Issuu on Google+

Medan 24-320C

P. Sidimpuan 20-290C

R. Prapat 24-320C

Penyabungan 20-29 0C

Berastagi 18-270C

Sibolga 22-320C

Berawan

Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

BMKG Polonia

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

MINGGU, Kliwon, 17 April 2011/13 Jumadil Awal 1432 H z No: 23479

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

Tahun Ke-65

Ibu Asyik Main Facebook AnakTewas Tenggelam FACEBOOK bisa bikin kecanduan, bahkan Anda terlena. Karena itu, hati-hatilah jangan sampai Anda bernasib seperti Shannon Johnson, 34. Perempuan asal Colorado itu diganjar 10 tahun penjara oleh pengadilan, Jumat (15/4). Gara-garanya ia berasyik-masyuk main Facebook hingga putranya yang berusia 13 bulan tenggelam. Bahkan, sang putra itu tak terselamatkan. Menurut juru bicara bagi Kantor Kejaksaan Weld County District, Amerika Serikat, Jennifer Finch, seorang hakim juga memerintahkan Shannon untuk menjalani kewajiban pembebasan bersyarat selama lima tahun setelah ia dibebaskan dari penjara. Shannon Johnson mengakui kesalahan pada Maret lalu atas dakwaan berat pelecehan terhadap anak yang mengakibatkan kematian putranya, Joseph. Ia menelepon 911 dari rumahnya di Fort Lupton, Colorado, September lalu, ketika ia menemukan anaknya yang masih kecil terpeleset dan jatuh di bak mandi. Saat ditanyai para penyidik, Shannon Johnson mengakui ia menaruh putranya di bak mandi dan pergi ke ruang lain untuk main game “Cafe World” di Facebook. Anak lelaki tersebut sendirian saja selama 10 menit. Joseph diangkut melalui udara ke satu rumah sakit Denver, tapi personel medis tak bisa menyelamatkan nyawanya. Shannon Johnson mengatakan kepada polisi ia seringkali meninggalkan putranya sendirian di bak mandi. Sebab, sebagai anak “yang mandiri” Joseph suka ditinggal sendirian. Ia juga tak mau Joseph jadi “anak mami”. (ant)

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Adik Nasruddin Akui Kasus Antasari Diduga Direkayasa

Antara

KADIV Humas Polri Irjen Pol. Polri Anton Bachrul Alam menunjukkan wajah pelaku pemboman di masjid Mapolresta Cirebon, di RS Polri Soekamto, Jakarta, Sabtu (16/4). Total korban berjumlah 30 orang, enam orang luka berat dan satu di antaranya adalah warga sipil.

JAKARTA (Waspada): Dugaan rekayasa persidangan kasus Antasari Azhar yang dituduh mendalangi pembunuhan berencana terhadap Direktur Putra Rajawali Banjaran Nasruddin Zulkarnaen diakui oleh pihak keluarga korban. Andi Syamsuddin, adik kandung Nasruddin mengatakan, ada rekayasa besar yang melibatkan orang-orang penting di Republik ini. Namun, dia tidak merinci orang-orang atau dari institusi mana yang dia maksud. Oleh karena itu, Syamsuddin mewakili keluarga meminta dukungan masyarakat Indonesia agar mantan Ketua Komisi Pemberantasan Korupsi (KPK) itu dibebaskan dari segala tuduhan. Dia meminta publik menekan lembaga hukum untuk membebaskan Antasari dari penjara. “Saya menyerukan kepada publik untuk memberikan dukungan moral dalam hal bagaimana bisa membebaskan Pak Antasari Azhar. Karena diduga kuat kasus ini memang ada rekayasa besar sehingