 0812 65 78790

All Gran Max Pick Up. DP 8 Jutaan sudah dgn angs. 1 (38 bulan). All New Xenia DP 20Jt-an Angs. Rp. 3Jt-an Proses Cepat, Data Dijemput, Mobil diantar. Hub: AHMAD NASUTION ASTRA DAIHATSU 0812 6005 2465 (24 Jam)

7 CM 8 CM

BURSA

SEPEDA MOTOR YAMAHA Vega-R 2005 Cakram, masih mulus, warna biru, standard, siap pakai. Harga 5,35Jt/Nego. Hub. 0878 6887 8265

YAMAHA New Scorpio Z. Thn. 2011. Merah, bln 6. Rp. 21Jt. Nego. Hub. 0813 6131 4188

BURSA

SERVICE/ASESORIS MOBIL

PROMO SARUNG JOK MOBIL SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO PROMO 1 PROMO II PROMO III PROMO IV

SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

9 CM Rp. 126.000 10 CM Rp. 140.000

ELITE MOTOR

BURSA

KOMPUTER TOSHIBA 14” Dvd& hp=2,7Jt - Diskon jadi 1,8Jt - berlaku 6hr LAPTOP - Coi 5 acer + VGA (3x)-(AcerCoi3/Co2-mulai (1xJt) Pc-Tblet+Kamera (1xJt)-KAMERA - Sony-casio-Kodak-CCTV-Mulai 195Rb PC-hdd40-500Gb?Ddr3 (99rb) Spk-aktif (39)adaptor (78rb) LCD (4xx) P4-2,8 (299) Gadai Jual-Beli - Latop-Dll? 0812-636-1967. Jl. Rantang (dicari Peg Toko & PRT)

DIJUAL LCD/CPO untuk Warnet 18 Unit Complit. Hub. 0812 6389 7897

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin TI-HATI dan HA HATI-HA melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602.

BURSA

ALAT MUSIK DIJUAL: 2nd Power: Sound Standar. 1000w, 2000w, 3000w, EQ: dod231, 830 USA, Al 60Ch USA. BMB Amp DAX 1,2, J7, J700, 55 Pro, DAR 5W, DTS Amp. Yamaha, Pioneer dll. Jl. Indragiri 25 Sp. Asia Hotel Wayat 061-7345487

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

AMANAH UMROH

UMROH ZIARAH 9 HARI UMROH ZIARAH 14 HARI UMROH RAMADHAN

APRIL, MEI, JUNI APRIL, MEI, JUNI

HOTEL MADINAH : AL-HARAM / DALLAH TAIBAH HOTEL MAKKAH : SARAYA AJYAD / MAKARIM HOTEL JEDDAH : AL AZHAR Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website: www.amanahumrohmedan.com

BURSA

PHOTO COPY

Terimakasih

2012 Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

11 CM Rp. 165.000 12 CM Rp. 180.000

Rabu, 4 April 2012

Ikuti: THE REAL TRAINING FOR HUMAN CHARACTER BUILDING

Bersama:

PELATIHAN SHALAT KHUSYU’

Ustadz ABU SANGKAN

Tempat: The Sulthan Darussalam Hotel Sabtu - Minggu: 26 - 27 Mei 2012, Jam 08.00-18.00 WIB

BURSA

Tempat pendaftaran: Sekretariat SCSU................................... (0812.8131.8288) Ir. H. Hasrul Hasan MM........................ (0811.642.616) Ustadz. Drs. H. Anwar AA................... (0812.635.9750) Drg. AKBP. Hj. Ettylamurty.................. (0812.6006.719) Hj. Iru Pratiwi......................................... (0811.605.144) Hj. Hazanenny...................................... (0812.7730.0044) Hj. Rita Dulong...................................... (0812.635.9059) H. Suriono - Mesjid Agung................. (0812.6030.4600) Toko Buku Sembilan Wali.................. (061) 452.7285 The Sultan Darussalam Hotel............ (0812.6374.6867) Madinah Syariah Millenium Plaza....(7779.8910) Ustadz. M. Arifin - Binjai...................... (0813.7008.0117) Ir. Hapson Siregar - Kisaran............... (0821.6867.0060) Dr. H. Charles Srg - Aekkanopan..... (0812.609.5287) H. Ahmad Suaib - Banda Aceh......... (0813.7555.4373)

HILANG/TERCECER HILANG

2 Surat SKT Tgl. 22 November 2006 yang diket. Lurah Titi Papan a/n. Masril Erman Tanjung. Luas 156,50M. a/n. Muliadi Luas: 135 M2. Tgl. 09 Mei 2006. Tanah tsb terletak di Lingk: X Titi Papan Medan Deli.

HILANG

Surat Pelepasan dan Penyerahan dengan ganti rugi Nomor 08/3/ II/1994. A/n. Fatmawaty. Yang telretak di Ling/VI Kel/Pekan Tanjung Pura Kec. Tanjung Pura Kab. Tk. II Langkat. Luas 22/21 x 19/8 M.

TERCECER

1 (Satu) Buah Surat Pernyataan Melepaskan Hak Atas Tanah No. 593.83/1106/1993 Tanggal 01 Oktober 1993 atas nama Katiyem. Tanah tersebut terletak di Dusun 1 Jalan KY. Khasim Desa SM. Diski Kecamatan Sunggal Seluas 156 M2. Tercecer pada hari Rabu Tanggal 01 Februari 2012 di sekitar Jalan KY. Khasim KM. 16 sampai dengan Jalan Binjai Km. 10 Kp. Lalang.

SERVICE

AC

ELEKTRONIK Cuci + B. Pasang Kulkas, Dispenser Hub. MAJU TEKNIK 0813 6244 4913 - 061-7030118

SERVICE

KONSTRUKSI PRIMA SERVICE WC TUMPAT - SEDOT WC

061.8451176 0812 6345 1176

DIJAMIN LANCAR - BERGARANSI

WC WC

TUMPAT/ SEDOT SETIA BUDI HP.8442246

0812 631 6631 Ada Garansi

TUMPAT/ SEDOT

77442112

0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

Media yang Tepat untuk Iklan Anda

BURSA

KURSUS KOMPUTER SINGKAT LPK PAULINE

BURSA

Surat Pelepasan Tanah dan Bangunan Serta Tanamannya No. 593.83/ 1055/SPTBT/M.M./IX/2010. Tanggal: 06 Sep. 2010. Atas n a m a : A N I TA N , y a n g dikeluarkan Camat Medan Marelan, Kota Medan. Tercecer sekitar Jalan Yos Sudarso/Medan - Belawan pada bulan Januari 2012

WASPADA

PENDIDIKAN

HILANG/TERCECER

TELAH TERCECER

Ingin Promosikan Produk Anda Harian

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

(TEMPAT KURSUS TERBAIK DI MEDAN) Word + Excel..........................................200 Rb (2 minggu) Word + Excel + Internet..................300 Rb (3 minggu) Ms. Office + Internet.....................450 Rb (1 bulan) Design Grafis (Komplit)................600 Rb (1 bulan) Autocad 2D, 3D.............................. 300 Rb (10 hari) Merakit komputer/ Installing...........400 Rb (6 hari) Bhs Mandarin................................... 500 Rb (Paket) Bhs Inggris.........................................400 Rb (Paket) Daftarkan lsg belajar, waktu bebas, Tanpa batas usia Jl. Sei Batang Hari No. 170 Medan Telp. (061) 844.2158 - Website: www.lkp-pauline.com

Sejak 1979

BT/ BS MEDICA

Kualitas,Keunggulan,KepastianMasa Depan Berpengalaman Lebih dari 32 Tahun Agar LULUS ke PTN Ikuti......

PROGRAM BIMBINGAN BELAJAR INTENSIVE 2012

DIBUTUHKAN

2 org Tk. pangkas yg berpengalaman, Aman dan belum berkeluarga jaminan 45.000/hari dan hasil dibagi 2, ada tempat tinggal, ditempatkan di kab. Samosir, Kec. Pangururan Hub. 0853.7026.7632

DIBUTUHKAN

Tkg. Pangkas Muslim, Jaminan 50 Rb, Full AC Hub. 0812.6044.564 DICARI Tk. Pangkas Mahir, Jujur, Rapi, Bersih, bertg jawab, Ada jaminan Hub. 0812.636.9995

Start Belajar: Senin, 23 April 2012

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

PENDAFTARAN SUDAH DIBUKA !!!

DAFTARKAN SEGERA KE SALAH SATU LOKASI BELAJAR BT/ BS MEDICA

Atau hubungi/ SMS ke: - Ir. Tagor Silalahi (0812.649.3252) - Nurliathy Haloho, S.P (0852.9636.0959) - Berdaulat Bakara, S.S (0853.6261.2687)

E-mail BT/ BS Medica: kampus107@yahoo.com website BT/BS Medica: www.btbsmedica.ac.id

* Boleh boking tempat terlebih dahulu untuk menentukan group belajar, nomor bangku, dan lokasi belajar

BURSA

LOWONGAN Sebuah Perusahaan Rokok mild membutuhkan tenaga kerja sebagai A. SUPERVISOR B. MARKETING EXECUTIVE Untuk kawasan daerah:

Kab. Batu Bara Kab. Asahan - Tanjung Balai Kab. Labuhan Batu Utara Kab. Labuhan Batu Selatan

Kab. Simalungun Kab. Serdang Bedagai Persyaratan Kerja: 1. Pria/Wanita usia 20 s/d 35 tahun 2. Memiliki SIM C dan sepeda motor milik sendiri 3. Berdomisili di daerah tersebut 4. Pengalaman kerja tidak diutamakan Bagi peserta calon pelamar agar menghubungi bagian personalia kami Bapak Suwardi SE, MM. HP. 0813 9744 5941

LOWONGAN PEKERJAAN DIBUTUHKAN OFFICE BOY

Dengan persyaratan: - Minimal tamatan SMU/ sederajat - Rajin, Jujur & Bertanggung jawab - Menguasai kerja lapangan Lamaran lengkap ditujukan ke:

SDIT ALMUSABBIHIN

Komp. Tasbi Blok C No. 99 Medan Telp. (061) 822.4722/ 0812.606.5216 Lamaran diterima paling lambat 1 minggu

KESEMPATAN KERJA

Kami, adalah perusahaan pembiayaan kendaraan, memberi kesempatan kepada para pelamar/ peminat untuk mengisi posisi sebagai berikut: LEGAL PRIA Kualifikasi khusus: A. S1 Hukum (Pidana) B. Memahami Hukum² Leasing C. Memiliki pengalaman magang di Kantor Pengacara/ LBH D. Dapat menggunakan aplikasi komputer Bagi yang memenuhi persyaratan kirimkan surat lamaran lengkap anda ke perusahaan kami, Multidana Finance Jl. Nibung Raya No. 144-148 Medan

DIBUTUHKANSEGERA

KAMI PERUSAHAAN ENTERTAIMENT YANG SEDANGBERKEMBANG,MEMBUTUHKANTENAGA KERJA MUDA YANG CAKAP, ENERGIK DAN CREATIVEUNTUKBERGABUNGBERSAMAKAMI. UNTUKPOSISI: 1. MARKETING MANAGER (MM) 2. OPERATOR MANAGER (OM) 3. MARKETING EVEN (ME) 4. DESIGN GRAFIK (DG) 5. RECEPTION (REC) 6. CASHIER (CASH) 7. WAITER (WAIT) 8. BARTENDER (BAR) DENGANPERSYARATAN: 1. PRIA/ WANITA USIA 20 S/D 35 TAHUN 2. PENDIDIKAN MIN. D3 DAN S1 (1, 2, 3, 4) DAN MIN. SMU/ SMK (5, 6, 7, 8) 3. MEMILIKI KEMAMPUAN LEADERSHIP (1 DAN 2) 4. PENGALAMAN 2 TAHUN DIBIDANGNYA (1, 2, 3) 5. BERPENAMPILANMENARIKDENGANTINGGI BADANMINIMAL165(6) 6. MENGUASAI ADOBE PHOTOSHOP, CORELDRAW,ILLUSTRATOR(4) 7. MEMILIKIKOMITMENYANGTINGGITENTANG PEKERJAANDANDAPATMEMBUATLAPORAN DANBEKERJADALAMTEAMWORK(1DAN2) 8. TELITI, JUJUR DAN LOYALITAS 9. GAJI DAN INSENTIVE (1 DAN 2) NEGO BILAMEMENUHISYARAT,KIRIMKANLAMARAN LENGKAP DENGAN NO HP DAN CV SERTA CANTUMKANKODEPOSISIDISUDUTKIRIAMPLOP KE HARIAN WASPADA DENGAN KODE “CLUBBING 2012” PALING LAMBAT 7 HARI SETELAH IKLAN INI TERBIT

BURSA

PELUANG BISNIS

HARGA TERMURAH

MODEL TERBARU

KRISNA WATER

1. Pemasangan Depot Air Minum Sistem Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll

CV. HYDRO UTAMA

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0852 6168 0200 - 0812 600 5410

GAHARU / KAYU ALIM TANAMAN INVESTASI

Yang Butuh Bibit Gaharu dan Bibit yang lain. Seperti: Damar Laut, Meranti, Kayu Kapur dan lain-lain. Hub. Bapak Jamal. Di Limau Manis Tanjung Morawa dan Siap melayani pesanan dalam partai besar. HP. 0813 7091 2113

DICARI AGEN U/ jual pakaian & Sepatu Dapatkan katalognya GRATIS produk Bandung Ketik: DAFTAR kirim SMS ke: 0853.1111.2006 Telp. 0852.2142.1414 www.sobizdistribution.com

Agenda

WASPADA Rabu 4 April 2012

07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Cek & Ricek 15.30 Tom & Jerry 17.00 Seputar Indonesia 17.30 Target Operasi 18.00 Mega Sinetron : Yusra Dan Yumna 20.30 Mega Sinetron Karunia 22.30 Mega Sinema 01.30 Seputar Indonesia

CATATAN

07.00 Inbox 09:00 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Terkini 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 FTV Istimewa 19.30 SCTV Sinetron Putih Abu Abu 20.00 Liputan 6 Terkini 20.30 Cinta Salsabilla 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07.54 New Oscar’s Oasis 08.00 Cerita Pagi 09.00 Cerita Pagi 10.30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15.30 Lintas Petang 16.00 Animasi Spesial 18.00 Shaun The Sheep 19.00 Fathiyah 20.00 Tendangan Si Madun 21.00SiMiskin&SiKaya 22.00 Segalanya CInta 23.00 Dewi Dewi Show 00:30 Lintas Malam

7:30 Wooow…! 8:00 Friends (Live) 9:00 Resep Warisan 9:30 Segeeerr 10:30 Catatan Sang Dai 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 17:30 Topik Petang (Live) 18:00 Pesbukers (Live) 19:00 Catatan Si Olga 20:00 Tawa Sutra Coooyyy… 21:00 Trix 22:00 Sinema Spesial 0:00 XYZ 0:30 Topik Malam (Live) 1:00 Lensa Olah Raga Malam (Live) 1:30 Sinema Legenda Jaka Tingkir

06:00 - Fokus Pagi 07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia Dong Yi, Jewel In The Crown 13:30 - Drama Asia (Korea): Pink Lipstick 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia Sungkyunkwan Scandal 18:30 - Drama Asia Monkey King 19:00 - Satria 20:00 - Tutur Tinular 22:00 - Buaya Show 23:30 - Mega Asia:

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 8 Eleven Show 10.05 8 Eleven Show 11.05 8 Eleven Show 12.00 Metro Siang 13.00 Headline News 13.30JWideshot 14.04 Headline News 14.30 Wideshot 15.30 Wideshot 16.05 Wideshot 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Otoblitz 21.05 Top Nine News 21.30 Mata Najwa 22.30 Stand Up Comedy 23.00 Metro Sports

B7

06:30 Insert Pagi 07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 Ala Chef 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Show Imah 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 16:30 Sepenggal Sejarah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV : 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV : 02:00 Reportase Malam

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break Live 11:30 Mutumanikam 12:00 Live News 13:30 Live News Kabar Arena Siang 14.00 Zona Merah 15.00 Live News Kabar Pasar 15:30 Ujung Negeri 16:00 Live News Kabar Petang 19.00 Kabar Utama 19:30 ApaKabarIndonesia Malam 21.00 Live News Kabar Malam 22.00 Live News Kabar Arena 22.30 Radio Show

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

33 Usia Paling Bahagia? Ada pertanyaan sederhana yang menggelitik “pada usia berapa orang merasa paling bahagia?” Menurut satu studi belum lama ini, jawabannya adalah 33. Tapi benarkah itu? Friends Reunited, satu jejaring di Inggris, mendapa-ti 70 responden yang berusia di atas 40 tahun mengatakan mereka tak menemukan kebahagiaan sejati sampai mereka berusia 33 tahun. “Usia itu adalah waktu yang cukup untuk keluar dari kenaifan masa kanakkanak dan sifat liar usia remaja tanpa kehilangan energi serta semangat masa muda,” kata Donna Dawson, seorang ahli psikologi, kepada wartawan Fox`s Washington. “Kepolosan sudah hilang, tapi rasa kenyataan bercampur dengan harapan kuat, semangat dapat melakukan`, dan kepercayaan sehat pada kemampuan dan bakat kita sendiri.” Jejaring tersebut memberi contoh, Pesohor berusia 33 tahun seperti

kepada New York Daily News. “Orang bisa melangkah tegap. Orang memiliki sangat banyak keyakinan dan dapat menarik hati orang yang lebih muda,” katanya. (ant)

selebriti pun sependapat. “Tentu saja itu juga berkaitan dengan masalah seks,” kata Christine Possemato,35 dari Springfield, New Jersey,

BURSA

TRAVEL/ WISATA

UMROH/ HAJI PLUS 2012 & HAJI 2013

PT. SATU GEMILANG TOUR AND TRAVEL MELAYANI: - TIKET MURAH DALAM & LUAR NEGERI - HAJI PLUS 2012, UMROH 2012 - PENDAFTARAN HAJI 2013 (HANYA 7 ORANG) - BUS PARIWISATA HUB: 0812.6467.6122

Makin kencangnya job manggung female DJ belakangan ini tak dipungkiri salah seorang wanita berdarah Belanda juga berprofesi sebagai DJ yang telah lama menggeluti dunia hiburan malam bernama Delizious Devina. Ditemui di Garuda Plaza Hotel (GPH) tempat ia menginap bersama grup musik Slank, Audiojet serta Maha Dewi seusai tampil di panggung Galan Mild Art of Party di Lapangan Benteng Medan Minggu (1/4) malam, ia menyebutnya sebagai berkah, karena memang kemampuan DJ wanita tak kalah dengan pria. DJ Devina saat menjadi bintang tamu di acara tersebut, tampil sangat memikat dihadapan ribuan penonton. Dia tampak asyik memainkan musik techno dan house music yang menjadi genrenya dibantu penyanyi Audiojet Jerom. Sambil menggoyangkan badannya, ia mengajak anak-anak muda kota Medan yang lagi menanti penampilan Slank berajojing ria. “Ayo Medan”, ajaknya bergoyang. Kalau DJ wanita sekarang lagi kebanjiran job tampil di diskotik, itu wajar saja, karena memang dari sudut pandang lebih enak untuk dilihat, tuturnya ketika dijegat wartawan sebelum naik menuju kamarnya. Bermain di arena terbuka seperti Lapangan Benteng disaksikan ribuan penonton, menurutnya, bukan hal baru, karena dia sudah pernah melakukan hal yang sama di Kuala Lumpur. Banyak kota besar di dunia pernah dikunjunginya, jadi saat diajak tampil di gelaran Art of Party, dirinya dengan senang hati menyambutnya, sekalian menambah jam terbang beraksi di depan audien yang besar, katanya. Devina juga mengakui, format music dimainkannya di diskotik, tidak jauh beda bila ia harus perform di lapangan terbuka. Cuma pengunjung saja lebih massal, sehingga harus disesuaikan dengan mood penonton yang ribuan orang. “Kita harus pandai memancing emosi mereka hingga tidak jeblok”, katanya sambil permisi karena tidak begitu suka dengan aroma durian yang memang disediakan Garuda Plaza Hotel buat para artis pendukung Art of Party.(m19)

MAYORITAS aktris dan aktor muda belakangan ini, boleh saja alergi berat terhadap berbagai kegiatan dunia perfilman gelaran pemerintah. Namun tidak demikian dengan Arumi Bachsin,18. Meski harus bersusah payah mengatur ulang jadwal kerja, dara cantik berdarah campuran Palembang – Bengkulu, Jerman – Belanda kelahiran Jakarta, 19 Februari 1994 ini, menyempatkan hadir pada HUT ke-62 Perfilman Nasional di Gedung Film Jl MT Haryono, Jakarta Selatan, akhir Maret lalu. “Dunia film merupakan ladang utama pekerjaan saya. Jadi, sudah sepantasnya menjunjung loyalitas tinggi dan peduli terhadap perkembangan perfilman nasional,” papar Arumi Bachsin kepada Waspada di Jakarta, baru-baru ini. Kendati dihadiri Menteri Pariwisata dan Ekonomi Kreatif Mari Eka Pangestu dan Wemendikbud – Windu serta Ukus Kuswara - Dirjen Nilai Budaya Seni dan Film, Arumi menjadi artis muda yang menyelip diantara deretan aktor dan aktris senior seperti Slamet Rahardjo, Christine Hakim, Elma Theana, Deddy Mizwar, Wulan Guritno, dan Roy Marten. “Tak percuma saya menjadwal ulang jadwal syuting film dan tayangan olahraga televisi saya pandu untuk bisa hadir di acara penting insan perfilman ini. Kalau tidak – seperti yang sudah-sudah tak ada wakil artis generasi muda. Semoga kehadiran ini sebagai bentuk dukungan saya, agar perfilman nasional jauh lebih maju dengan bersinerginya dua kementrian yakni Kemenparekraf dan Kemenbud,” ujar Arumi yang pertama mengorbit lewat film Bestfriend tahun 2008. Aktris terakhir membintangi film Kafan Sundel Bolong serta Hattrick (2012) ini pun berharap, dengan berkumpul dengan para pemangku kebijaksanaan perfilman nasional, termasuk para artis senior, dirinya bisa menambah wawasan, menimba ilmu dan pengalaman akting dengan mereka. “Dimasa datang, saya juga ingin tak selamanya menjadi bintang film. Tapi bisa naik pangkat menjadi sutradara. Jadi, tak melulu bekerja di lokasi syuting, tapi juga harus banyak bergaul dengan insan semua perfilman nasional,” tekad Arumi Bachsin, menutup pembicaraan. * (AgusT)

BURSA

KESEHATAN

KHUSUS OBAL LEVEL/ HEPATITIS

Insya Allah dpt mengobati sampai ke visursnya, Izin Dinkes: 448/2868/II/2011 Hub. 0852.7056.0100

BURSA

BUSANA/ ACCESORIES

Informasi Pembaca Bursa Property

PECI MAHKOTA

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

DIJUAL

Rumah ukuran 9,5x28m, Di Jalan Raya Menteng samping Gg. Benteng lokasi Pinggir jalan No. 01A Medan (Khusus Muslim) Telp. (061) 734.8760

KUSUK & LULUR TERAPY MBAK ALIN

BURSA

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

WASIR/ AMBEIEN

MENJUAL PECI TEMPAHAN

Garansi 10 Hari Sembuh Tanpa Operasi HUBUNGI: SPECIALIST WASIR

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

H.G.A. FACHRUDIN

Jl. Brigjend. Katamso No. 683C Medan

BURSA

(±50m dari Simpang Pelangi) Hubungi: 0852.9751.4253 0812.6050.0881

MATERIAL

RUMAH DIJUAL

SHM, 2 Tkt, 6x16m, Jl. B. Katamso Gg. Pemuda No. 35 Sei Mati, Medan Maimun, Harga Rp. 325 Jt/nego Hub. 0812.6326.0534

Arumi Bachsin

RUMAH DIJUAL

Semi permanen Bertingkat 2, Uk. 11x18m, 4 KT, 2 KM, 2 RT, PLN, PAM, SHM, Halaman Luas, Di Jl. Padi Raya Tembung Psr. 3 Hub. 0813.9642.3289

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama

Perumahan Citra Mandiri Jl. Karya Jaya Blok M No. 4 Medan(depan DIM Medan) Hub. 0812.6402.4004 (4 hari)

RUKO BARU DIJUAL

DI JL. KELAMBIR V DEPAN SEKOLAH PA B , 2 T I N G K AT , 2 K M , S H M , STRATEGIS UTK USAHA, BEBAS BANJIR, HARGA 310 JT/NEGO HUB. 0813.9680.3777 (TP)

DIJAMIN 100%

Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

TERAPI ALAT VITAL N SPESIALIS RATU ENDANG ASTARI + A NNYAI DA G AG A L D I T E M PAT L A I N ? ? DITANGANI LANGSUNG

TANAH & BANGUNAN DIJUAL Uk. 8x27 di Desa Sugiharjo Kec. Btg. Kuis, Rp. 70 Jt/nego Hub. 0813.6133.8709

TANAH DIJUAL

Beserta Bangunan di dalamnya, Uk. Tanah 9.215,1m², SHM (139m²), Jalan Prajurit No. 80 Kel. Glugur Darat I Kec. Medan Timur Hubungi HP. 0812.6004.7979, Tanpa perantara

H. UST. YUSUF/ H. ABIDIN

A. Ust OTONG

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR

RUMAH DIJUAL CEPAT

TANAH

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

izin kejari: no. B.78/N.4.3/DSP.4/12/2008

Kami memberi bukti bukan janji alat vital besar dan panjang ditempat No. suntik No. silikon, murni tradisional ramuan alami dan Do’a. dijamin paten dan permanen, tanpa ada efek samping bebas pantangan untuk semua usia, ras dan agama.

Mahar 600 Rb Rahasia Ter jamin

Menjadikan alat vital keras kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, loyodankuranggairahkembaliperkasa.Menanganibekassuntik/silikon,maniencer,plekcur,matitotal, spilis, mandul, ingin punya keturunan dan menangani yang gagal di tempat lain.

Untuk Wanita: (Bisa Berdarah Lagi)

Terapi perawan/ virgin bisa langsung cek ke dokter. Menyembuhkan keputihan bau tidak sedap, ingin terasa gigit, payudara montok padat dan kenyal.

BUKTIKAN DISINI...!!!

Sanggup atasi problem al: Ekonomi, bangkruk, terlilit utang rumah tangga sering cekcok, bubarkan perselingkuhan, buka aura, pelaris, berbagai macam susuk pengasihan pelet, dll. Praktek/ Alamat:

Praktek tetap Jl. SM. Raja depan Kampus UISU Gg. Khotib No. 3 Praktek mulai jam 08.00-21.00 Telp. 0812.6880.7666 - 0878.6767.6333

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.1222

MASTER TERAPI KEJANTANAN KI ZEIN & USTAD RUSLAN

DARI PELABUHAN RATU SUKABUMI

Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja) H P. 0 8 2 1 . 6 2 8 7 . 2 7 4 8 No. Izin Kejaksaan, Nomor : B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama.

PRIA - Panjang: 10 - 12 - 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 - Sperma encer - Lemah syahwat - Ejakulasi dini - Impotensi

W A N I TA : - Memperindah payudara - Menjadikan G-spot, seperti perawan kembali - keturunan

DIJAMIN BERGARANSI KONSULTASI UMUM: - Susuk semar asih - Ajian tali raga - Susuk Ratu Malam - Bedak aura kinasih - Ajian pemutus & penyambung cinta - Pelet tuyul

DJ Devina diabadikan di lobi Garuda Plaza Hotel usai manggung di acara Art of Party di Lapangan Benteng Medan Minggu (1/4)

Loyalitas Arumi Pada Perfilman Nasional

SABILUTTAISIR=Pusat Pengobatan Narkoba, anti rokok & Alkohol. Terdaftar di Depkes & LP POM MUI Hub. 0812 6309 7454

PROPERTY

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Browniess 15:30 Asal Usul Flora &. 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Indonesiaku 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata **m31/G

DJ Wanita Lebih Enak Dilihat

Jennifer Love Hewitt/ misswallpaper.com

Jennifer Love Hewitt, vokalis Maroon 5 Adam Levine dan Katie Holmes kelihatannya menikmati keberhasilan besar saat ini. Dan orang yang bukan

08.00 Fairly Odd Parents 08.30 MEnggapai Bintang 09.00 Super Hero Kocak 10.00 Obsesi 11.00 Top Banget 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.00 Hand Made 15.30 Berita Global 16.00 Top Banget 16.30 Fokus Selebriti 17.30 Penguin Of The Madagascar 18.00 Spongebob 19.00 Awas Ada Sule 20.00 Big Movies 22.30 Big Movies

Daniel Radcliffe Berperan Sebagai Penyair Bintang Harry Potter, Daniel Radcliffe berperan sebagai penyair Allen Ginsberg pada film baru Kill Your Darlings. Aktor populer lewat film Harry Potter ini berusaha menghidupkan kembali imajinasi penonton karakter pahlawan petualangan itu dalam film barunya. Mengambil seting kondisi Amerika di tahun 1940-an , film ini mengeksplorasi kehidupan penyair Jack Kerouac dimainkan Jack Huston dan William Burroghs dibintangi Ben Foster. Keduanya digambarkan terlibat dalam investigasi pembunuhan bersama Radcliff sebagai Ginsberg. Aktor filmWoman In Black baru berusia 22 tahun ini melakukan syuting di New York juga memainkan peran penting pada Beat yaitu satu gerakan mengkritik materialisme Amerika, badan sensor dan represi seksual. Ditulis dan disutradarai John Krokidas, film Kill Your Darlings berdasarkan cerita nyata mencerikan kisah Lucien Carr diperankan Dane DeHaan dihukum karena kasus pembunuhan yang tidak direncanakan setelah membunuh David Kramer, seorang berusia lanjut menghantui karakter Dehaan. Menurut laporan, Jesse Eisenberg bisanya melakukan kasting untuk peran utama dan Radcliffe disebutkan melakukan akting film itu berikutnya. Bagi aktor belia ini film barunya KillYour Darlings tidak kalah seru dan penuh tantangan seperti film petualangan Harry Potter dibintanginya sebelumnya. “Saya sangat antusias dengan skenario dan sutradara film itu, karena sangat menarik dan penuh tantangan seperti dalam Harry Potter. Saya suka menyelesaikan semua tantangan baik di dunia layar lebar maupun kehidupan nyata,” aku Radcliffe pada MTV. Mary-Kate dan Ashley Olsen yaitu adik aktris Elizabeth Olsen juga membintangi film ini. Film Kill Your Darlings dirilis pada tahun depan. Nur/metro.co.ukDaniel Radcliffe/blogspot.com

Opini

B8 TAJUK RENCANA

Bonus Ganda Buat PKS Jika Ditendang Koalisi Dan KIB-II

T

iga menteri dari Partai Keadilan Sejahtera (PKS) harus mengurut dada dan hanya bisa berdoa semoga Presiden Susilo Bambang Yudhoyono (SBY) tidak menendangnya dalam Kabinet Indonesia Bersatu (KIB) jilid-II. Jika ditendang ketiga menteri PKS takkan bisa lagi menggunakan fasilitas negara yang ‘’wah’’ sebagaimana terlihat selama ini. Tapi, menunggu ditendang oleh Presiden SBY dari koalisi Setgab sepertinya sulit. Sebab, kalau PKS ditendang harus ada parpol pengganti dan tidak mudah mencarinya. Jangankan PDIP, Gerindera dan Hanura saja menolak. Apalagi Pemilu dan Pilpres tinggal dua tahun lagi. Bisa-bisa PKS memperoleh ‘’bonus ganda’’ jika Presiden SBY memperlakukan PKS semena-mena dan timbul image dizalimi sehingga simpati masyarakat meningkat buat partai yang di awal berdirinya dikenal bersih dan antikorupsi. Sejak ‘’insiden’’ voting rapat paripurna DPR, Jumat (30/3) lalu, hubungan Partai Demokrat (PD) dengan PKS memanas. Wajarlah kalau parpol dalam koalisi pemerintahan SBY-Boediono kecewa dan mengompori SBY untuk membuang PKS dari Setgab Koalisi. Memang jauh sebelum voting tokoh PKS yang duduk di legislatif maupun dalam struktural partai menolak rencana kenaikan BBM. Bahkan mereka siap didepak dari koalisi pemerintah dengan risiko tiga menterinya di-recall. Saat Mukernas di Medan pun Presiden PKS dalam orasi politiknya pada penutupan Mukernas menegaskan kesiapan PKS untuk menempati posisi apa pun. Artinya, demi membela kepentingan rakyat menolak kenaikan BBM PKS siap dibuang dari koalisi dan siap pula menerima risiko jika tiga menterinya juga dipecat. Tentu tidak mudah bagi PKS untuk mengambil sikap berseberangan dengan kebijakan koalisi. Tarik-menarik dalam internal partai berbasis Islam itu pun tidak terbendung. Sudah sempat terdengar menjelang rapat paripurna PKS yang semua ngotot menolak kenaikan BBM akan kembali mendukung pemerintah karena begitu banyak kemudahan dan keuntungan sebagai partai pendukung pemerintah, terutama untuk mengumpulan dana menuju Pemilu mendatang. Namun sikap arus bawah PKS tampaknya menginginkan PKS kembali ke jalur yang benar, berada di luar pemerintahan dan rapat paripurna menjadi momentum yang pas Intisari untuk pro-rakyat. Sampai menjelang voting tarik-menarik masih terjadi sebelum akhirnya PKS tidak setuju BBM naik dan menolak pePKS memperoleh bonus nambahan pasal 7 ayat 6a yang dinilai ‘’akalakalan’’, di mana harga minyak ditunda tapi ganda bila Presiden SBY memberi kewenangan bagi pemerintah harga BBM bersubsidi jika menendangnya dari Set- menyesuaikan harga minyak mentah (Indonesia Crude Price/ gab dan KIB jilid-II ICP) mengalami kenaikan atau penurunan rata-rata 15% dalam waktu 6 bulan. Hemat kita, putusan petinggi PKS berseberangan dengan koalisi merupakan pilihan bijak melihat penurunan tajam dalam sejumlah survei yang dilakukan lembaga survei independen. Kalau sebelumnya PKS berada dalam kategori parpol menengah, belakangan ini peringkat PKS di urutan ketujuh, sedikit di atas Gerindra dan Hanura. PKS dalam satu survei disebut satu level dengan Partai Amanat Nasional dan Partai Persatuan Pembangunan, merupakan tiga partai yang berdasarkan survei Lembaga Survei Indonesia (LSI) mengalami penurunan suara. Pada survei Desember 2010, PKS bahkan disalip Partai Kebangkitan Bangsa. PKB mendapat 4,8 persen, sementara PKS hanya 4,6 persen dalam survei yang memiliki 1.229 responden itu. Peneliti senior Lembaga Survei Indonesia Burhanuddin Muhtadi menyatakan, dukungan terhadap PKB yang tak berbeda jauh dengan hasil Pemilu 2009 (4,9 persen) itu mencerminkan PKB memiliki pendukung setia atau pemilih yang relatif loyal. Tidak demikian halnya dengan PKS, setelah melihat para petinggi partai dan menterinya serta para tokoh yang duduk di legislatif semakin melupakan visi dan misi partai. Mereka banyak yang larut dalam mengejar jabatan, popularitas, dan kekayaan. Bahkan banyak yang sudah meninggalkan pola hidup sederhana dengan bermewahmewah, dan yang sangat memprihatinkan di antara mereka terlibat kasus korupsi dan amoral dengan membuka gambar porno dalam kumputer tabletnya saat sidang paripurna terkait penolakan pembangunan gedung DPR/MPR tahun lalu. Survei lembaga riset Jaringan Suara Indonesia (JSI) yang dirilis 23 Oktober 2011 menyatakan, posisi PKS merosot tajam ke peringkat ketujuh di bawah Demokrat, Golkar, PDIP, PAN, PPP, dan PKB. Padahal selama ini, PKS adalah partai menengah yang terkuat di kancah perpolitikan nasional, dengan rata-rata perolehan suara di atas PAN, PPP, dan PKB, apalagi dengan Gerindera dan Hanura. Tentunya turunnya elektabilitas PKS merupakan lampu kuning alias peringatan dini yang patut diwaspadai agar tidak semakin merosot lagi. Sehingga perubahan kebijakan dengan melakukan pembelotan dari Setgab Koalisi dinilai positif untuk mengembalikan citra PKS yang lama tergerus di pusat dan daerah. Lantas, apa indikator lainnya? Tidak sulit ditebak. Pertama, PKS tak lagi memperjuangkan aspirasi rakyat, khususnya umat Islam banyak kecewa melihat elite politiknya yang semakin berlomba mengejar hal-hal duniawi. Kedua, masih terkait dengan pertama, di mana posisi elektabilitas PKS turun karena berada di dalam pemerintahan yang dinilai gagal mensejahterakan rakyat. Ketiga, menteri-menteri asal PKS tak bisa berbuat banyak, seperti Menkominfo Tifatul Sembiring, Mensos Salim Segaf Al-Jufri, dan Menteri Pertanian Suswono. Keempat, para anggota dewannya setali tiga uang. Wajar saja kalau pendukung PKS galau melihat manuver petinggi PKS yang tidak lagi komit dengan visi dan misi partai bersih dan islami.+

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Facebook Smswaspada

+628566238659 SBY memang benar-benar seorang presiden yang tidak punya “Hati Nurani”, saat masih banyak rakyat yang miskin dia malah mau naikkan BBM, inilah contoh penguasa yang hanya mementingkan diri sendiri, buktinya lagi dia malah, 1.Beli Pesawat Khusus Kepresidenan untuk jalan-jalan & cari hutang keluar negeri, 2.Saat rakyat dibingungkan dengan mau dinaikkannya BBM, SBY & keluarganya malah enak-enakan jalan-jalan ke China, 3.SBY, “INGAT”, nikmat apalagi yang belum anda dapat dari uang rakyat, anda sudah hidup di Istana Negara yang “SUPER MEWAH” dan gaji yang besar & juga dengan fasilitas yang sangat sempurna sudah dinikmati, kini rakyatnya sendiri mau dimiskinkan, 4.Bila BBM DINAIKAN, ANDA adalah satu-satunya pemimpin Indonesia yang sangat “Zalim Masa Kini”. +6281264855546 Karena mau naiknya harga BBM mulailah B -olak B -alik M -embeli Untuk B -anyak B -anyak M-enimbun. Jadi dari BBM untuk BBM. TRIM’S WASPADA KU. +6281927305191 Kenapa hanya gara gara 1 orang saja, yaitu rezim SBY, dengan menaikkan BBM, harus banyak darah rakyat yang harus di korbankan ??? Dan kenapa pihak kepolisian b’ertindak anarkis terhadap para aktivis yang berjuang untuk rakyat !!! “Wahai penguasa,, harusnya kalian sadar kalo hidup kalian sekarang ini dikarenakan rakyat !!!!” +6285260065441 Ass.wr.wb Kenapa ya BBM mesti naik,pemerintah kita pada ke asyikan dengan koruptor sehingga tanpa memikir rakyat yang menderita akibat menaikkan BBM dan pejabat pandai menipu rakyat kecil.. +6285362982484 Aslkm Waspada..sekiranya pemerintah menaikan harga BBM tentunya biaya hidup masarakat bawah makin berat, sebab kebetuhan pokok terus naik,sementara kesempatan kerja terbatas. Untuk terahir kali saya hanya berharap kepada : Ahli Ekonomi atau Ekonom2 kita yang masih punya hati yang pro Rakyat, berkumpullah semua temui tim Ekonomi SBY dan debatlah mereka dan beri sulusi kepada mereka Supaya BBM jangan dinaikan.tolonglah masarakat yang sudah mulai ketimpa tangga ini. Itulah harap saya trims.Aslkm..WASPADA, +6282165293457 Indonesia paling kaya di dunia.kenapa rakyat menderita?.dpr renungkanlah kekayaan alam kita.perofesornya pandai-pandai hitungan angka kemewahan.tuhan berfirman.al.quran al.israa’ayat 16.dan jika kami hendak menghancurkan sesuatu negeri(bangsa),maka kami perintahkan orang-orang yang bermewah-mewah(untuk taubat dan taat),tetapi mereka tetap melakukan kedurhakaan dalam negeri itu, maka terjadilah kutukan kami.lantas kami hancur-leburkan(penduduk) negeri itu. +6282165293457 Dan janganlah kamu jadikan sumpahmu sebagai tipu-daya sesamamu(yang menyebabkan) kaki(mu) tergelencir sesudah(tegak berdiri) dengan kokoh. Dan kamu akan menderita kesulitan(di dunia) karena kamu merintangi jalan ALLAH.Dan kamu akan ditimpa azab yang berat.

WASPADA Rabu 4 April 2012

Pressure Group Dalam Pembangunan Oleh Dr Drs H.Ramli Lubis, MM Banyak gebrakan terjadi, banyak pula kejutan berlangsung, tapi tidak sedikit keprihatinan diselingi kelucuan-kelucuan. Ini menyiratkan betapa pendidikan moral dan etika demikian minus-nya.

D

alam sebuah tatanan masyarakat yang mapan tidak saja ditandai kesejahteraan masyarakatnya. Tetapi juga ditandai dengan semakin dewasanya masyarakat dan, tentunya juga, pemerintahan dalam menyikapi berbagai masalah. Rasionalitas dan rasa malu adalah salah satu wujudnya. Mengundurkan diri dan mengakui lawan-lawan politiknya adalah langkah-langkahnya. Sebaliknya dalam masyarakat yang “terbelakang” perkembangan sistem sosialnya ditandai dengan rakyatnya banyak yang tidak makmur. Selain itu penggunaan cara-cara tidak terhormat sering menjadi pilihan untuk mencapai tujuan. Dalam masyarakat seperti ini, preseden buruk itu akan berulang terjadi. Ketidakadilan akan senantiasa mewarnai. Pihak yang berkuasa suka berlamalama dalam ketidakteraturan tanpa memiliki cukup kemampuan untuk mengatasinya. Ada lagi yang begitu sulitnya tersentuh nuraninya sehingga merasa nyaman dalam ketidakbecusan. Selanjutnya ketika para intelektualnya atau para calon intelektualnya menyampaikan aspirasi, maka normanorma yang selama ini dianut seolah tak lagi diperlukan. Caci maki, hujathujatan, merusak, membakar, anarkhis. Lebih parah lagi, rakyat dibuat susah, mereka tak lagi peduli. Tapi ini semua sudah terjadi di negeri ini. Pada dasarnya rakyatlah pihak yang paling besar menanggung akibatnya. Ketika harga Bahan Bakar Minyak (BBM) akan dinaikkan, meskipun kebijakan itu masih rencana, rakyat sudah harus menanggung harga kebutuhan bahan pokok yang melonjak tinggi. Ini masih dibayang-bayangi kenaikkan harga BBM itu sendiri yang tentunya akan semakin membuat melemahnya daya beli masyarakat. Selanjutnya, atas nama rakyat unjukrasa marak di mana-mana. Jalanan diblokir, kerusuhan merebak. Ketika rakyat mulai memahaminya sebagai penyaluran aspirasi mereka, toh pada akhirnya persepsi itu perlahan berubah. Kabarnya di beberapa tempat, bentrokkan justru terjadi antara masayarakat dengan para mahasiswa. Para pengendara bukannya merasa

nyaman dengan aksi tersebut, tapi justru merasa sangat terganggung. Aktivitasnya terhambat, dan itu berlangsung berharihari lamanya. Tidak karena kita punya tradisi menyampaikan aspirasi di jalanan dengan cara-cara merugikan orang banyak. Kita juga punya tradisi untuk menhujat dan menjatuhkan pemimpin, orang yang seharusnya terhormat itu. Lihatlah sejarah Soekarno, kemudian lihat pula bagaimana tragisnya Soeharto yang dilengserkan paksa. Habibie pun demikian juga, dia dilecehkan sedemikian rupa oleh orang-orang yang katanya terhormat di gedung dewan itu. Sekarang Susilo Bambang Yudhoyono yang mendapat giliran. Dia tak pernah henti mendapat goyangan dari kanan kiri. Ini adalah realitas dinamika dalam proses pembangunan di Indonesia. Banyak gebrakan yang terjadi, banyak pula kejutan yang berlangsung, tapi tidak sedikit pula keprihatinan melanda diselingi kelucuan-kelucuan. Ini semua menyiratkan betapa pendidikan moral dan pendidikan etika di bangsa ini demikian minus-nya. Hingga terkadang dengan mata telanjang, orang-orang mempertontonkan ketidaktahuannya membedakan antara kebenaran dan kekeliruan. Maka rakyatlah yang selalu berada dalam posisi yang dilematis. Karena hampir seluruh pejabat dan konglomerat akan berkata perlunya pemberdayaan rakyat dalam pembangunan. Namun dalam kenyataannya, tidak sedikit rakyat yang justru tidak berdaya dan dibuat semakin tidak berdaya lagi oleh orang-orang yang katanya menyuarakan kepentingan rakyat itu. Gerakan mahasiswa Sebagai pressure group atau kelompok penekan, ada kesamaan antara greget dan aktivitas politik pemuda dan mahasiswa di tahun 1928 dengan ge-

rakan pemuda di tahun 2012 ini. Mereka sama-sama memiliki semangat yang tinggi, potensi yang besar sekaligus punya kegamangan melihat realitas politik yang terjadi. Kegamangan itu bersumber dari mengguritanya berbagai persoalan sehingga semakin rumit untuk disimpulkan ke dalam sebuah gerakan. Inilah yang terasa sekali pada gerakan mahasiswa sekarang ini. Mereka bertekat untuk memperjuangkan kepetingan rakyat, dan pada saat yang sama menyengsarakan rakyat dengan tindakan anarkhis. Ditambah lagi gerakan ini dinodai dengan adanya di antara gerakan itu yang sangat bersifat pragmatis. Aksi unjukrasa dipandang sebagai lahan bisnis untuk mengumpulkan, dan mengerahkan massa. Kalkulasinya, semakin banyak jumlah massa maka semakin besar biayanya. Meski gerakan politik itu berawal dari kepedulian politik dan rasionalitas serta objektiitas, namun kondisi ini tak sempat menimbulkan inovator politik yang berusaha dengan sungguh-sungguh merekam realitas masyarakat ini menjadi formulasi gerakan. Sebaliknya kepatuhan politik akan melahirkan para oportunis politik yang kedua-duanya diperlukan dalam proses pembangunan politik. Hanya saja terkadang inovasi politik menimbulkan gejolak sosial politik, yang tentu saja tidak disenangi penguasa politik yang mapan. Sebaliknya kepatuhan politik dapat menjamin stabilitas stagnasi kehidupan politik. Kita tidak akan sulit mencari contoh negara yang lebih berhasil dengan kondisi seperti ini, seperti Singapura dan Malaysia. Oleh karenanya diperlukan adanya kesadaran politik residual. Ini adalah titik tengah antara kepedulian pressure group membangun inovasi politik dengan kepatuhan politik. Titik ini adalah suatu kondisi di mana para mahasiswa dibentuk agar menjadi pollitical domesticated man yaitu kelompok pressure group yang kian rasional, efisien dan terampil menguasai teknologi sekaligus peka menangkap berbagai permasalahan politik di masyarakat.

berkaitan dengan jumlah khalayak dari sebuah produk. Sebuah produk kultural akan menjadi contoh dan anutan sehinga menjadi budaya massa. Karenanya aksi-aksi unjukrasa anarkhis yang ditayangkan televisi, disiarkan media massa dan dikonsumsi oleh jutaan orang akan menjadi budaya massa. Semakin sering tindakan anarkhis dalam unjukrasa maka akan semakin sering dicontoh. Budaya massa didukung oleh para transmiter, bukan kreator budaya. Transmiter ini yang menyebarluaskan suatu produk hingga menjadi budaya. Merekalah yang memproduksi budaya populer dengan khalayak yang luas. Di dalam lingkaran budaya massa ini akan selalu ada lingkaran kecil yang merupakan wilayahnya kelompuk kulturasi. Ini adalah kaum yang selalu mengikuti arah gerakan angin bidaya berhenbus. Kaum kulturasi ini hampir sama dengan kelas menengah dalam budaya massa. Kelas menengah ini adalah kelompok yang memiliki keahlian dalam merancang pesan yang disenangi massa. Orientasi mereka biasanya pada profit dengan mengelola pesan-pesan yang sensional. Produk-produk komunikasi massa yang bejubel itu merupakan bagian yang tak terpisahkan dari keberadaan kaum kulturasi ini. Merekalah yang menayangkan secara terus menerus aksi-aksi kekerasan dalam unjukrasa mahasiswa yang merangsang aksi-aksi lanjutan secara sporadis. Inilah yang disebut dengan dimensi komunikasi dalam dinamika politik. Komunikasi dalam tataran filosofis bertujuan menciptakan masyarakat yang ideal dan harmonis. Berbagai opini dan kritik yang muncul diupayakan untuk menciptakan harmonisasi sosial. Begitu pula dengan karakteristik komponen komunikasi digunakan demi perwujudan harmoni di masyarakat. Lembaga komunikasi termasuk komunikator dan media massa lebih bersifat fungsional bagi kepentingan sosial. Equilibrium sosial merupakan sasaran akhir dari setiap pemanfaatan sarana kounikasi.

Budaya massa Budaya massa, kata Daniel Bell,

Penulis adalah Mantan Wakil Wali Kota Medan.

Penutup Dari isu-isu lokal yang marak belakangan terjadi, kita dapat memaklumi bahwa negeri ini sedang dalam proses penyempurnaan sistem sosial kita. Atau dengan kata lain kita masih terbelakang dalam hal ini. Karena dalam tatanan masyarakat yang lebih stabil, maka cara-cara menyampaikan aspirasi atau unjukrasa akan dilakukan dengan lebih terhormat.

Perempuan “Cantik” Di Indonesia Oleh Rusmini ...banyak wanita menggantungkan kebahagiaan pada materi, di antaranya kecantikan wajah dan perhiasan. Akibatnya, jika tidak terpenuhi, maka banyak yang merasa kurang bahagia.

P

enyesatan kaum perempuan pada era kontemporer telah menampakkan hasil yang memilukan. Indonesia berpenduduk mayoritas Muslim, dengan corak pakaian santun kini menjadi bias. Cerminan pribadi Muslimah yang terbingkai dalam totalitas keshalihan sulit ditemui. Menjadi barang mahal dan langka bak intan permata. Kebanyakan Muslimah hari ini lupa akan keindahannya yang hakiki, memilih kehinaan dengan menina bobokkan agama. Menidurkan keimanan dan terlelap dalam kemewahan fana. Budaya materialistis menjadi tolak ukur kemuliaan seseorang. Sebagian perempuan gamang dalam menatap masa depan. Media Indonesia tanggal 3 Maret 2012 heboh dengan judul berita utama “Indonesia Peringkat Ke-1 Pengunduh, Pengunggah Situs Porno”. Modernisasi yang tidak terkendali hanya mampu menjual cita- cita generasi Bangsa. Angka aborsi yang dilakukan remaja putri melonjak drastis. Mengambil data dari Dinas Kesehatan KalimantanSelatan,kotaBanjarmasin pada 2010 terdapat 50 kasus persalinan bayi dengan status bapak tidak jelas. Meningkat hingga 235 kasus tahun 2011. Dalam kesempatan lain memaksa aborsi, menghukum mati janin tidak bersalah. Perilaku seks bebas telah menjadi wabah penyakit, mengutip (AntaraNews 15/ 11/2010) terungkap penyakit HIV /Aids mencapai130.000orang.Fenomenainiadalah pil pahit yang harus ditelan. Pengobatan perbaikan akhlak perempuan Indonesia perlu digencarkan. Penyakitpsikisyangdisebabkanmental pecundang anak muda, juga menuntut kerusakanfisik. BerdasarkandataPencegahan dan Pemberantasan Penyalahgunaan dan PeredaranGelapNarkotika(P4GN),pengguna narkoba sampai Februari 2011 di Indonesia dari jumlah pelajar dan mahasiswa sebanyak 921.695 orang. Pelajar dan mahasiswa yang notabene tumpuan harapan justu terikut arus propaganda kenistaan moral. Terombang- ambing tidak tentu arah. Perjuangan anak Bangsa di tengah kegalauan penguasa yang tidak mampu menuntaskan masalah, semakin menunjukan kerendahan peradaban negeri ini. Kehadiran media internet mempermudah akses perkembangan ilmu pengetahuan, namun juga mampu meningkatkan ritme galau anak muda. Menelisik kembali dokumentasi (Antara, 24/6/2010) gerakanJanganBugilDepanKamera(JBDK) mengungkap selama 2010, masyarakat Indonesia berada pada urutan keempat di dunia yang suka membuka situs porno. Over galau pun semakin konkrit dengan rata-rata2videopornosetiapharidiproduksi

(Hidayatullah, Juni 2008).Tindakan amoral itu justru dilakukan oleh remaja melalui telepon genggam. Menyebarkannya lewat internet dan bisa diakses oleh siapapun di seantero negeri. Seks bebas, narkotika dan penyalahgunaan internet dapat mematikan potensi muslimah.Terbelenggu dengan kebiasaan buruk budaya Barat. Berawal dari pola pikir yang salah dengan menjadikan pakaian seksi sebagai hal yang lumrah dan wajar. Fatamorgana dunia Pemikiran remaja putri Indonesia dibombardir dengan serangan gaya hidup dan fashion yang berkiblat ke Barat. Menjadikan Negara adidaya sebagai panutan. Padahal, mereka justru kehilangan identitas adat Timur yang sopan dan menjunjung tinggi etika. Mendiagnosa gaya hidup glamor orang Barat, kita akan menemukan pemikiran yang tidak orisinil dan secara tidak langsung merendahkan derajat perempuan. Pionir emansipasi wanita dijadikan senjata oleh kaum feminisme. Menjadikan tubuh mereka sebagai bahan jualan, memanen keuntungan demi memenuhi target materi. Belenggu emansipasi wanita dicerahkan oleh Hasan Al Banna dalam revitalisasi gerakan. Ulama tersohor yang banyak memberikan kontribusi terhadap metode gerakan dakwah pada zaman kontemporer, turut menyuarakan aspirasi perempuan. Beliau menjelaskan bahwa akan tiba masanya kebatilan dikemas dalam kajian filsafat untuk mengelabui masyarakat awam. Teori yang mereka propagandakan seolah kebenaran yang tidak bisa direvisi. Masih mengutip wacana Al Banna, pada taraf propaganda maka atas nama kebebasan, mereka mengatakan kepada perempuan muslimah yang rapi menutup aurat, “Pakaian yang anda kenakan adalah kuno, mengekang kebebasan, menutupi kecantikan, budaya Arab dan membatasi dirimu menikmati hidup”. Tak ayal, remaja putri Indonesiatermakanbudayayangmengekspostkecantikan,hartadankedudukansebagai modal dasar yang tidak bisa ditawar. Dunia wajar untuk dinikmati, namun ada batas yang Allah berikan dengan tujuan memuliakan kaum hawa. Sinyal kemenangan Gelombang kehidupan perempuan secara fundamental menyisakan secercah harapan. Ditengah kegalauan anak Bangsa, saat ini mulai marak generasi muda yang kembali beriman kepada Islam. Menggelorakan seruan kebenaran menuju masyarakatmadani.Merekakaummudayangmasih belia dan segar. Kebaikan dan keburukan punbertanding.Remajaputribebasmenen-

tukan pilihan. Ingin ikut pada propaganda hedonisme dengan kenikmatan sesaat ataukah stayle hidup yang menjanjikan kemuliaan dunia akhirat. Militansi perempuan yang ditorehkan dalam organisasi pemuda tingkat kampus maupun sekolah adalah upaya solutif yang ditawarkan. Melalui talk show, diskusi, ceramah, seminar, bakti sosial yang dilakukan, secara tidak langsung menempa anak Bangsa bermental pejuang. Demikianlah cerminan perbaikan para muslimah dalam tataran dunia pendiddikan. MengkambinghitamkanIslamsebagai agama yang menghalangi prestasi dan mengekang perempuan adalah propaganda yang menyesatkan. Pada masa Rasulullah SAW, para sahabiah mampu merefleksikan beragam kemandirian ideal. Semangat yang menggelora mampu membawa gemilang agama melalui perannya dalam menoreh karya terbaik untuk umat dan dunia. Aktualisasi peran muslimah memiliki efek ganda,dengan 1 prestasi yang diukir mampu mempengaruhi beberapa kali lipat besarnya perubahan bagi semesta. Khadijah ra adalahbussinesswomen tangguhyangdisegani pada zamannya. Aisyah ra dengan kecerdasan pemahaman hadist dan Asma binti Yazidsangdiplomasihebat.Merekacontoh pribadi anggun dan bersahaja yang mengejawantahkan belenggu agama. Prestasi yang mereka torehkan membuktikan kapabilitas perempuan unggul. Untuk menuju masa pencerahan, remaja Indonesia penting untuk mempelajari bibiografi dan memetik hikmah atas perjalanan hidup muslimah sekelas para sahabiah. Persepsi cantik Fitrah setiap perempuan menginginkan tampil cantik. Kecantikan luar dalam akan membingkai kepribadian Muslimah terlihat indah, mulia dan penuh karisma. Dra Hj Kastini S Kaspan MPd, magister pendidikan dari Universitas Negeri Surabaya (Unesa) mengungkapkan banyak wanita yang memiliki kecenderungan menggantungkan kebahagiaan pada materi, di antaranya kecantikan wajah dan perhiasan. Akibatnya, jika tidak terpenuhi, maka banyak wanita yang merasa kurang bahagia. Esensi nilai cantik tidak cukup hanya dilihatdariwajahdanbentuktubuh,apalagi sebagaipenentukebahagiaan.Perempuan perlu ilmu dan ruhaniyah dalam menampilkan keaslian keindahannya. Keshalihan muslimah akan lebih memancarkan kecantikan, karena sifat inner beauty lebih kekal daripada sekedar penampilan fisik. Sejatinya inner beauty merupakan refleksi akhlak, mencerminkan aura kecantikan yang muncul dari hati nurani perempuan berupa kekuatan spiritual, memanifestasikan dalam balutan tingkah laku sebagaimana dikehendaki Allah dan RasulNya.IbnuAbbas,pernahmendengar Rasulullah berkata, sesungguhnya amal kebaikan itu akan memancarkan cahaya dari dalam hati, membersitkan sinar pada wajah, kekuatan pada tubuh, kelimpahan

dalamrezeki,danmenumbuhkanrasacinta manusia padanya. Artinya nilai cantik diukur dari amal seorang Muslimah dalam memberikan manfaat sebanyak- banyaknyakepadaummat.Kecantikanhakikitidak lekang oleh perubahan zaman dan waktu. Walaupun kondisi remaja Indonesia hari ini lebih cenderung pada pergaulan bebas, tapiupayamelestarikandanmeningkatkan kualitas perempuan tidak boleh ditinggalkan. Berbaur namun tidak melebuh, demikian sikap aktivis perempuan dalam menyikapi polemik kehidupan yang menawarkan kenikmatan sesaat. Membangkitkan inner beauty secara simultan dan kontiniu, bertahap terus menerus sesuai tuntunan Islam. Kebaikan penting untuk ditularkan, sebaliknya keburukan harus segera diredam. Usaha berkesinambungan harus terus digencarkan. Ibu yang memiliki anak remaja lebih giatdalammemberikanteladanterbaikbuat anak-anak.Begitupunbagiayahdanseluruh pihak untuk menuntaskan permasalahan moralitas remaja yang rendah. Penulis adalah Pengurus Daerah Kesatuan Aksi Mahasiswa Muslim Indonesia (KAMMI) Medan, Mahasiswa UNIMED.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Meneg PPN: Pembangunan Sumut selaras nasional - Tapi begitupun jalan tol cuma satu! * DPRD Medan desak Pemko revisi Perda PBB - Jangan sampai masyarakat jadi galau * BPS: Harga BBM tunggu pertengahan tahun - Padahal menunggu paling membosankan

oel

D Wak

Opini

WASPADA Rabu 4 April 2012

Tanggapan Dan Komentar Atas Tulisan Sdr. Ali Amri 1. Setuju kebenaran Alquran 100%, tapi kalau hukum diambil langsung oleh yang bukan ahlinya bisa sesat dan menyesatkan,sebab ada lagi ayat Alquran yang tidak ditulis di mushab yang kita baca dan ada ayat yang ditulis di mushab Alquran tapi tidak dipakai lagi sebagai sumber hukum, ia hanya bacaan berpahala bila dibaca, seperti QS An-Najm ayat 39 yang artinya : Dan bahwa tidak ada bagi manusia kecuali apa yang diusahainya, ayat ini sudah tidak dipakai lagi sebagai sumber hukum karena ia telah dinassakhan dengan sebab turunnya surah Attur ayat 21 yang maksudnya anak cucu mereka yang beriman itu ditingkatkan Allah derajatnya sebagai derajat bapak-bapak mereka dan dikumpulkan dengan bapak-bapak mereka disurga. Ayat ini dikomentari Ibnu Taimiah : Siapa yang berkeyakinan bahwa manusia tidak bermanfaat kecuali dengan amalnya maka ia telah membakar ijmak, sebagian ulama ada yang menerangkan bahwa yang dikamsud manusia melingkupi semua manusia yang beriman dan tidak beriman, jadi kalau ada usaha manusia itu mengucap duakalimahsyahadat, bermanfaatlah usaha orang lain kepadanya.Untuk renungan surah An Najm turun di Makkah ke 21 dalam Alquran ditulis di urutan ke 53, sedang surah Attur turun di Makkah ke 74 dalam Alquran ditulis di urutan ke 52, yang jelas surah Annajm duluan turun dari Surah Attur. 2. Tidak setuju disebut hadis secara mutlak kebenarannya kurang 100%, sebab ada hadis mutawatir 100% kebenarannya, dihukum kafir yang tidak yakin. Contoh : Hadis yang menerangkan berbelahnya bulan masa nabi dua pirquh, ini menjadi mukjizat nabi. Dan hadis yang menerangkan umat Muhammad masuk surga 70.000 tanpa hisab adalah hadis mutawatir dari Rasulullah SAW bahwasanya ia mengabarkan bahwa umat ini ada 70.000 orang yang masuk surga tanpa hisab. Hadis ada yang mutawatir amali,mutawatir maknawi dan mutawatir lafsi ini tidak diragukan kebenarannya 100%.Sedang hadis Ahad,Aziz,Hasan, Soleh dll setuju zanni seperti hadis Taroktu pikum amroini.... Quran-Hadis. Adapun hadis R.Bukhari dan Muslim yang isinya : Orang yang telah mati mendapat siksa didalam kubur karena tidak istinja atau bersuci menurut Sdr Ali Amri adalah hadis yang sangat fatal sekali kepalsuannya, saya tidak sependapat dengan Saudara, hanya sependapat dengan Sohibul Fadilah Al Ustadz Al Jalil Asysyeikh Alawi Assaid Abbas Al Mudarris Bil Haromi Al Makki cetakan 1938 M Hal 22. a. Yang melihat hadis tersebut bukti sabitnya siksa kubur b. Diperkuat dengan dalil Quran : Bahwa neraka dibentangkan kepadanya pagi dan sore hari (QS Al Mukmin 46) c. HR Bukhari Muslim : Sesungguhnya salah kamu bila ia mati dibentangkan kepadanya tempat duduknya pagi dan sore. d. Hadis soheh Masyhur Nabi SAW banyak berlindung dari azab kubur dan menyuruh berdoa supaya berlindung.. e.QS Ali Imron ayat 69 : Janganlah kamu kira orang yang terbunuh di jalan Allah itu mati, bahkan hidup disisi tuhannya diberi rezeki f. Hadis soheh : bahwa arwah mereka berada di mulut burung hijau bersenang-senang di surga g. QS Annur ayat 19 : Bagi mereka azab yang pedih di dunia dan pada hari akhirat, ini juga bukti sebelum dihisab sudah disiksa. Saudara li AMri yang menolak adanya siksa kubur bertanya apanya yang disiksa? menjawabnya adalah Husain bin Muhammad Al Jisir Attrobalisi dalam buku aqidahnya Hosonul Hamidiah yang memakai dalil aqli, nas ALquran dan hadis mutawatir dan hadis masyhur hal 124-136. a. Perasaan nikmat dan azab hanya kumpulan ruh dan bagian-bagiann yang asli.. b. Sesungguhnya bagian-bagian yang asli yang ada beserta ruh bertaut dengannya... c. Tidak ada yang mencegah bahwa Allah Taala menjadikan ruh bertaut secara khusus kepada bagian yang asli sekira merasa nikmat dan azab. d,Tidak ada yang mencegah bahwa sebagian manusia mereka hidup dekat Tuhan mereka diberi rezeki seperti syuhada. Saudara Ali Amri menulis :menurut Alquran kesalahan manusia baru ditimbang/diketahui nanti di akhirat setelah ada pengadilannya. Mana ayat Alquran nya/ kenapa tidak ditulis dinaskahnya, supaya pembaca menimbangnya? Demikian tanggapan dan komentarnya. M Nawawi Rangkuti Lulusan Pesantren Mustofawiyah tahun 1958 Mantan Hakim Honor Pengadilan Agama 16 tahun Guru Agama panggilan masyarakat

Prof. Dr. Syahrin Harahap, MA

Etika Protes “Buat kalian para mahasiswa yang berdemo mengatasnamakan kepentingan rakyat dan para pendukungnya..Yang merasa perbuatan mereka benar..Silakan baca ini baik-baik..Kalian mahasiswayangmembawanamakamidijalan...Berteriaksanasinimengatasnamakankepentingann kami masyarakat Indonesia...rakyat kecil dan buruh...Alih-alih membela kami kalian justru menghancurkan fasilitas umum yang dibangun dengan uang dan keringat kami...Tak jarang kalian membuat kami ketakutan ngeri dengan perbuatan kalian...kalian seperti binatang yang membabbi buta...Tak jarang kalian bentrok dengan warga sekitar....Yang lebih lucu lagi...Kalian merusak kantor-kantor, restoran cepat saji, showroom mobil, mobil pengangkut minuman dan gas. Tak jarang kalian menjarah isinya...Dan kalian lupa...Satpam, Office boy, CS, supir dan pegawai kecil lainnya adalah kami masyarakat Indonesia yang katanya kalian bela. Tahukah kalian wahai yang katanya mahasiswa...kami sipir taxi tak berani menarik penumpang karena takut terjebak di tengah keributan dan menjadi korban. Padahal keluarga kamin burtuh makan...Tahukah kalian kami OB dan pegawai rendahan...Terpaksa harus mengeluarkan ongkos lebih banyak hanya untuk menghindari daerah kerusukan yang kalian ciptakan...Apakah kalian pernah berpikir...kalian bukannyameringankanbebankami.Kalianjustrumenambahbebankami...Bisakahkalianberdemo dengan cara yang lebih mulia? Belajarlah...kembali ke bangku kuliah kalian...jadilah juara...jadilah orang hebat...yang kelak memimpin...menjadi direktur, atau bahkan jadi pengusaha hebat. Bukalah lapangan pekerjaan buat kami...majukanlah kami, kehidupan kami rakyat miskin dengan cara yang lebih baik...majukanlah bangsa ini dengan prestasi kalian. Jangan biarkan simpati kami berubah menjadi antipati. Jangan biarkan arti mahasiswa sama dengan preman...” Kalimat-kalimat di atas dikirimkan oleh seorang melalui black barry massanger ke hp saya tanpa kutipan. Namun isinya menggambarkan betapa manusia memiliki kecenderungan untuk melakukan protes terhadap apa yang menurutnya tidak benar dan memang melakukan protes merupakan konsukuensi logis dari fitrah manusia yang cenderung pada kebenaran. Kalimatkalimat itu juga sekaligus menggambarkan betapa suatu protes harus mempertimbangkan bahwa protes tidak selalu berada di ranah qath’iyuddalalah yang kebenarannya sudah pasti, akan tetapi seringkali berada pada ranah ijtihadi hingga memungkinkan untuk memunculkan protes baru. Protes itu amat penting dalam menegakkan kebenaran dan kesejahteraan rakyat sebab pengenalan terhadap kebenaran dan kebatilan, salah dan benar, tidak akan datang dari langit. Ia timbul dari fefleksi yang mendalam dari panduan anugrah berfikir dan pemahaman terhadap realitas. Disini amat dibutuhkan peran cendekiawan. Protes juga penting karena pada hakikatnya tidak ada yang dapat menjaga manusia modern dan memelihara kepentingan umum selain kesadaran individu dan kekuatan rakyat banyak. Bahkan seperi disebut Hassan Hanafi, “yang diharapkandapatmenghancurkankebatilandanmembelakebenaranhanyalahtindakankesadaran kaumcendekiawanyangdapatmentranformasikankesadaranindividumenjadikesadarankollektif”. (Hassan Hanafi: Min al-Aqidah ila al-Saurah). Islam—melalui lisan Rasulullah—menegaskan pentingnya protes untuk mencegah kesalahan dan kekeliruan dengan power atau kekuasaan, atau dengan lisan, atau dengan membenci kesalahan dan kekeliruan (al-hadis). Umat manusia tdak pernah direkomendasikan untuk membiarkan kesalahan dan kekeliruan meraja lela, sebab bukan saja akan mendatangkan akibat yang lebih parahtetapibisamendatangkanbalabencana.(al-hadis).UntukitulahmakaRasulullahmengingatkan bahwa“jihad terbesar umat manusia adalah mengatakan yang benar pada penguasa yang zalim. (al-hadis). Namun perlu disadari bahwa protes harus beretika. Seperi dikatakan Taha Jabir al-Alwani, perlu ditegakkan ‘ethics perbedaan’. (Thaha Jabir alAlwani:The Etics of Disagreeman in Islam). Islam menegaskan lima prinsip mengenai etika protes. Pertama, protes harus bersifat konsekuen pada hal-hal yang prinsip dan dasariah, yang menyangkut benar dan salah sera kepentingan dasar rakyat. Disini tidak ada negosiasi, tidak ada lima puluh ataun seratus ribu rupiah ataupun nasi bungkus. Kedua, protes harus didasarkan pada nilainilai transendental. Protes dilakukan berdasarkan ketaatan pada Tuhan, bukan untuk ‘Bapak’ atau untuk‘Ketua’, hingga teguran atau protes terhadap imam yang keliru dalam shalat dilakukan dengan membaca ‘subhanallah (Maha Suci Allah) bukan dengan cara demonstrasi menyatakan sang imam sudah keliru. Ketiga, protes dilakukan dengan bersikap santun.Tidak ada rekomendasi untuk anarkis. “Berkatalah yang benar atau jika tidak, lebih baik engkau diam saja.” (al-Hadis). Keempat, protes, apalagi bukan dalam hal-hal yang dasariah, tidak diperkenankan merasa benar sendiri. Sebab seringkali yang memprotes dengan yang diprotes sama-sama bertujuan untuk menegakkan kebenaran dan memwujudkan kesejaheraan rakyat Kelima, karena protes pada hakekatnya adalah untuk mencari dan menegakkan kebenaran maka sesunguhnya protes adalah nasehat atau saling menasehati hingga yang terjadi adalah yang memprotes harus menyadari bahwa dirinya sedang mendedikasikan kelebihannya untuk menutupi kelemahan yang dinasehati. Sementara yang dinasehati harus meyakini bahwa dia sedang mengakomodasi kelebihan orang lain untuk menutupi kekurangannya. Dengan demikian yang memprotes dan yang diprotes adalah bersaudara di jalan yang benar. Begitulah,protesmerupakankeniscayaandalammewujudkanperbaikanbangsadanmasyarakat. Namun protes haruslah memiliki etika hingga protes melahirkan kebaikan bukan sebaliknya melahirkan protes baru dan dendam tak berkesudahan. Wa Allahu A’lamu bi al- Shawab.

B9

Nasib UMKM Dan Isu BBM “

Tentu saja, isu kenaikan harga Bahan Bakar Minyak (BBM) membawa imbas luar biasa terhadap berbagai sektor, termasuk dunia usaha.Bahkan,sejumlah pengamat memprediksi, kenaikan harga BBM akan memperpanjang daftar warga miskin dan membengkakkan jumlah pengangguran. Tak ayal, rencana pemerintah menaikkan harga BBM 1 April 2012, mendapat protes sengit. Meski akhirnya ditunda. Karena, kenaikan harga BBM selalu menjadi biang kenaikan harga. Tidak saja bahan kebutuhan pokok melambung, juga biaya bahan baku dan ongkos produksi membengkak. Jika hantaman ini tak mampu disiasati, dikhawatirkan dunia usaha gulung tikar. Nah, bagaimana nasib Usaha Mikro Kecil Menengah (UMKM) setelah harga tak jadi BBM naik? Usaha rakyat bermodal kecil ini tentu saja tak boleh diabaikan. Karena, jumlahnya ternyata tidak sedikit dan mampu menyerap tenaga kerja dalam jumlah yang tidak tanggung-tanggung. Menurut data, UMKM di Medan saja, misalnya, mencapai 232.000 yang tersebar di inti kota dan pinggiran. Selama ini, bermodalkan kegigihan dan pantang menyerah, pelaku UMKM bangkit; walaupun terkadang terseok. Mereka berupaya mengembangkan usahanya dengan berbagai upaya. Setelah mendapat pembinaan dari instansi terkait dan bantuan permodalan dari berbagai pihak, sejumlah UMKM di Medan mampu berkembang secara signifikan. Namun, adakah isu BBM akan membuat mereka kembali terpuruk ke titik nadir? Langkah-langkah apa yang dilakukan pemerintah sehingga kondisi ini tidak membuat UMKM tiarap? Berikut wawancara Irham Hagabean Nasution (IHN) dengan Kepala Dinas Koperasi dan UMKM Medan Ir Qamarul Fattah, MSi (QM) di Medan,kemarin. IHN: Sebenarnya, apa imbas paling nyata dari rencana kenaikan harga BBM terhadap UMKM, khususnya di Medan? QF: Imbas itu pasti ada. Sekarang, para pelaku UMKM yang menghadapi begitu banyak permasalahan,nah saat ditambah dengan satu masalah lagi, mereka akan goyang. Tapi saya percaya, goyangnya hanya sementara. Adaptasi. Tapi, yang perlu kita simak, beberapa waktu lalu juga terjadi krisis, pelaku UMKM ini sudah teruji. Mereka tetap eksis dan bangkit lagi. Mereka dapat mengatasi berbagai permasalahan saat krisis menghantam. IHN: Jadi, apa yang kita lakukan? QF: Ya, kita tidak bisa membiarkan mereka. Upaya yang kita lakukan, dan sekarang sudah kita mulai, ada serangkaian upaya untuk menekan biaya produksi mereka. Pertama, dengan menyiapkan bahan baku yang murah dan mudah diperoleh dengan kualitas baik. Kita juga sudah memberi serangkaian pelatihan bagaimana mengefektifkan dan mengefisienkan pemakaian tenaga kerja. Kemudian kita, misalnya kepada perajin kulit, sudah mengarahkan agar potongan-potongan kulit yang kecil selama ini menjadi sampah, kita arahkan untuk dijadikan kerajinan tangan apakah itu dalam bentuk tempat handphone dan asesoris, sehingga potongan yang selama ini terbuang menjadi bernilai ekonomis yang diharap dapat menekan cost produksi. Jadi, pembimbingan kepada mereka harus terus-menerus kita lakukan sehingga kita dapat mengatasi gejolak yang terjadi akibat kenaikan harga BBM. IHN: Mengenai bantuan permodalan? QF: Di samping itu juga, dengan adanya lembaga pengelolaan dana bergulir, yang saat ini memang masih ada di Jakarta, memang memberikan bantuan penguatan permodalan dengan

bunga relatif sangat kecil. Namun, persyaratan-persyaratan ini harus dipenuhi seperti khusus koperasi harus koperasi yang sehat, tentu standar tata kelola keuangannya juga harus baik, tren usahanya juga memungkinkan dia untuk bisa membayar. Ini tetap kita berikan bimbingan kepada mereka untuk mempersiapkan persyaratanpersyaratan ini. Sehingga, jika dana ini bisa dimanfatkan pelaku UMKM kita, akan sangat bermanfaat. IHN: Berapa sebenarnya jumlah UMKM di Medan? QM: Data terakhir, berdasarkan pendataan dilakukan Bappeda Medan 2009, jumlah UMKM yang ada di Kota Medan 232.000. Di situ sub sektornya disebut sub sector perdagangan, sub sektor industri dan sub sektor jasa dan usaha lainnya. Jadi, yang paling besar itu di sub sektor jasa dan usaha lainnya, menyusul perdagangan dan sub sektor perindustrian. Terus terang, pada saat awal saya memasuki dinas, kita tidak punya data yang valid. Makanya, kita secara bertahap melakukan pendataan di lapangan. Sampai sekarang kita baru memperoleh data, pelaku UMKM yang mempunyai produk di Medan sekira 3.000 UMKM. Pendataan ini akan terus kita lakukan. Kemudian, usaha-usaha yang ada di perkoperasian, koperasi itu anggotanya ada yang memiliki usaha, itu juga terus kita lakukan. Jadi, sampai sekarang kita masih mendapatkan anggota koperasi yang memiliki unit usaha sekira 18.000. Sekarang kita memproritaskan pelaku UMKM yang punya produk. Karena, jika mereka kita tingkatkan, tentu produk yang dihasilkan mampu memberi kontribusi ke daerah ini. Produk yang kita jual ke luar daerah, akan menghasilkan devisa ke Kota Medan. Apalagi, dengan meningkatnya produksi mereka, itu menyerap tenaga ker-

Para pelaku UMKM yang menghadapi begitu banyak permasalahan,nahsaat ditambah dengan satu masalah lagi, mereka akan goyang. Serangkaian upaya dilakukan untuk menekan biaya produksi.

ja sehingga tingkat pengangguran dan tingkat kemiskinan otomatis bisa ditekan. Dari 3.000 jumlah UMKM yang kita data, 600 di antaranya sudah kita lakukan pembinaan. Ada kita berikan teknik untuk meningkatkan kualitas dan menekan biaya produksi, kemudian ada juga di bidang managerial, kewirausahaan, dan akutansi. Pembinaan yang kita lakukan sesuai dengan apa yang mereka miliki. Kita menginginkan, ke depan, usaha mikro kita sudah meningkat menjadi usaha kecil. Usaha kecil saat ini diharap akan menjadi usaha menengah dan selanjutnya. Jadi, pembinaan yang kita lakukan ini harus berkesinambungan. Kriteria UMKM menurut UU No 20 tahun 2008, usaha mikro memiliki aset maksimal Rp50 juta, usaha kecil memiliki aset Rp50 sampai Rp500 juta, menengah Rp500 juta sampai Rp10 miliar dan usaha besar di atas Rp10 miliar. IHN: Apa lagi yang dilakukan untuk meningkatkan kiprah UMKM dan koperasi di Medan? QF: Upaya kita sekarang mengangkat harkat, martabat dan citra koperasi dan pelaku UMKM yang selama ini di masyarakat cenderung koperasi dan UMKM itu dianggap usaha pinggiran. Tentunya, untuk mengangkat harkat, martabat dan citra ini, harus dilakukan dengan berbagai upaya yang sungguhsungguh. Dari internal kami sendiri, kami berusaha yang selama ini dianggap kurang peduli, juga kantornya juga kurang repsentatif, kita berupaya meningkatkan kepedulian aparat kita, dan mulai bulan Mei ini kantor kita akan dibangun dua lantai. Di lantai dasar akan dibuat sebagian untuk aula, juga ada beberapa ruangan seperti klinik di mana pelaku UMKM yan mau konsultasi seperti bidang akutansi, yang nanti kita datangkan ahli akutansi. Aula ini juga akan kita jadikan tempat interaksi antara sesama pelaku UMKM, sesama koperasi, koperasi dengan UMKM, juga mereka berinteraksi dengan kami sebagai aparat dinas pembina koperasi dan UMKM. Jadi, forum silaturahmi dan komunikasi itu sangat dibutuhkan untuk mengembangkan jaringan bisnis. Ruangan yang sebelah lagi di Dinas Koperasi dan UMKM Medan di Jalan Gatot Subroto Medan akan kita jadikan galeri. Di situ, produk-produk UMKM akan kita tampung untuk dipromosikan tanpa kita pungut biaya. Kita juga akan coba upayakan kerjasama dengan berbagai biro trevel dan hotel, sehingga pangsa pasarnya bisa lebih meluas. Citra yang akan kita bangun kepada koperasi dan UMKM, bahwa koperasi dan UMKM yang selama ini mayoritas tidak memiliki perizinan, akan kita fasilitasi untuk mengurus perizinan, apakah izin gangguan, izin usaha perdagangan, izin usaha industri kecil, kemudian tanda

daftar perusahaan. Itu akan kita fasilitasi supaya mereka memiliki legalitas. Mengenai sertifikasi untuk produk makanan, kita akan fasilitasi untuk mengurus lebel halalnya dan label dari kesehatan tentang higienisnya dan kesehatan makanan. Jika perlu, setiap produk makanan akan kita berikan sertifikasi sehingga kita berani mengklaim kalau itu makanan sehat dan bergizi. Produk seperti garmen banyak diproduksi, begitu juga kerajinan kulit. Tetapi mereka belum memiliki merek. Makanya, kita fasilitasi mereka untuk mengurus merk produk mereka (HAKI) ke Departemen Hukum dan HAM. Jadi, dengan melengkapi mereka dengan berbagai perizinan yang lengkap serta sertifikasi apalagi memiliki sertifikasi tentang kualias produk, mereka diharap mempunyai kepercayaan yang tinggi dan mempunyai nilai tawar produk yang jauh lebih tinggi. Selain itu, kita juga akan membangun suatu komunitas dalam pengkalisifikasian produk yang sama, sehingga mereka menjadi lebih kuat. Ibarat lidi, jika itu cuma satu batang tentu akan rapuh, tapi kalau kita jadikan sapu menjadi kuat. IHN: Pembinaan seperti apa lagi yang dilakukan Dinas Koperasi dan UMKM Medan? QF: Dengan perkembangan teknologi yang berkembang pesat, kita menginginkan, utamanya koperasi, yang selama ini tata kelolanya masih menggunakan sistem manual, akan kita arahkan mereka menggunakan IT, sehingga bisa mempermudah mereka dalam mengelola perkoperasiannya sehingga lebih efektif dan akuntabel. Secara perlahan kita coba terapkan penggunaan IT kepada koperasi dan juga kepada pelaku UMKM. Saya sudah mulai memaksanakan kepada koperasi dan pelaku UMKM dengan tidak memberikan nomor telepon saya, tetapi saya memberikan alamat email saya untuk memaksa mereka kalau mau berkomunikasi dengan saya harus melalui IT. Alamat email saya fatthah@yahoo.com. Bagi mereka yang tidak bisa menggunakan, kita sudah berkoordinasi dengan Balai Penelitian dan Pelatihan yang ada di bawah kementerian Kominfo di Jalan Tombak yang menyatakan mereka bisa memberikan pelatihan kepada pelaku UMKM kita secara gratis menyangkut penggunaan komputer dan internet. Setiap pagi selesai subuh atau malam, itu tetap saya buka dan saya coba komunikasi. Ini tujuannya bukan untuk mempersulit menghubungi saya, saya juga kalau ada kegiatan di luar yang tidak begitu penting, saya akan lebih betah di kantor untuk menerima mereka. Alhamdulillah, kantor kita sekarang sangat sering dikunjungi pengurus koperasi dan pelaku UMKM untuk melakukan komunikasi yang tujuannya untuk kemajuan bersama.

Uji Materi Pasal “Perselisihan Terus Menerus” Oleh Hj. Erma Sujianti Tarigan Kita dapat mengambil contoh pada pasangan Aa Gym dan istrinya Teh Ninih yang belakangan telah sadar dan menikah kembali.

R

umah tangga manakah yang tidak pernah “dibunga-bungai” dengan perselisihan? Bahkan perselisihan bisa jadi merupakan salah satu cara untuk saling belajar, saling kritik dan akhirnya mendapatkan solusi terbaik. Namun bukan solusi untuk berpisah melalui lembaga perceraian. Dikarenakan banyaknya perceraian dengan alasan ‘perselisihan terus menerus,’ telah mendorong Halimah (mantan istri Bambang Trihatmodjo) untuk melakukan uji materi terhadap pasal yang mengatur tentang “perselisihan terus menerus” tersebut ke Mahkamah Konstitusi. Namun Harapan Halimah untuk menjadi istri Bambang Trihatmodjo pupus, karena Mahkamah Konstitusi (MK) menolak permohonan uji materi Pasal 39 ayat (2) huruf F UU No 1 Tahun 1974 tentang Undang-Undang Perkawinan. Alasan penolakan, bahwa pasal yang dimohonkan telah memiliki dimensi hukum, dimensi kehidupan batin, dimensi kemasyarakatan, dan dimensi keagamaan. Mahfud MD selaku Ketua Majelis Hakim MK, menjelaskan, merujuk pada penjelasan Pasal 39 ayat (2) huruf F UU Perkawinan, bahwa perceraian dapat terjadi karena alasan bahwa antara suami dan istri terus menerus terjadi perselisihan dan pertengkaran dan tidak ada harapan akan hidup rukun lagi dalam rumah tangga. MK menilai penjelasan Pasal 39 ayat (2) UU No. 1/1974 memberikan salah satu jalan keluar—ketika suatu perkawinan tidak lagi memberikan kemanfaatan karena perkawinan sudah tidak lagi sejalan dengan maksud perkawinan sebagaimana disebutkan dalam pasal 1 UU No. 1/1974.Selain itu juga tidak memberikan kepastian dan keadilan hukum sebagaimana dimaksud pasal 28

D ayat (1) UUD 1945. Pemohon yakni Halimah berupaya menyelamatkan rumah tangganya dengan tidak mau bercerai akhirnya pengadilan memutus cerai. Halimah tidak pernah menyetujui perkawinan Bambang dan Mayang. Pengadilan pun telah memutuskan perceraian Bambang dan Halimah awal tahun 2011. Adapun Pasal 39 ayat 2 UU Perkawinan yang digugat Halimah berbunyi, “Antara suami dan istri terus menerus terjadi perselisihan dan pertengkaran dan tidak ada harapan akan hidup rukun lagi dalam rumah tangga.” Hemat penulis, selama ini memang kebanyakan perkara perceraian dengan mengambil alasannya Pasal 39 ayat 2 huruf F tersebut. Sebagaimana Bambang, padahal bisa jadi hal itu cuma alasan yang dicari-cari. Artinya, tidak murni perselisihan terus menerus, melainkan dikarenakan ada pihak ketiga, wanita idaman lain, dan si wanita idaman lain tersebut tidak bersedia dimadu, dia mau menjadi satu-satunya istri sehingga istri yang lainnya harus disingkirkan. Hati kita memang sering ngilu menyaksikan sebuah perceraian, apabila salah satu pihak tidak mau bercerai (dikarenakan masih sayang pada pasangannya, atau menimbang anakanak). Tetapi memang ada pula perceraian harus dilakukan dikarenakan adanya unsur kekerasan, kekejaman fisik maupun psikis. Inilah yang murni harus bercerai karena dapat membahayakan jiwa pasangan hidup. Sedangkan apabila dikarenakan ada Pria Idaman Lain (PIL) dan Wanita Idaman Lain (WIL), seyogianya tidak harus bercerai, melainkan berpoligami sebagai solusinya. Barangkali kita dapat mengambil contoh pada pasangan Aa Gym dan istrinyaTeh Ninih yang belakangan telah

sadar dan menikah kembali. Mulanya dikarenakan merasa tidak kuat pada poligami suaminya, tidak dapat menerima/tidak ikhlas diduakan sehingga Aa Gym terpaksa menceraikannya. Namun belakangan (mungkin) sudah merasa kuat, ketika dinikahi lagi oleh Aa Gym, dia bersedia kembali. Sebenarnya perceraian di kalangan pasangan yang mempunyai sejumlah anak yang masih kecil-kecil, dapat berdampak negatif pada perkembangan kejiwaan anak tersebut kelak. Langkah yang diambil pasangan ini sangat tepat, demi anak. Uji materi yang dilakukan Halimah sebenarnya merupakan sebuah langkah maju untuk tidak mempermudah terjadinya perceraian anak manusia. Tetapi kekukuhan untuk menolak poligami juga sangat keliru, karena apabila seorang laki-laki sudah berkeinginan berpoligami, akan sulit untuk membendungnya. Kita mengakui poligami pun

menimbulkan banyak dampak, namun ada kalanya solusinya lebih tepat poligami, bukan perceraian. Lembaga mediasi, sudah dapat dilakukan dengan se-efektif mungkin dikarenakan saat ini sudah banyak mediator bersertifikat (non PNS). Jika selama ini hakim selaku mediator kurang efektif me-mediasi pasangan yang hendak bercerai dapat dimaklumi karena mereka terikat dengan penanganan banyak perkara dan sebagai PNS manalah mungkin mereka menganjurkan orang untuk berpoligami (karena poligami dengan hukum negara mempunyai syarat yang sangat ketat, harus ada izin istri, izin atasan, dlsb sehingga telah mendorong banyaknya nikah siri/ bawah tangan). Namun bagi Mediator bersertifikat yang bukan PNS akan berani memberi solusi poligami. Penulis adalah Wartawati Waspada Medan.

Aceh

B10

Nyak-nyak Di Jambo Aye Resah

Aktivitas SMAN 4 Pantonlabu Serba Darurat

Waspada/M Jakfar Achmad

KASEK SMA persiapan negeri nomor 4 Pantonlabu, di Desa Tanjong Meunuang, Kec. Tanah Jambo Aye, Aceh Utara, Fuadi, melihat puing-puing kerusakan mobiler dan perlengkapan lain di ruang kantor guru akibat dilanda angin puting beliung yang menimpa sekolah ini, Jumat pekan lalu.

Sidang Pembobolan Kas Pemkab Aceh Utara

PANTONLABU (Waspada) : Nyak-nyak (perempuan kelompok usaha home industry) di Kec. Tanah Jambo Aye, Aceh Utara, akhirakhir ini resah akibat tunggakan pinjaman dana PNPM dan BKPG mencapai ratusan juta rupiah. Sumber layak dipercaya menyebutkan, hal yang meresahkan ibu-ibu (nyak-nyak), terkait adanya ancaman dari unit pengelola kegiatan (UPK) Tanah Jambo Aye, jika pinjaman dana bergulir itu tidak lancar dikembalikan, akan ada sanksi hukum segala macam proyek yang ditunjang dana PNPM akan ditunda bagi desa (gampong) bersangkutan. Demikian pula terhadap dana Bantuan Kemakmuran Peumakmu Gampong (BKPG), pokoknya kedua jenis dana bantuan pemerintah untuk desa tersebut akan dipending oleh UPK di Tanah Jambo Aye. “Saya menerima laporan, ada ‘bayang-bayang’ sanksi yang membuat ibu-ibu/perempuan kelompok usaha di desa ini ketakutan,” kata Keuchik Biara Timu, Kec. Tanah Jambo Aye, Aceh Utara, M Nur Usman.(b13)

YPI Darussadah II Cot Tarom Miliki MTs BIREUEN (Waspada): Yayasan Pendidikan Islam (YPI) Darussaadah II Cabang Cot Tarom, Jeumpa, Bireuen, sekarang ini memiliki sekolah Madrasah Tsanawiyah (MTs). Sekolah yang dibangun dengan bantuan swadaya masyarakat dan donatur lainnya di komplek dayah pimpinan Tgk H Muhammad Ishak yang akrab disapa Abon Cot Tarom tersebut, Sabtu (31/3) diresmikan Bupati Bireuen Nurdin Abdul Rahman diwakili Asisten II bidang ekonomi dan pembangunan, Zulkifli, ikut dihadiri Kapolres Bireuen AKBP Yuri Karsono, SIK, Dandim 0111/Bireuen serta sejumlah tokoh masyarakat lainnya. Tgk H Muhammad Ishak mengatakan, sekolah yang berstatus swasta dibangun atas permintaan masyarakat serta orang tua santri. Kemenag Bireuen Zulhelmi mengatakan, pihaknya akan menempatkan guru-guru sertifikasi yang belum cukup jam mengajarnya sebagaimana ditentukan di sekolah tersebut. (cb02)

Dua Ruko Hangus Terbakar ALUE IE PUTEH (Waspada): Dua pintu rumah toko (ruko) yang menjual kelontong sekaligus tempat jual beli hasil pertanian di Desa Matang Rawa, Kec. Baktiya—Alue Ie Puteh, Aceh Utara, hangus terbakar, Senin (2/4) sekitar pukul 19.30. Tak ada korban jiwa. Namun hampir seluruh isi ruko, termasuk sekitar satu ton biji pinang dan ratusan kilogram kakao serta gabah, musnah jadi arang. Kerugian ditaksir Rp250 juta. Sementara sumber api diduga arus pendek listrik. “Api pertama muncul di dekat meteran listrik, lalu menjalar cepat ke bagian atap. Saya sendiri hanya sempat menyelamatkan sepeda motor dan baju di badan. Barang lain, semuanya hangus dilalap api,” kata Muhammad, 30, guru, yang tinggal di ruko tersebut. Muhammad menjelaskan, ruko tersebut milik Hj Maimunah, 80, warga setempat. Bagian depan, berupa dua pintu toko, disewa Tgk Ibrahim, 65, menantu Hj Maimunah. Sehari-hari, Tgk Ibrahim menjadikan toko tersebut sebagai tempat berjualan kelontong sekaligus tempat jual-beli hasil pertanian. “Saya sendiri bersama keluarga, menyewa bagian belakangnya. Saat kejadian, kami berada dalam rumah. Saya tahu ruko terbakar setelah mendengar teriakan warga dari luar. Ketika itu, api sudah membesar. Saya buru-buru menyelamatkan anak-anak, lalu mengeluarkan sepeda motor. Selanjutnya, api tak mungkin diterobos lagi,” imbuhnya. Sementara Tgk Ibrahim menyebutkan, saat kejadian, dia dan keluarga berada di rumahnya, sekitar 15 meter dari lokasi kebakaran. Sama seperti Muhammad, dia juga mengetahui kebakaran itu setelah diberitahu warga dari desa tetangga yang kebetulan melintas di lokasi kejadian. (b19)

Tuntutan Jaksa Belum Siap

BANDAACEH (Waspada) : Majelis hakim Pengadilan Tin-dak Pidana Korupsi (Tipikor) Banda Aceh, Selasa (3/4), kem-bali menunda sidang kasus bo-bolnya Rp220 miliar dana de-posito kas Pemkab Aceh Utara. Pasalnya, jaksa penuntut umum dari Kejaksaan Negeri Banda Aceh belum siap membacakan tuntutannya. Akibatnya, majelis hakim diketuai M Arsyad Sundusin sempat memperingatkan jaksa

agar serius membuat tuntutan, karena sudah tiga kali dilakukan penundaan persidangan dengan alasan jaksa belum siap dengan tuntutannya. “Saya minta saudara serius, karena sudah diberikan waktu 1,5 bulan lebih, tapi tuntutannya belum siap juga,” tegas Arsyad Sundusin. Pada persidangan itu selain belum siapnya jaksa membacakan tuntutan, juga salah seorang terdakwa Ilyas A Hamid, mantan Bupati Aceh Utara tidak hadir ke persidangan, dengan alasan sakit lambungnya kambuh. Untuk membuktikan terdakwa Ilyas A Hamid sakit,

penasihat hukumnya Sayuti Abubakar memperlihatkan secarik surat keterangan dokter kepada majelis hakim. Sementara terdakwa II Syarifuddin, mantan Wakil Bupati Aceh Utara, meskipun kondisinya masih sakit, namun tetap hadir ke persidangan. Penasihat hukum terdakwa Syarifuddin, Syamsul Rizal dalam persidangan itu kembali memohon kepada majelis hakim agar diberi status pengalihan tahanan, karena terdakwa perlu rawat jalan. Untuk mendengarkan tuntutan jaksa, majelis hakim menunda sidang hingga, Selasa (10/4).(b02)

BLHK Komersilkan Alat Berat Untuk Dapatkan Jatah LHOKSEUMAWE (Waspada) : Pihak Badan Lingkungan Hidup dan Kebersihan (BLHK) Lhokseumawe ternyata sering mengomersilkan alat berat jenis Buldozer untuk mendapatkan jatah uang. Hal itu terungkap dalam keterangan yang disampaikan terdakwa Safrizal selaku operator, warga Aceh Timur dalam sidang lanjutan kasus pelarian alat berat BLHK, Selasa (3/4) di Pengadilan Negeri Lhokseumawe di Banda Sakti, Kota Lhokseumawe. Terdakwa juga mengaku dengan mudah membawa keluar masuk alat tersebut selama dua tahun lebih, jika sudah memberikan uang kepada petugas dan Kepala BLHK. Sidang itu dibuka Ketua majelis hakim Syamsul Qamar didampingi dua hakim anggota M Jamil dan Teuku Syarafi dan Jaksa Penuntut Umum (JPU) dihadiri Saifuddin. Sedangkan terdakwa hadir ke pengadilan bersama sejumlah temannya dengan mamakai baju merah dan sandal jepit. “Saya membawa buldozer ke Aceh Timur pada 26 Juli 2011, setelah mendapat izin secara lisan dari mandor T Muhayat-

syah, dan Kasi Kemotoran Faisal, dan sebelumnya saya sudah memberikan upeti kepada mereka,” katanya. Dalam perjalanan saat membawa buldozer, kata Safrizal, dirinya juga sudah memberitahukan Kepala BLHK Ishaq Rizal (sekarang mantan), karena dirinya tak sempat jumpa untuk menyerahkan uang. “Tapi ketika saya bilang ada titipan uang, Ishaq langsung

meminta saya segera mengirimkan uang itu. Tapi tak sempat saya kirim karena saat mengerjakan cetak sawah baru di Aceh Timur, saya rugi, tapi sebelumnya selalu ada jatah uang untuk Ishaq, mandor, kasi dan sejumlah petugas lain,” katanya. Diungkapkan Safrizal, sejak 2010 dirinya bekerja sama dengan petugas BLHK untuk mengomersilkan buldozer, kemudian hasilnya dibagikan kepada petugas di BLHK. (b16)

Dandim Dan Petani Panen Padi Program Catur Karya BIREUEN (Waspada): Dandim 0111/Bireuen Letkol Inf M Arfah didampingi Sekdakab Bireuen, para petani yang tergabung dalam Kelompok Tani “Ingin Maju” dan jajaran Dinas Pertanian setempat melakukan panen perdana padi Program Catur Karya yang dicanangkan Pangdam Iskandar guna meningkatkan ketahanan pangan dan perekonomian petani. Armaini, Ketua Kelompok Tani ”Ingin Maju” di Desa Lipah Rayeuk, Kec.Jeumpa mengatakan, hasil panen padi tersebut mencapai 10 ton per hektare dengan luas areal mencapai 5,2 ha. “Mulai dari persemaian benih hingga panen tetap diawasi Pak Dandim serta Dinas Pertanian,” tutur Armaini. Untuk kelanjutan program ini, sebagaimana direncanakan dan telah berkoordinasi dengan dinas terkait, Kodim 0111/Bireuen melaksanakan pengembangan tanaman karet dan kakao di Simpang Mamplam. “Kegiatan lanjutan itu juga atas dasar permintaan dari para mantan kombatan,” jelas Letkol Inf Muhammad Arfah. (cb02/b17)

Siapa Lagi Yang Mau Menyusul...

Waspada/Musyawir

ANGGOTA Pramuka dari SMAN 1 Baktiya membantu membersihkan sisa kebakaran di ruko milik Hj Maimunah, di Desa Matang Rawa, Baktiya, Selasa (3/4) pagi.

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

14:30

Rabu 4 April 2012

Diterjang Puting Beliung

Cetak Sawah Baru Diberikan Pemerintah Pusat Melalui APBN JEURAM (Waspada) : Sebagai Kabupaten baru Nagan Raya cukup memiliki sumberdaya alam. Namun, jika sumberdaya alam tersebut tidak digali sama saja nol. Seperti, masih luasnya lahan tidur yang dapat digarap, salah satunya dapat digunakan sebagai lahan persawahan. Informasi dihimpun Waspada hingga, Selasa (3/4) Pemerintah Kabupaten Nagan Raya dalam tahun 2012 ini telah memprogramkan cetak sawah baru seluas 1.600 hektare yang tersebar di seluruh kecamatan di wilayah. Diperkirakan total areal sawah mencapai 17.120 hektare. “Program cetak sawah baru yang diberikan oleh pemerintah pusat melalui dana APBN ini untuk menambah luas areal persawahan baru sehingga produksi padi dan akan semakin lebih baik,” kata Kepala Dinas Pertanian dan Peternakan Kabu-paten Nagan Raya Ali Basyah, SP. Menurutnya, program cetak sawah baru itu akan difokuskan di kawasan minim areal persawahan, seperti di Kecamatan Kuala Pesisir, Tadu Raya, Kuala serta sejumlah kawasan lainnya yang belum luas areal persawahannya. Dikatakan, dengan luas areal persawahan sebanyak 17.120 hektare yang saat ini dimiliki Nagan Raya telah mampu memproduksi padi sebanyak 176.800 ton dengan surplus beras sebanyak 110.000 ton. Diharapkan, dengan penambahan areal cetak sawah baru itu, akan terus meningkatkan hasil panen. (cda)

WASPADA

PERTANYAAN tanpa tanda tanya ini tertera di sudut bawah sebuah papan kecil di Mapolres Aceh Utara di Lhoksukon. Papan putih ukuran 50x30 cm itu dipajang di lorong kantor, persis dekat Bagian Sumberdaya Manusia. Di dalamnya ada delapan kolom pasfoto. Tiga di antaranya masih kosong. “Ini foto anggota kita yang sudah dipecat. Mereka ada tujuh orang dan rata-rata dipecat karena indisipliner atau tidak disiplin,”kata Kapolres Aceh Utara AKBP Farid Bahtiar Effendi, kepada Waspada, Selasa (3/4). Ketujuh mantan penegak hukum tersebut masing-masing Aipda Heru Wasiatmoko, Aipda Mitrayadi, Bripka Fafan Zulfansyah, Brigadir Isma Mulyadi, Briptu Rizki Trini, Bripda Dwi Septhianda dan terakhir Briptu Dodi Handoko. “Lima dari tujuh orang ini, dipecat dalam dua tahun terakhir atau selama saya menjabat Kapolres. Ini membuktikan hukum benar-benar kita tegakkan. Siapapun dia, jika melawan hukum pasti kita tindak,” ujar AKBP Farid. Khusus Dodi Handoko, yang upacara pemecatannya digelar di halaman Mapolres Aceh Utara, Senin (2/4) pagi, terpaksa menanggalkan seragam

PANTONLABU ( Waspada): Setelah diterjang angin puting beliung yang menimpa bangunan SMAN 4 Pantonlabu, di Desa Tanjong Meunuang, Kec. Tanah Jambo Aye, Aceh Utara, aktivitas belajar mengajar di sekolah itu berlangsung serba darurat. Kepala sekolah Unit Sekolah Baru (USB) yang mulai beroperasi tahun 2009 ini, Fuadi, mengimbau Pemkab Aceh Utara secepatnya menanggulangi sarana dan prasarana yang rusak dilanda puting beliung (tornado/angin puyuh) dan hujan deras terhadap sekolah ini, Jumat (30/3) pekan lalu. “78 Dari 198 siswa SMA persiapan negeri nomor 4 Pantonlabu tersebut, pada 16 April ini akan mengikuti Ujian Nasional (UN) perdana. Demi kelancaran UN kita harapkan tin-dakan cepat Pemkab dan untuk ini kita sudah kirimkan data-data kerusakan ke pihak atasan, Senin (2/4),” kata kasek, Selasa (3/4).

Dijelaskan, daftar kerusakan sekolah yang ditimbulkan bencana angin puting beliung antara lain satu unit atap ruang kantor, 3 set komputer, sound system, kamera digital, 22 unit meja guru, 22 kursi guru, meja kasek, kursi kasek, 3 buah meja tata usaha, 3 kursi tata usaha, 3 lemari arsip, 3 kipas angin, papan struktur, 3 paket perleng-kapan dapur, 267 buku paket siswa, 51 buku pegangan guru dan satu set alat kesenian (re-bana). Kabid Sarana dan Prasarana Dinas Pendidikan, Pemuda dan Olahraga Aceh Utara, Anwar, mengatakan, dasar laporan kasek, pihaknya telah memformatkan telaah staf. “Berikutnya kami menunggu arahan dan kebijakan atasan. Sebelumnya, kami juga telah mendata di lapangan, kerusakan fisik mau-pun perlengkapan sekolah ini akibat bencana angin puting be-liung berkisar Rp200 juta,” ujarnya. (b13)

Konsultan Proyek Dan Mantan Kadis Koperindag Aceh Tamiang Dilaporkan KUALASIMPANG (Waspada) : Konsultan proyek pembangunan pasar tradisional dan sarana pendukung lainnya di Kec.Manyak Payed, Kab.Aceh Tamiang Tahun Anggaran 2010 sebesar Rp1.170.840.000 dan nilai kontrak proyek tersebut senilai Rp974.639.000, Ade Chandra, yang juga Direktur CV Putra Karya Konsultan dan mantan Kadis Koperindag Aceh Tamiang Ramli sudah dilaporkan oleh Zulkifli, PNS kepada Kejari Kualasimpang terkait dengan kasus dugaan tindak pidana korupsi proyek tersebut, Selasa (3/4). Zulkifli yang juga narapidana kasus tipikor proyek tersebut yang saat ini sedang menjalani hukuman di LP Klas II B Kualasimpang itu melaporkan keduanya dan diterima Kasi Tindak Pidana Umum Erwin Nasution karena Plt Kasi Pidsus Haykal sedang mengikuti sidang kasus Tipikor di Pengadilan Tipikor Banda Aceh dan Kajari Kualasimpang M Basyar Rifai sedang mengikuti acara di Kantor Bupati Aceh Tamiang. Menurut Zulkifli, konsultan proyek tersebut Ade Chandr dan mantan Kadis Koperindag Aceh Tamiang Ramli yang ketika itu sebagai Kadis Koperindag setempat dan juga Kuasa Pengguna Anggaran ( KPA) proyek tersebut telah melakukan penipuan dan pemalsuan laporan kemajuan pekerjaan pembangunan pasar tradisional di Manyak Payed Tahun Anggaran 2010. Zulkifli dalam laporan pengaduannya Nomor :PDS 01/N.I.22/Fd.I/04/2012 itu melampirkan satu eksemplar surat perjanjian kontrak kerja No.14/445/Disperindagkop/Atam/VIII/ 2010 tanggal 17 Agustus 2010, satu eks surat perjanjian kerja (kontrak) No.010/10/SPK/2010 tanggal 2 September 2010, satu eks berkas Perkara Tindak Pidana Korupsi atas nama Zulkifli bin Ibrahim dan satu eks surat pernyataan tanggungjawab No.91/900/2010 tanggal 30 Desember 2010. Menurut Zulkifli, Dinas Perindustrian, Perdagangan, Koperasi Aceh Tamiang pada 2010 dialokasikan Dana Alokasi Khusus (DAK) pembangunan pasar tradisional dan sarana pendukung lain di Manyak Payed dengan anggaran Rp1.170.840.000 dan nilai kontrak Rp974.639.000 yang dikerjakan PT Loeh Raya Perkasa dengan Direktur Zulfadlisyah sesuai dengan surat perjanjian kerja Nomor.010/10/SPK/2010 tanggal 2 September 2010. Zulkifli membeberkan, dalam pelaksanaan pembangunan proyek tersebut, Kadis Dispe-

rindagkop Aceh Tamiang/KPA Ramli menunjuk CV Putra Karya sebagai konsultan pengawas dengan surat perjanjian kerja pekerjaan pengawasan teknis pembangunan pasar tradisional di Manyak Payed Nomor.14/445/Disperindagkop/Atam/VIII/2010 tanggal 27 Agustus 2010 yang tugasnya memeriksa dan mempelajari dokumen untuk pelaksanaan konstruksi yang dijadikan dasar dalam pengawasan pekerjaan di lapangan. Selain itu lagi, pihak konsultan juga bertugas mengawasi pemakaian bahan, peralatan dan metode pelaksanaan serta mengawasi ketepatan waktu dan biaya pekerjaan konstruksi, mengawasi dan memeriksa perubahan serta penyesuaian yang terjadi selama pekerjaan konstruksi. Tugas lainnya, konsultan pengawas membantu memecahkan persoalan yang terjadi selama pelaksanaan konstruksi terkait dengan masalah pembangunan dan bila diperlukan konsultan pengawas dapat menyelenggarakan rapat-rapat lapangan secara berkala dan menyiapkan laporan. Selanjutnya, ungkap Zulkifli, 20 September 2010, Kadis Perindagkop/KPA Aceh Tamiang Ramli menunjuk PPTK (Pejabat Pelaksana Teknis Kegiatan) dengan surat keputusan Kadis Koperindagkop/KPA Aceh Tamiang Nomor 111.3.1 tahun 2010 tanggal 20 September 2010. “Kenapa saya yang dihukum, sedangkan Konsultan Pengawas dan mantan Kadis Perindagkop/KPA Aceh Tamiang itu tidak dijadikan tersangka, padahal mereka ikut juga dalam proyek ini,” tegas Zulkifli yang akan melaporkan kasus ini ke Komisi Yudisial dan pihak terkait lainnya di Jakarta. Kajari Kualasimpang M Basyar Rifai melalui Kasi Pidum Erwin Nasution membenarkan Zulkifli telah melaporkan Ade Chandra dan Ramli ke Kejari Kualasimpang. “Nanti akan saya pelajari terlebih dahulu kasus ini, kalau memang ditemukan ada bukti dan ada saksi, maka tentu saja kasus ini akan dibuka kembali untuk diproses,” tegas M Basyar Rifai. Sedangkan tentang Syafrizal yang sudah divonis karena ikut terlibat dalam proyek itu, tetapi belum dijebloskan ke dalam penjara, kata Kajari Kualasimpang, karena Syafrizal mengajukan banding kepada Pengadilan Tinggi Banda Aceh. (b23)

Lahan Cetak Sawah Baru Telantar, Petani Lhoksukon Kembalikan Benih Padi LHOKSEUMAWE (Waspada) : Puluhan petani di Kecamatan Lhoksukon, Kabupaten Aceh Utara mengembalikan ratusan zak benih padi bantuan Dinas Pertanian dan Tanaman Pangan setempat, Selasa (3/4). Mereka kecewa dengan dinas tersebut karena telah menelantarkan 120 hektare sawah baru yang dibangun dari dana APBN TA-2011. Menurut keterangan petani setempat, pada pertengahan 2011, Dinas Pertanian membuka lahan cetak sawah baru di Lhoksukon Teungoh. Sekitar 120 hektare sawah dibuka di Gampong Dayah, Menasah Meuriya dan Gampong Meureubo. Lahan tersebut ditumbuhi semak sehingga tidak produktif. “Setelah lahan dibersihkan, juga dibangun saluran air yang berasal dari Irigasi Langkahan,” jelas Keucyik Meureubo, Idris A Gani. Namun saluran yang dibangun sangat sempit. “Hanya dipasang gorong-gorong kecil sehingga airnya tidak bisa mengalir,” tutur Kepala Dusun Tgk Di Krueng, Nasruddin. Akibatnya, lahan sawah baru kini ditumbuhi semak karena tidak bisa dimanfaatkan warga. Mereka juga mendapat informasi, untuk program cetak sawah baru, pemerintah pusat

telah menganggarkan dana sampai Rp1,3 miliar. Sehingga mereka mempertanyakan mengapa lahan sawah baru tidak diselesaikan sehingga terlantar kembali. Pada Desember 2011 lalu, petugas Dinas Pertanian dan Tanaman Pangan Aceh Utara menyerahkan ratusan zak benih padi kepada petani dari Lhoksukon. Namun sampai memasuki bulan keempat 2012, air dari saluran irigasi belum juga mengalir ke sawah. Bahkan berbagai tumbuhan semak belukar menutupi lokasi itu. “Untuk apa benih padi, kalau sawah tidak bisa dikelola,” ujar Rusli, 35, petani setempat. Sehingga mereka mengembalikan seluruh benih ke Dinas Pertanian, dengan harapan pemerintah daerah setempat segera membangun saluran agar bisa mengairi sawah warga. Kepala Dinas Pertanian dan Tanaman Pangan Aceh Utara M Abbas menjelaskan, bantuan cetak sawah baru merupakan program pemerintah pusat. Begitu juga dengan benih padi yang dikembalikan warga, merupakan bagian dari program cetak sawah baru. Selain di Lhoksukon, pemerintah daerah juga mencetak sawah baru di beberapa kecamatan di Aceh Utara, di antaranya di Kecamatan Sawang. (b15)

Rawa Itek Pantonlabu Nikmati APBK Aceh Utara Rp1,7 M Waspada/Musyawir

WARGA memperhatikan papan nama anggota Polres Aceh Utara yang dipecat, di Mapolres setempat, Selasa (3/4). polisi lantaran positif mengonsumsi narkoba dan sudah lebih tiga kali naik sidang disiplin. “Dodi sering kami ingatkan karena jarang masuk dinas. Sekitar empat bulan lalu, dia ditarik ke Mapolres, di bagian penjagaan. Di sini pun Dodi jarang masuk dinas dan ketika tes urin di Mapolda, dia positif memakai narkoba,” kata Iptu Idris, Kapolsek Payabakong, selaku mantan atasan Dodi. Briptu Dodi dianggap tak patut lagi dipertahankan status-

nya sebagai polisi dan dia dipecat berdasarkan Pasal 13 PP Nomor 2 Tahun 2003, tentang Peraturan Disiplin Anggota Polri. “Kita berharap ini menjadi pelajaran berharga bagi anggota lain. Mudah-mudahan ke depan tak ada lagi anggota yang menyusul dipecat dan mereka yang sudah diberhentikan bisa introspeksi diri demi meraih sukses,” tutur AKBP Farid BE. (b19)

PANTONLABU (Waspada) : Gampong Rawang Itek Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, menikmati APBK Aceh Utara, TA/ 2012 sebesar Rp1,7 miliar lebih. Beberapa tokoh masyarakat di Pantonlabu mengatakan, pantas saja karena desa ini merupakan bagian dari ibukota Kec. Tanah Jambo Aye (Pantonlabu), termasuk wilayah Kemukiman kota Pantonlabu. Masyarakatnya terpadat, dibanding 46 desa di kecamatan ujung timur Aceh Utara ini. Item alokasi Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Utara TA 2012 yang mengakses desa di lintas jalan negara Medan-Banda Aceh ini antara lain lanjutan peningkatan jalan yang menghubungkan Desa Rawa Itek – Desa Matang Drien, dengan anggaran sebesar Rp850 juta. Berikutnya paket proyek normalisasi saluran pembuang ke areal persawahan Kemu-

kiman kota Pantonlabu, sebesar Rp192 juta. Penyelesaian pembangunan ruang kelas belajar (RKB) Sekolah Dasar Negeri (SDN) 1 Pantonlabu Rp57 juta. Lanjutan pembangunan stadion Rp499 juta dan bantuan usaha kelompok ‘Beurata’ sebesar Rp35 juta. Rumah duafa, juga mendapat alokasi anggaran APBK di desa ini. Kendati hanya satu unit, yaitu atas nama Tgk Ibrahim dengan besaran anggaran Rp50 juta. Pengembangan usaha sulam bordir ‘Bungong Jaroe’, pula tidak ketinggalan demi pembinaan ketrampilan ibu-ibu dengan anggaran sebesar Rp15 juta. Item terakhir yaitu bantuan pos tidak langsung, yaitu sharing APBK terhadap Taman Kanak-kanak Swasta (TKS) Al-Wahyudi, sebesar Rp2 juta. Dari akumulasi tersebut, alokasi APBK terhadap desa ini terendah Rp2 juta dan tertinggi Rp850 juta. (b13)

WASPADA Rabu 4 April 2012

Aceh

B11

Angin Kencang Landa Pidie, Gedung Sekolah Ambruk SIGLI (Waspada): Angin kencang melanda daerah pesisir, Pidie, Senin (2/4) sekira pukul 18:30, menyebabkan gedung sekolah Madrasah Aliyah Swasta (MAS), Tgk Chik Dicuree, Desa Sagoe, Kecamatan Muara Tiga ambruk tertimpa pohon kelapa. Tidak ada korban jiwa dalam peristiwa bencana alam itu. Namun akibat peristiwa itu, atap gedung sekolah ambruk dan kaca-kaca jendela pecah. Beruntung meubiler sekolah, seperti meja bangku dan lemari bisa diselamatkan. Kerugian ditaksir mencapai Rp 20 juta. Ibnu Hajar, seorang guru MAS Tgk Chik Dicuree, kepada Waspada, Senin (2/4) mengungkapkan, peristiwa angin kencang itu muncul secara tiba-tiba dan menumbangkan batang pohon kelapa yang banyak tumbuh di halaman belakang gedung menimpa atap sekolah. Sebenarnya pohon kelapa yang banyak tumbuh di belakang gedung sekolah sangat berbahaya bila bencana alam serupa muncul kembali. Namun karena pohon kelapa itu milik masyarakat, pihak sekolah tidak bisa menebangnya. Meskipun harus ditebang harus ada ganti rugi. “ Karena itu kami berharap pihak terkait bisa membantu kami menebang pohon kelapa itu supaya tidak memakan korban jiwa” pintanya. (b10)

Masih Ada Di Nagan Raya Sekolah Tidak Beroperasi TERIPA, Nagan Raya (Waspada) : Anggaran yang dikeluarkan pemerintah untuk biaya pandidikan sangat besar, bahkan setiap tahun jumlahnya juga ditingkatkan, dengan harapan besar kedepan dapat memperbaiki kualitas pendidikan, terutama di Daerah. Di Kecamatan Teripa Kabupaten Nagan Raya terdapat gedung sekolah yang dipenuhi semak belukar karena tidak difungsikan. Tentunya hal ini seolah mewujudkan minimnya perhatian pemerintah daerah terhadap pendidikan. Hasil amatan Waspada, Selasa (3/4), lebih dari satahun gedung sekolah tersut tidak difungsikan. Tentunya hal itu sangat mengecewakan, sebab jika gedung sekolah difungsikan para siswa dapat menempuh sekolah lebih dekat. Hingga saat ini masih terdapat siswa yang berangkat sekolah dengan berjalan kaki. Menjadi harapan besar baginya agar gedung sekolah segera difungsikan agar anak sekolah dapat lebih dekat dan memperkecil risiko bagi siswa yang berjalan kaki. “Pemerintah Derah harus memiliki kebijakan untuk segera memfungsikan gedung sekolah yang sudah bertahun terbengkalai,” ucapnya. Kepala Dinas Pendidikan Kabupaten Nagan Raya saat ingin dikonfirmasi, Selasa (3/4) (3/4) tidak ada di tempat. Hal itu dikemukakan dua orang stafnya berada di ruangan Kadis. (cda)

Di Nagan Raya, Pemilik Warnet Sajikan Game Online JEURAM (Waspada) : Di Kabupaten Nagan Raya, untuk menarik perhatian remaja, terutama pelajar, pemilik warnet menyajikan game online. Dimana peminatnya didominasi pelajar Sekolah Menengah Pertama (SMP), Sekolah Menengah Atas (SMA). Bahkan siswa Sekolah Dasar (SD) tidak luput dari candu bermain game secara online. Menanggapi itu, Ketua Yayasan Pendidikan Pembangunan Informatika (YPPI) Nagan Raya Mahyudi, SE, Selasa (3/4) berpendapat. para orang tua seharusnya mampu mengawasi anaknya untuk tidak benyak menghabiskan waktu diluar rumah tanpa alasan yang jelas. Selain itu, untuk tidak membuang waktu percuma di luar ruamah, pantas pula kiranya orang tua mencarikan solusi tempat bagi anaknya untuk mengisi waktu luangnya dengan kegiatan positif yang lebih terarah dan bermanfaat. (cda)

Hewan Ternak Marak Di Jalan Raya Meulaboh MEULABOH (Waspada) : Ternak milik warga seperti sapi dan kambing, sering berkeliaran di sejumlah jalan raya di Meulaboh. Akibatnya, perjalanan terkadang jadi terhambat, kotor dan rentan terjadi kecelakaan. Pantauan Waspada, Selasa (3/4) hewan ternak melintasi ruas jalan protokol tepat di depan kantor Bupati Meulaboh Aceh Barat. Berdasar Qanun No 8/ 2011, sapi dan sejenisnya yang tertangkap didenda Rp300 ribu per ekor, plus biaya pemeliharaan Rp 100 ribu per hari. Sementara kambing Rp200 ribu per ekor plus biaya pemeliharaan Rp50 ribu per hari. Jika lebih dari tiga hari, hewan itu akan dilelang, uangnya akan diberi ke pemilik sesudah diambil denda dan biaya rawat. (cda)

GeRAK Aceh Latih Anggota Dewan Bireuen Dan Aceh Tengah BANDA ACEH (Waspada): Gerakan Anti Korupsi (GeRAK) Aceh bekerjasama dengan The Asia Foundation (TAF) menggelar pelatihan anggaran yang berbasis kebutuhan kelompok rentan dan perempuan yang diikuti anggota DPRK Bireuen dan Anggota DPRK Aceh Tengah. Pelaksanaan kegiatan yang difasilitasi Sri Mastuti dari BASICS Jakarta sebagai penasehat tentang tatakelola yang demokratis dan gender, ini dilangsungkan di Hotel Grand Nanggroe Banda Aceh selama dua hari, Selasa dan Rabu (3-4/4). Menurut Koordinator GeRAK Aceh, Askhalani, Selasa (3/ 4), kegiatan ini merupakan rangkaian dalam Program Peningkatan Efektifitas Partisipasi Perempuan untuk Mendorong Tata Pemerintahan dan Demokrasi yang Responsif Gender di Aceh. Kegiatan yang dilaksanakan juga diharapkan adanya strategistrategi baru yang secara komprehensif untuk difahami oleh anggota legislatif di Kabupaten Bireuen dan Aceh Tengah dalam implementasi pengarusutamaan gender khususnya dalam fungsi legislatif. (b04)

Sejumlah Pelajar Bolos Terjaring BIREUEN (Waspada) : Sedikitnya 10 pelajar yang membolos saat jam belajar di Bireuen dijaring anggota Satuan Polisi Pamong Praja (Satpol-PP) di warung internet (warnet) dan tempat play station, Selasa (3/4). Komandan Satpol PP Bireuen, Mukhsen mengatakan, sepuluh pelajar ini yakni enam di antaranya siswa SMA Negeri 2 Bireuen, dua siswa SMK PGRI dan dua pelajar MTsN. “Kemudian mereka kita bawa ke pendopo, selanjutnya diserahkan ke Dinas Pendidikan Bireuen untuk diserahkan kepada kepala sekolah masing-masing,” ucapnya. Menurutnya, razia ini dilaksanakan berkat banyak informasi dari masyarakat tentang ulah sejumlah siswa yang bolos dan mereka mampir di warnet dan play station. (b17)

Polisi Amankan Tersangka Pembunuh Iskandar BIREUEN (Waspada) : Aparat kepolisian kembali mengamankan satu lagi tersangka pelaku pembunuhan bermotif dendam yang menewaskan Iskandar, warga Juli Paseh, Kec. Juli, sementara pelaku utama masih diburon. Kapolres Bireuen AKBP Yuri Karsono melalui Kanit I Pidum Aipda T Saiful Mahdisyah, Selasa (3/4) kepada wartawan mengatakan, seorang pelaku pembantu yang diamankan Selasa (3/4) dinihari itu berinitial Mu, 18, asal Juli setelah diserahkan keluarganya sekira pukul 02.30. Begitupun, katanya, polisi kini sedang berupaya untuk mengamankan pelaku utama, AR, termasuk dengan cara pendekatan dengan anggota keluarganya agar tersangka menyerahkan diri. (cb02/b17)

Gagal Diangkat, Tenaga Honorer Temui Ketua Komisi D

Waspada/Muhammad Riza

SEORANG guru memperhatikan gedung sekolah MAS Tgk. Chik Dicuree, Kecamatan Muara Tiga yang ambruk tertimpa pohon kelapa, akibat tiupan angin kencang yang terjadi, Senin (2/4) sore.

Kuota Raskin Agara Berkurang 60 Ton Per Bulan KUTACANE (Waspada) : Hasil pendataan Badan Pusat Statistik (BPS) Aceh Tenggara, yang mendata jumlah keluarga miskin berkurang tanpa mengikutsertakan data keluarga menengah ke bawah, berdampak bakal terjadi pengurangan raskin sekira 60 ton per bulan . Hal ini disesalkan sejumlah kepala desa dan pengamat kebijakan publik Agara. Ridwan A Gani, Kasub Divre Bulog Kutacane, kepada Waspada, Selasa (3/4) mengatakan, hingga bulan Mei 2012 stok raskin Agara penyaluranya tetap sejumlah 494 ton per bulan. Hal ini sesuai masih dengan jumlah penyaluran pada tahun 2011. Untuk 16 kecamatan se-Agara. Namun besar kemungkinan mulai Juni 2012 bakal terjadi pengurangan raskin sejumlah 60 ton per bulan. Berdasarkan data BPS Agara itu, terjadi pengu-

rangan jumlah orang miskin. Yashut, pengamat kebijakan publik di Agara, menyesalkan soal informasi bakal terjadinya penurunan jumlah penyaluran raskin di Agara. Pasalnya, sesuai peraturan pemerintah tahun 2012 di dalam penentuan kuota raskin. Dikatakan, jumlah kuota dihitung berdasarkan jumlah KK miskin ditambah jumlah KK menengah. Artinya, kata dia, meski disebut BPS angka kemiskinan berkurang, seharusnya jumlah raskin tahun 2012 ini akan bertambah bukan justru berkurang. Yashut juga mengatakan pihaknya ragu soal kebenaran data BPS Agara, pasalnya dilapangan justru terlihat keluarga miskin bertambah di Agara. Kasub Bulog Agara, Ridwan A Gani membenarkan penjelasan yang disampaikan Yashut kepada Waspada. Dikatakan, pihak Bulog juga telah menyampaikan ke BPS, ada keanehan soal kuota raskin di Agara yang mengalami penurunan sekira 60 ton per bulan.Pasalnya se-Aceh, hanya Agara yang mengalami pengurangan raskin. ‘’Padahal aturan pemerintah ta-

hun 2012 soal penyaluran raskin ditentukan penjumlahan KK miskin ditambah jumlah KK menengah ke bawah. Pihak BPS Agara,’’ kata Ridwan A Gani seraya menyebutkan, mereka tidak ada diperintahkan mendata keluarga menengah ke bawah. Persoalan raskin ini juga telah disampaikan Bulog Kutacane, pada bagian Ekonomi Setdakab Agara pada bulan Januari 2012 lalu, agar ditinjau ulang soal pendataan BPS karena tidak menyertakan jumlah data KK menengah ke bawah. Dikhawatirkan hal ini akan menjadi persoalan nantinya. Saat ini saja para kepala desa justru meminta penambahan kuota raskin di desa mereka. Secara moral,kata Ridwan,dia telah mengingatkan pihak terkait di Agara, namun hingga April tidak diketahui jawaban. Dipastikan bila tidak ditindaklanjuti , maka, mulai bulan Mei ini akan keluar Peraturan Gubernur tentang penetapan kuota raskin ini maka dipastikan pengurangan kuota raskin 60 ton per bulan di Agara, demikian Ridwan.(b25)

Dana Zakat PNS Agara 2 Tahun Belum Disalurkan KUTACANE (Waspada) : Elemen masyarakat Agara kembali mempertanyakan tentang penyaluran zakat PNS Aceh Tenggara sejumlah Rp3 miliar diperuntukan pada fakir miskin yang belum juga disalurkan oleh pemerintah daerah sejak 2 tahun ini. Koordinator JK-Matra Agara, Selasa (3/4) menyesalkan sikap pemerintah daerah yang terkesan hanya basa-basi perduli dengan rakyat miskin. Faktanya hingga saat ini hak fakir miskin berupa dana zakat yang dipotong dari gaji PNS se-Kabupaten Agara tersebut sudah 2 tahun lebih belum disalurkan. Pada November 2011 lalu, berbagai pihak telah melakukan protes terkait pembuatan pera-

turan Bupati Agara soal penyaluran zakat ini, namun hingga saat ini, tidak juga ada kepastian hak fakir miskin itu disalurkan. Kasri Selian dari LSM Lira, Selasa (3/4) juga menyampaikan rasa kecewanya. Pasalnya, zakat tersebut sejak 2010 hingga 2012 ini tidak kunjung disalurkan. Banyak keanehan, kata Kasri, awalnya dipercaya pihak Kemenag Agara diminta mendata jumlah rakyat miskin, namun ketika selesai pendataan, justru dikatakan data tersebut diragukan. Pasalnya, jumlah rakyat miskin dianggap terlalu banyak. Hasbulah, Kabag Hukum Agara mengatakan, soal peraturan bupati untuk penyaluran dana zakat ini pada awal 2012

telah rampung. Perbup ini, kata dia, sebagai legalitas pencairan dana menyangkut tata cara pencairan karena dana yang diambil dari pemotongan gaji PNS itu terlebih dahulu masuk ke rekening daerah sebagai PAD. Yashut, pengamat kebijakan publik, dalam konfirmasinya dengan Wakil Bupati Samsul Bahri, Selasa (3/4) membenarkan jumlah dana PNS yang dipotong atas nama zakat tersebut jumlahnya saat ini Rp3 miliar. Namun wabup yang menjabat Ketua Baitul Mal Agara ini enggan menjawab kepastian kapan disalurkan. Samsul Bahri via SMS menyebutkan, proses pencairan dana sedang dalam tahap proses di bagian keuangan daerah.(b25)

Warga Pelosok Aceh Utara Keluhkan Infrastruktur Jalan TANAH JAMBO AYE (Waspada): Warga pelosok Aceh Utara, khususnya wilayah Kemukiman Jambo Aye Tengah, Kec. Tanah Jambo Aye, saat ini didera keberadaan infrastruktur jalan. Rusaknya jalan, antara lain, terlihat di Gampong Lhok Merbo, Lhok Beuringen, Matang Teungoh, Matang Seuke Pulot, Matang Raya dan Buket Jrat Manyang. Akibat jalan ini rusak, jarak tempuh desa terpencil Buket Jrat Manyang yang hanya 8 kilometer ke ibukota kecamatan Tanah Jambo Aye (Pantonlabu), membutuhkan waktu hampir setengah jam. Hasil observasi Waspada, Senin (2/4) dari kota kecamatan (Pantonlabu) ke Desa Lhok Merbo sudah diaspal dua tahun lalu. Namun, sekarang sudah hancur hingga batu-batu bermunculan. Pada beberapa titik ruas jalan, kondisi aspal sudah bergelombang dengan lapisan tanah liat di bawah aspal sudah muncul ke permukaan. Dari ujung jalan yang sudah diaspal dan rusak itu di Desa Lhok Merbo, ruas jalan yang tersisa menuju Desa Buket Jrat Manyang belum mengenal peningkatan sekitar 5 kilometer. Sepedamotor yang merupakan satu-satunya jenis kendaraan masyarakat di desa bertopografi perbukitan itu kini sulit menjangkau ibukota kecamatan. Keuchik Buket Jrat Manyang, M Amin Usman mengatakan, bagi masyarakat secara

SUBULUSSALAM (Waspada): Gagal diangkat menjadi CPNS melalui verifikasi dan validasi tim pusat (pengangkatan tenaga honorer) kategori satu, dasar informasi http://www.bkn. go.id/honorer/, diumumkan kemarin, puluhan guru tenaga honorer kategori I Pemko Subulussalam datangi Ketua Komisi D DPRK setempat, Senin (2/4). Kepada Waspada, beberapa orang guru tenaga honorer di halaman Gedung DPRK usai menemui Ansari, Senin mengaku sangat kecewa dengan hal itu karena sesungguhnya sangat berharap menjadi PNS. Sejumlah guru yang minta tidak disebutkan identitasnya mengatakan, semua persyaratan sudah dipenuhi. “Kami nggak tau lagi mengadu kemana, padahal ini kesempatan terakhir,” aku sumber menambahkan, tiga di antara mereka

yang tidak lulus adalah Guru Bantu Pusat 2003. Dikatakan, dari 88 tenaga honorer yang terdaftar, hanya 61 yang lulus. “Kami sangat berharap, Bapak Wali Kota Subulussalam memperhatikan nasib kami,” keluh mereka. Ketua Komisi D DPRK Subulussalam Ansari Idrus Sambo dikonfirmasi, Senin membenarkan kalau dirinya menerima kunjungan sejumlah guru honorer yang tidak lulus melalui verifikasi dan validasi tim pusat tersebut. Ansari berjanji akan memediasi keluhan mereka yang gagal, meski dipastikan kewenangan menentukan lulus atau tidak lulus menjadi urusan pusat (Menpan RI). “Kita upayakan, mereka bisa lulus melalui kategori II,” pungkas Ansari berjanji akan memediasi persoalan itu dengan wali kota, sekda dan Komisi A DPRK Subulussalam. (b28)

Hari Ini Gugatan Kommid Terhadap HT Zulkarnaini Disidangkan MEULABOH (Waspada) : Karena sebelumnya Bupati Nagan Raya Drs HT Zulkarnaini, Rabu (28/3) sore lalu tak menghadiri sidang perdana terhadap gugatan 17 orang pegawai negeri sipil (PNS) Pemkab setempat yang tergabung dalam Korban Mutasi Mencari Keadilan (Kommid) terkait belum dilaksanakannya putusan tetap Mahkamah Agung, yang telah dimenangkan Rabu (4/4) akan dilakukan sidang kembali di Pengadilan Negeri Meulaboh, Aceh Barat. Hal itu dikemukakan Kommid kepada Waspada, Selasa (3/4). Sebalumnya pada Sidang yang dimulai sekira pukul 15:05 dipimpin ketua majelis hakim Mukhtar, SH dan sejumlah hakim anggota itu hanya berlangsung selama beberapa menit saja. Tergugat Bupati Nagan Raya beserta kuasa hukumnya dalam kasus tak seorangpun hadir. Dalam persidangan yang turut dihadiri kuasa hukum Kommid Nagan Raya, Zulfikar Sawang, SH dan sejumlah penggugat itu, majelis

hakim hanya membacakan surat yang dilayangkan Kabag Hukum Setdakab Nagan Raya, Zulfikar, SH yang menyatakan Bupati Nagan Raya Drs HT Zulkarnaini berhalangan hadir untuk mengikuti persidangan di pengadilan. Karena tergugat tak memenuhi surat untuk menghadiri sidang gugatan itu, akhirnya majelis hakim memerintahkan kepada juru sita untuk menyurati kembali tergugat Bupati Nagan Raya guna menghadiri persidangan selanjutnya yang diagendakan pada Rabu (4/4) di PN Meulaboh. Usai membacakan surat dan memerintahkan juru sita, majelis hakim langsung menutup sidang dan akan dilanjutkan lagi pekan depan. Diketahui Zulfikar Sawang selaku kuasa hukum Kommid Nagan Raya, pihaknya berharap supaya perkara itu segera ada kepastian hukum, dan meminta kepada tergugat sebaiknya hadir ke persidangan. Sehingga nantinya proses persidangan tidak tertunda-tunda seperti yang terjadi kemarin. (cda)

Waspada/Muhammad Riza

TIGA tersangka pelaku penganianyaan Sabri Ali, 65 sedang dimintai keterangan oleh petugas penyidik Polsek Pidie, Selasa (3/4).

Diduga Pembunuh, Warga Pijay Babak Belur SIGLI (Waspada): Sabri Ali, 65 warga Desa Mesjid Puduek, Kecamatan Trienggadeng, Pidie Jaya babak belur dihajar tiga orang pelaku di Terminal Terpadu, Kota Sigli, Selasa (3/4) sekira pukul 02:30 dinihari. Aksi itu diduga bermotif dendam pribadi. Ketiga pelaku penganiayaan itu adalah, Muslem Bin Ismail,54, Jamaluddin bin Ismail, 46 dan Ramadani bin Muslem,19, ketiganya warga Desa Mesjid Puduek, Kecamatan Trienggadeng, Pidie Jaya dan masih sekampung dengan dengan Sabri Ali. “ Kasus ini benar, dan sudah ditangani oleh Polsek Pidie. Ketiga tersangka pelaku penganiayaan itu juga sudah ditahan di Mapolsek Pidie” kata Pejabat Kasat Reskrim Polres Pidie AKP Aiyup kepada Waspada, Selasa (3/4). Muslem, salah seorang tersangka penganianyaan kepada Waspada, mengaku aksi pengeroyokan itu dilakukannya terhadap Sabri Ali karena dendam. Sebab ia menduga Sabri Ali merupakan pelaku pembunuhan terhadap putrinya Naizul Rahma,7 (Almarhumah-red) pada 13 Februari 2012. “ Ada beberapa saksi yang melihat Sabri Ali membunuh anak saya. Makanya kami sekeluarga mencari dia” kata Muslem.

Menurut Muslem, pihak keluarganya berat menaruh curiga terhadap Sabri selaku pembunuh putrinya tersebut. Sebab, setelah putrinya meninggal dunia yang bersangkutan langsung menghilang dari desa. “ Kami sangat sedih. Anak kami masih kecil baru berusia tujuh tahun, tetapi meninggal karena dibunuh. Hati orang tua mana yang sedih dan galau pak,” papar Muslem dengan nada sedih. Sebenarnya, ungkap Muslem, dirinya sudah lama mencari Sabri Ali untuk mempertanggungjawabkan perbuatannya, namun tidak diketahui rimbanya. Namun kebetulan, kami mendapat informasi dari masyarakat, yang bersangkutan terlihat di kampung pulang dari Banda Aceh. “Setiba di Terminal Terpadu Kota Sigli, kami berhasil menemukannya” kata Muslem. Amatan Waspada, ekses dari peristiwa itu Sabri Ali, korban penganiayaan Muslem, cs harus dirawat secara serius di Unit Gawat Darurat (UGD) RSU Sigli, karena mengalami luka robek pada bibir sebelah kiri, luka lecet pada kepala sebelah kanan, lutut kiri memar, paha sebelah kiri robek dan lutut sebelah kiri lecet. Sedangkan ketiga tersangka pelaku penganiaanya tersebut telah diamankan di Mapolsek Pidie. (b10)

Dishutbun Pijay Bagi Bibit Kakao Gratis Waspada/M Jakfar Achmad

RUAS paket jalan Desa Alue Ie Mirah – Desa Buket Jrat Manyang, di wilayah Kemukiman Jambo Aye Tengah, Kec. Tanah Jambo Aye, Aceh Utara, hanya Rp750 juta (900 x 6 meter), alokasi APBK Aceh Utara TA 2012. umum, keberadaan ojek (RBT) menjadi vital, walau tarif dari pedalaman ini dipatok Rp10.000 sekali jalan. Kendaraan roda empat sudah lama berhenti menarik sewa dari Pantonlabu – Desa Buket Jrat Manyang atau sebaliknya karena faktor jalan yang rusak. Imum Mukim Jambo Aye Tengah, Asy ‘Ari menyebutkan, poros jalan ini berpangkal dari Desa Alue Ie Mirah – Desa Buket Jrat Manyang merupakan jalan strategis yang mempunyai akses ke wilayah eks trans Unit V, Kec. Baktiya. Lewat jalan ini warga eks trans membawa hasil sawit, sebaliknya membeli dan membawa pulang bahan kebutuhan sehari-hari dari kota perbatasan Aceh Utara – Aceh Timur (Pantonlabu).

Selain kebutuhan 17 desa di Kemukiman Jambo Aye Tengah, jalan ini juga mempunyai akses ke 23 desa di Kec. Langkahan yang bertetangga dengan Kec. Tanah Jambo Aye. “Kendati kondisi jalan demikian parah, warga tidak pernah protes, seperti memblokir, menanam batang pohon pisang di atas badan jalan,” tutur Asy’Ari. Dalam setiap musyawarah rencana pembangunan (Musrenbang), 17 kades, 1 imum mukim dan 102 tokoh masyarakat (laki-laki dan perempuan) di Kemukiman Jambo Aye Tengah, kata Asy’Ari, selalu mengingatkan Pemkab Aceh Utara untukmemprioritaskanlan-jutan paket pembangunan peningkatanjalanDesaAlueIeMirah–Desa Buket Jrat Manyang. (b13)

MEUREUDU (Waspada) : Dalam upaya meningkatkan pendapatan dan kesejahteraan masyarakat terutama para petani di sejumlah kecamatan di Kabupaten Pidie Jaya, Pemkab setempat memfokuskan pembangunan di sektor pertanian dan perkebunan. Upaya itu dilakukan dengan mengoptimalkan berbagai fasilitas yang ada. Untuk mendukung upaya dimaksud, salah satunya dengan merehabilitasi kembali tanaman perkebunan yang sudah tua dan membuka lahan perkebunan baru dengan membantu bibit tanaman secara gratis. Bupati Pidie Jaya HM Gade Salam, Minggu (1/4) mengatakan, suatu daerah akan maju bila sektor pertanian dan perindustrian bisa hidup berkembang. Maka itu, Pemkab Pidie Jaya terus berupaya membenahi fasilitas yang sudah dimiliki di daerahnya termasuk membantu para petani dan pedagang kecil. “Ini penting sekali dilakukan, sebab majunya sebuah daerah ditentukan oleh tumbuh dan berkembangnya sektor pertanian dan industri. “Sebuah daerah tidak akan maju tanpa aktivitas ekonomi dipelopori oleh kegiatan pertanian dan industri. Selama ini Pemkab Pidie Jaya bersama jajarannya terus berusaha untuk menghidupkan fasilitas yang sebelumnya telah ada,“ tuturnya. Kepala Dinas Kehutanan dan Perkebunan Pidie Jaya Bukhari Adam mengatakan, untuk

memenuhi harapan tersebut Pemkab setempat pada 2012 ini telah menganggarkan dana Rp1,8 miliar membantu pengadaan bibit kakao gratis kepada para petani. Disebutkan Bukhari, setidaknya ada delapan Kelompok Tani (Poktan) tersebar di lima kecamatan di Pidie Jaya yang dijatahi 312.000 batang bibit kakao (cokelat). Disebutkan, pembagian bibit kakao itu merupakan program peningkatan perekonomian masyarakat di pedesaan. Menurut Bukhari, untuk program pengembangan taraf ekonomi masyarakat pedalaman di Pidie Jaya, tahun ini pihaknya menjatah pembagian bibit kakao kepada delapan kelompok tani di lima kecamatan. Dana yang bersumber dari Otonomi Khusus (Otsus) sebesar Rp1,8 miliar, selain pengadaan 312.000 batang bibit kakao juga diperuntukkan untuk dana perawatan dengan totalnya Rp240 juta untuk kelompok tani tersebut. Delapan kelompok tani yang mendapat jatah bibit kakao gratis yaitu, Paya Bo Gampong Blang Krueng, Gampong Sagoe Langgien (Kec.Bandar Baru), Gampong Barona Jaya, Gampong Panton Weng, Cot Ticem Gampong Papuen (Kec. Trienggadeng), Udep Beujawa Gampong Lampoh Lada, (Meureudu), Japakeh Gampong Lhok Sandeng Meurah Dua), dan Ingin Maju Gampong Krueng Kiran (Kec.Bandar Dua).(b09)

Aceh

B12

FPJ Desak Dishub Fungsikan Terminal Aceh Timur

PANTONLABU (Waspada): “Peningkatan mutu pendidikan jangan sebatas slogan, tapi harus ditunjang dengan peningkatan fisik sekolah dan kualitas guru,” kata Imum Mukim Jambo Aye Utara, Kec. Tanah Jambo Aye, Aceh Utara, Razali, Senin (2/4). Pemuka masyarakat ini meminta perhatian Pemkab Aceh Utara terhadap sektor pendidikan baik fisik maupun kuantitas serta kualitas guru. Seperti SMA persiapan negeri nomor 4 Pantonlabu di Tanjong Meunuang, Kemukiman Jambo Aye Utara, sudah tiga tahun terakhir operasional sekolah masih saja fasilitas pendukungnya serba kekurangan. Musibah angin puting beliung yang menerpa dan menghancurkan satu unit kantor guru berikut fasilitas pendukungnya, Jumat (30/3) pekan lalu, kiranya dapat menyita perhatian Pemkab Aceh Utara untuk melengkapi sarana dan prasarana sekolah ini. “Saya meminta Pj Bupati setempat, secepatnya mengirim konsultan guna melihat tingkat kerusakan sebagai bahan penyusunan design konstruksi dan biaya,” ujarnya.(b13)

Satu Kopel RDG Di SDN 23 Pantonlabu Mubazir

Pasar Bernilai Rp1,5 M Rusak Sebelum Dipakai LHOKSUKON (Waspada) : Gedung Pasar Terpadu bernilai Rp1,5 miliar di Lorong III, Lhoksukon, ibukota Kabupaten Aceh Utara, rusak sebelum digunakan. Lantai pasar yang dibangun dengan dana Otsus 2010 ini mulai retak. Begitu juga loteng dan parit. Sementara bohlam, sebagian besar sudah copot, seolah sudah dipakai puluhan tahun. “Pasar itu terkesan dibangun tanpa pengawasan pihak terkait. Mutu bangunan buruk dan hingga kini belum bisa difungsikan,” kata Koordinator Bidang Advokasi Anggaran dan Kebijakan Publik, LSM MaTA, Baihaqi. Kadis Perindustrian, Perdagangan dan Koperasi Aceh Utara, Mehrabsyah, menyatakan, semua item bangunan yang rusak tersebut akan diperbaiki menjelang serah terima pasar dari pemerintah daerah kepada pedagang. “Rencananya, pasar ini baru kita fungsikan tahun depan. Jika kita perbaiki sekarang, takutnya malah rusak lagi dan kita mesti kerja dua kali,” ujar Mehrabsyah. (b19)

Waspada/Musyawir

LANTAI dan parit di Pasar Terpadu Lhoksukon, rusak sebelum dipakai. Foto direkam, Selasa (3/4).

Waspada/Muhammad H. Ishak

TERTIMPA: Warga memperhatikan salah satu sepedamotor yang tertimpa tiang Penerangan Jalan Umum (PJU) milik Pemkab Aceh Timur di Kota Idi yang tumbang akibat berkarat. Meski tidak ada korban jiwa, namun sepedamotor mengalami kerusakan berat akibat terbentur tiang PJU. Kejadian tersebut sempat menjadi perhatian warga sebelum datangnya pemilik kendaraan. Foto diambil Selasa (3/4).

Warga Amankan Sepasang Anak Jalanan Berzina LANGSA (Waspada) : Aktivitas anak-anak jalanan di Kota Langsa semakin meresahkan. Setelah mereka sempat menghilang sebentar menyusul tindakan Kapolda Aceh di Banda Aceh beberapa bulan lalu, yang mengumpul mereka di SPN Selawah untuk dibina, kini kehadiran mereka makin tidak terbendung.

Bahkan tindakan mereka melanggar norma-norma agama semakin tambah berani. Kenyataan itu terbukti, Selasa (3/ 4) dinihari, ketika warga Kota Langsa menangkap sepasang anak jalanan itu di Lapangan Tenis, sekitar taman Bambu Runcing sedang berzina tanpa takut dan malu dilihat orang. Kadis Syariat Islam Kota Langsa Ibrahim Latif mengatakan, rasanya seperti tak habis pikir kenapa moral mereka sudah begitu rusak. Menurutnya, saat ditangkap

Lhok Reudeub Hanya Kecipratan Rp 2 Juta Dana APBK Aceh Utara PANTONLABU, (Waspada): Lhok Reudeub, gampong (desa) terpencil di Kemukiman Jambo Aye Tengah, Kec Tanah Jambo Aye, Aceh Utara, hanya kecipratan Rp 2 juta, dana APBK Aceh Utara, TA/2012. “Ini sungguh memprihatinkan bagi desa kami yang berpenghuni 99 kepala keluarga (KK), atau 360 jiwa warga. Rp 2 juta dana dialokasikan Pemkab Aceh Utara, pada pos belanja tidak langsung, untuk sekolah semai benih bangsa (SBB) atau Taman Kanak-kanak (TK),” kata Geuchik Lhok Reudeub, Arifuddin, Sabtu (31/3). Arifuddin yang juga ketua komite Sekolah Dasar Negeri (SDN) 23 Pantonlabu, di Desa Lhok Reudeub, alokasi Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Utara, Tahun Anggaran (TA) 2012, pula tidak ada sama sekali. Pada hal beberapa item pembangunannya sangat penting, seperti WC sekolah belum ada sejak SDN ini dibangun 22 tahun lalu. Tuha 4 (perangkat desa), Basyaruddin, Mahmud dan Tgk Zakaria, menyebutkan jalan

lingkungan desa sepanjang 3.500 meter belum tersentuh pembangunan. Saat hujan ruas jalan penuh lumpur, terutama ruas jalan yang menghubungkan antara Desa Lhok Reudeub – Buket Alue Puteh, terang tuha 4. Kades menjelaskan, masalah infrastruktur (sarana jalan lingkungan) sudah tiga kali berturut-turut dibicarakan kades dan para perangkat desa, pada setiap jenjang musyawarah rencana pembangunan (Musrenbang), kendati belum pernah muncul dalam format buku APBK. Bukan cemburu, melihat alokasi APBK Aceh Utara, TA/ 2012 yang terlalu serakah digasak ke Desa Matang Serdang, Kecamatan tanah Jambo Aye, Aceh Utara, hingga tembus angka Rp 3,7 miliar lebih. Tapi, sangat disesalkan, tim anggaran pembangunan daerah (TAPD) di Pemkab Aceh Utara, terkesan proses penyusunan APBK setiap tahun tanpa merujuk kepada skala prioritas, komentar para pemuka masyarakat Desa Lhok Reudeub.(b13)

Alumni Bertanggungjawab Atas Maju Mundurnya Darussa’adah IDI CUT (Waspada): Maju mundurnya Yayasan Pendidikan Islam (YPI) Daruss’adah Pusat di Teupin Raya (Pidie) dan Darussa’adah Cabang se Aceh tidak hanya sepenuhnya berada ditangan pengurus, namun juga menjadi tanggungjawab alumni Darussa’adah, baik di Aceh ataupun yang sudah berada di luar Aceh, termasuk di luar negeri. “Alumni Darussa’adah se Aceh bertanggungjawab atas maju mundurnya YPI Darussa’adah yang sudah tersebar Cabang Ponpes di seluruh Aceh,” papar PanasehatYPI Darussa’adah Pusat Tgk. H. Mukhtar Wahab (Abon) ketika memberikan Tausiah di Haul Ke IIIalmarhumTgkH AbdulWahab BinTgk Abdul Hamid di Komplek Ponpes Darussa’adah Cabang Idi Cut, Aceh Timur Selasa (3/4). Halitu sengaja disampaikan di hadapan ribuan alumni Darussa’adah Cabang Idi Cut dan alumni Darussa’adah se Aceh yang hadir memadati komplek Ponpes tersebut. Menurutnya, jika alumni Darussa’adah tidak mendukung kelancaran proses pengaajian yang berkelanjutan, maka Da-

russa’adah yang pernah mencapai puncak kejayaan dengan antri terbanyak bakal mundur. “Seluruh alumni yang sudah kembali ke masyarakat mari kita bantu Darussa’adah terdekat, minimal jika kita punya keturunan maka sisihkan salah seorang anak kita itu ke Darussa’adah, sehingga Darussa’adah tetap bersinar. Ini juga pesan dari seluruh pimpinan Darussa’adah sebelumnya,” ujar H Mukhtar. Dia juga sempat menyinggung, umat Islam yang baik sebagaimana pesan rasul harus mengingat dua hal dan melupakan dua hal. “Pertama umat Islam harus ingat kebaikan orang kepada kita dan harus selalu mengingat kepedihan yang kita berikan kepada orang lain,” katanya seraya menambahkan, umat Islam harus melupaka dua hal yang lupa dengan kebaikan kita kepada orang lain dan lupa keburukan orang lain kepada kita. Kegiatan diawali dengan zikir, tahlil, dan doa yang dipimpin Tgk. H. Abdullah dari Sampoinit (Aceh Utara) di lokasi Makam Almarhum Abu Idi Cut

Rabu 4April 2012

Proyek Pembangunan Terminal Terbengkalai

Peningkatan Mutu Jangan Sebatas Slogan

PANTONLABU, (Waspada): Satu kopel (dua pintu) Rumah Dinas Guru (RDG) di SDN 23 Pantonlabu, Gampong (Desa) Lhok Reudeub, Kecamatan Tanah Jambo Aye, Aceh Utara, statusnya mubazir. Kepala sekolah (kasek) Sekolah Dasar Negeri (SDN) ini, Hamdani, SPd yang dihubungi, Minggu (1/4) membenarkan. RDG yang dibangun bersamaan gedung sekolah itu, tahun 1988 lalu sekarang tidak ditempati guru. Enam personil guru pegawai negeri sipil (PNS) yang bertugas di sekolah 79 murid ini, termasuk dirinya tidak mau menempati RDG. “Pasalnya, kami memiliki rumah sendiri,” ujarnya. Dua personil guru bakti dan dua personil guru honorer daerah (Honda) serta dua personil guru bakti sekolah, juga menolak untuk menempati RDG dengan alasan mereka memiliki rumah sendiri. Kondisi RDG tersebut, kini ditutupi semak, tanpa pagar pengaman dan tidak terawat. Selama Hamdani (kasek ditugaskan ke SDN 23 Pantonlabu, tahun 2010), dibenarkan RDG ini ditempati keluarga pasangan Ibrahim, 30, bersama istri Cut Mariani, 27, berikut dua anaknya. Tapi, aset sekolah tidak dirawat, entah mengapa. “Saya akan panggil penghuni RDG dimaksud dalam waktu dekat ini, guna memberi tanggungjawab. Bagaimana seharusnya menjaga aset sekolah,” terang kasek. Hamdani mengakui, berbagai persoalan telah melengkapi SDN 23 Pantonlabu, di desa terpencil Lhok Reudeub, Kemukiman Jambo Aye Tengah, Kec Tanah Jambo Aye. 22 tahun usia sekolah, bangunan WC tempat buang hajat belum ada. Pagar sekolah dua sisi kiri kanan, juga sisi belakang belum dibangun. Pekarangan sekolah 50 x 50 meter kondisinya sangat rendah, sehingga kalau hujan tidak dari 10 centimeter terendam. Pada saat puncak hujan aktivitas murid tidak bisa dilakukan, termasuk kegiatan olahraga. Dana Biaya Operasional Sekolah (BOS) triwulan I/2012, sudah diterima sebesar Rp 11.455.000 dari seharusnya sekitar Rp 30 juta, semuanya sudah digunakan sesuai 13 item yang dibenarkan petunjuk pelaksanaan (Juklak) dana BOS, katanya. (b13)

WASPADA

Waspada/Muhammad H. Ishak

PENASEHATYPI Darussa’adah Pusat Teupin Raya, Tgk. H. Mukhtar Wahab bersalaman dengan Calon Bupati Aceh Timur Muslim Hasballah (kiri) yang didampingi Tgk H Hasbi Pulo Blang (kanan) usai Tausiah Haul Ke III Almarhum Tgk H AbdulWahab di Komplek Darussa’adah Cabang Idi Cut, Kab. Aceh Timur, Selasa (3/4). yakni 30 meter ke arah utara kediamannya di Komplek Darussa’adah Cabang Idi Cut. Selain dihadiri ribuan alumni dan para tokoh agama dan aparatur

desa, sejumlah politisi dari Parpol juga hadir, termasuk Calon Bupati Aceh Timur No Urut 1 Muslim Hasballah bersama Timsesnya. (b24)

warga, keduanya sudah bertingkah laku seperti binatang, tidak berpakaian. Yang laki-laki sedang mabuk. Setelah disuruh pakaikan busananya, mereka diamankan di kantor Dinas Syariat Islam. Setelah diperiksa, ujar Ibrahim Latif, yang laki-laki berinisial BS, 21, berasal dari Sumtera Barat dan perempuannya MR, 20, warga Kota Langsa. Kasus mereka akan dilimpahkan ke Mahkamah Syariah untuk diproses sesuai hukum Syariat Islam. (b20/b22)

JULOK (Waspada) : Proyek bernilai miliaran rupiah pembangunan Terminal Aceh Timur di Desa Meudang Ara, Kec. Nurussalam— Bagok, Kab. Aceh Timur, terbengkalai. Kondisi tersebut terjadi setelah pembangunan itu selesai akhir 2010. Sementara itu, Forum Pemuda Julok (FPJ) mendesak Dinas Perhubungan dan Informatika Aceh Timur didesak segera memfungsikan Terminal Aceh Timur yang lokasinya di persawahan Desa Meudang Ara, Kec. Nurussalam—Bagok. Ketua FPJ Hasballah Kadimin, Selasa (3/ 4) menjelaskan, Terminal Aceh Timur yang lokasinya lebih kurang 25 kilometer ke arah barat Kota Idi, pusat Pemkab Aceh Timur siap dibangun tahun 2008-2009. Namun rampung total Terminal Idi-Aceh Timur pada awal 2011. “Kita minta Pemkab Aceh Timur mendesak Dishub setempat agar segera memfungsikan Terminal Idi. Karena kita melihat dalam dua tahun terakhir hanya ternak warga yang

berkeliaran di sana,” ujar Hasballah seraya menambahkan, pihaknya sangat menyesalkan tindakan Dishub yang menelantarkan pembangunan bernilai miliaran rupiah itu di tengahtengah persawahan. Jika terminal tersebut dibiarkan terbengkalai, maka daerah yang rugi karena tidak mampu menambah Pendapatan Asli Daerah (PAD). “Jangan hanya sebatas membangun terminal di mana-mana, tapi terminal yang sudah ada fungsikan dengan baik seperti Terminal Peureulak dan Terminal Idi di Kota Idi,” ucap Hasballah Kadimin. Kadis Perhubungan Aceh Timur Zahri, MAP saat dimintai keterangan mengaku, terminal tersebut belum sempurna siap. “Jalan masuk dan jalan keluar belum ada. Dan ada beberapa sudut yang belum siap dikerjakan, bahkan konsultan sudah turun ke lokasi,” ujarnya seraya menambahkan, kelanjutan pembangunan tersebut akan dilanjutkan pekerjaannya pada 2012 ini. (b24)

Peran Pemerintah Diharapkan Cegah HIV/AIDS Di Banda Aceh BANDAACEH (Waspada) : Meskipun pengidap HIV/AIDS tidak bisa disembuhkan, namun untuk pencegahan penularannya dapat dilakukan dengan cara sosialisasi. Karenanya, dalam menanggulangi HIV/ AIDS, peran peme-rintah dan instansi terkait sangat diharapkan, selain peran aktif penderita juga diperlukan. Demikian ungkap Penjabat Sekretaris Daerah Kota Banda Aceh, Ramli Rasyid pada sosialisasi lintas sektoral dalam rangka penanggulangan penyakit HIV/AIDS yang berlangsung di rumah makan Istana di kawasan Lambhuk Banda Aceh, belum lama ini. Hadir pada acara tersebut, Sekretaris Komisi D DPRK Banda Aceh, perwakilan Komisi Penanggulangan HIV/AIDS Kota Banda Aceh, Kadis Perhubungan Kota, Kadis Kesehatan Kota Banda Aceh, Satpol PP dan WH Kota, Kadisdikpora Kota, Kadis Syariat Islam Kota, Ketua KPA PAI Kota Banda Aceh Hj Illiza Saaduddin Djamal serta beberapa instansi terkait. Kata Ramli, pengidap penyakit HIV/AIDS itu tidak mengenal strata, ia dapat dijangkiti oleh siapapun dan dengan cara apapun. “Kita jangan berbangga hati dengan label Kota Syariat

Islam. Karena buktinya sekarang di kota kita sudah terjangkit penyakit HIV/AIDS yang notabene penyakit neraka jahannam,” terangnya. Melalui Forum tersebut Sekda berharap penanggulangan HIV/AIDS di Kota Banda Aceh bisa diperkecil dan bila perlu bisa dihapus. Oleh karena itu peran instansi pemerintah sangat urgen, Sekda mencontohkan Disdikpora Kota Banda Aceh berperan dalam membina remaja dan pemuda, di sana ada guru konseling dan guru agama. Mereka sangat berpengaruh dan berperan penting dalam sosialisasi penanggulangan HIV/AIDS dan juga instansi terkait lainnya. Kadis Kesehatan Kota Banda Aceh dr Media Yulizar mengatakan, forum diskusi tersebut merupakan pertemuan yang ke-4 yang dilaksanakan. Dia menyebutkan latar belakang dilakukannya forum diskusi lintas sektoral tersebut karena kasus HIV/AIDS di Banda Aceh terus mengalami peningkatan dan penanggulangan HIV/AIDS merupakan salah satu sasaran program MDG’s di bidang kesehatan yang kini digiatkan pemerintah. (b02)

Mengenal Lebih Akrab Muslim Hasballah–Marwi Umar JAK TA PEUKONG...!!! Adat Bak Po Teumeuruhom, Hukom Bak Syiah Kuala, Qanun Bak Putro Phang, Reusam Bak Laksamana. Adat Ngon Hukom Lagee Zat Ngon Sifeut.

MUSLIM HASBALLAH lahir di Alue Bu, 21 Maret 1968. Masa kecilnya Muslim habiskan di Desa Alue Bu, Kecamatan Peureulak Barat, Kab. Aceh Timur. Muslim menamatkan Sekolah Lanjutan Tingkat Pertama (SLTP) di Alue Bu. Sementara pendidikan terakhirnya di Madrasah Aliyah (MA) Darul Ulum Peureulak. Sejak lajang Muslim sudah dikenal masyarakat. Pembawaannya yang sedikit pendiam dan ulet membuat teman-temannya menghargai sosok Muslim Hasballah. Sejak muda dia dikenal pemuda yang rajin dan amanah. Dia kian populer setelah bergabung dengan Gerakan Aceh Merdeka (GAM), apalagi saat konflik menjadi buronan TNI/Polri. Kabarnya, Muslim selalu berada di tengah-tengah masyarakat yang selalu melindunginya saat GAM bergerilya di hutan belantara Aceh Timur di bawah komando almarhum Panglima GAM Wilayah Peureulak, Teungku Ishak Dawod. Pada Agustus 1990, Muslim Hasballah hijrah ke Tripoli, ibukota negara Libya untuk mengikuti pendidikan kemiliteran para gerilyawan GAM. Muslim Hasballah adalah salah satu putra Aceh Timur yang disiapkan menjadi bagian dari kekuatan militer elit GAM. Setahun setelah menerima pendidikan militer negeri almarhum Muammar Khadafi, Muslim kembali ke Aceh, 1991 untuk melanjutkan perjuangan bersama teman-temannya di Aceh, bahkan dia sempat menjabat sebagai Komandan Polisi Militer (Danpom) GAM Wilayah Peureulak. Jabatan terakhirnya di struktur militer GAM sebagai Komandan Operasi (Dan-Ops) GAMWilayah Peureulak hingga tahun 2005.

Setelah MoU antara Pemerintah RI-GAM, Muslim mulai berani tampil di muka publik sebagai bagian yang tak terpisahkan dari sejarah Aceh masa lalu. Tepat pada tahun 2006, Muslim Hasballah dipercayakan untuk mencalonkan diri dalam Pemilihan Kepala Daerah (Pilkada) Aceh Timur periode 2007-2012. Dalam kalangan GAM kala itu, Muslim dianggap tokoh yang santun sehingga sosok Muslim cukup layak untuk ditampilkan memimpin Aceh Timur 2007-2012. Ternyata pasangan Muslim – Nasruddin yang maju melalui Jalur Independen menang dengan suara yang sangat siqnifikan dan mengalahkan kandidat lain. Dipercayakan sebagai Bupati Aceh Timur bukanlah amanah yang mudah untuk di emban, mengingat sosok Muslim Hasballah yang sebelumnya sebagai tokoh pejuang GAM yang bergerilya di butan Aceh. Tahun 2007 menjadi awal kepemimpinan Muslim Hasballah sebagai Bupati Aceh Timur. Gaya kepemimpinan Muslim cukup disegani dan dikenal pembawaannya santai itu ternyata punya komitmen besar dalam membangun AcehTimur yang lebih maju. Marwi Umar, SP, MM Sementara itu, Marwi Umar lahir di Bantayan 4 Maret 1958. Marwi dibesarkan di Kec. Simpang Ulim, Kab. Aceh Timur dikenal sejak kecil taat dan cerdas. Pendidikan dasar ditamatkan di MIN Simpang Ulim, lalu melanjutkan ke SLTP Indra Puri, Aceh Besar dan pendidikan keahliannya di SPP Saree dan Diploma-III di APP Medan. Terakhir beliau memperoleh gelar sarjana di Universitas Samudra Langsa. Sementara gelar pascasarjana beliau diselesaikan di Sekolah Tinggi Ilmu Ekonomi (ISM) 2006. Dari riwayat pendidikannya Marwi merupakan salah satu tokoh Aceh Timur yang sangat berkosentrasi dalam sektor pembangunan pertanian di

Kabupaten Aceh Timur. Bukan saja dikenal dikalangan birokrasi pemerintah, tapi figure Marwi sangat dekat dengan kalangan masyarakat Aceh Timur. Setelah menamatkan SPP Saree, Marwi mengawali karir CPNS di tahun 1981. Karir Marwi di birokrasi sudah berlangsung lama, terakhir Marwi menjabat sebagai Kepala Dinas Pertanian Kabupaten Aceh Timur 2005-2012. Saat ini sosok Marwi dikenal sebagai bapaknya petani, karena sejak menjabat Kepala Dinas Pertanian mampu memajukan pertanian di daerah-daerah pedalaman dan juga mampu memberi akses kepada petani untuk membuka lahanlahan kosong yang sudah lama tidak berproduksi. Marwi telah menjadi ikon yang sulit dilupakan oleh petani di Aceh Timur, selama beliau menjabat Kepala Dinas Pertanian telah banyak sekali pe-

ngembangan pertanian yang dilakukannya. Konstribusi Marwi kepada petani Aceh Timur beliau wujudkan melalui, Pengembangan Padi Lahan Kering (Gogo) seluas 2.000 ha di Kecamatan Serbajadi dan Peunaron tahun 2011, pengembangan jagung hibrida seluas 1.000 hektare di Kecamatan Peunaron, peningkatan produksi padi ratarata 5 persen pada tahun 2011, peningkatan Intensitas Penanaman Padi (IP) dari 1 menjadi 1,5, perluasan areal sawah seluas 700 ha pada tahun 2011 di Kabupaten Aceh Timur, tercapainya 6.914 meter jaringan irigasi terpadu usaha tani tahun 2011, peningkatan optimasi lahan seluas 292 ha di tahun 2011 dan meningkatnya jalan usaha tani seluas 3.428 meter di Kabupaten Aceh Timur. LANJUTKAN...!!! PILIH NOMOR 1 MUSLIM HASBALLAH – MARWI UMAR, SP, MM. (***)


Waspada, Rabu 4 april 2012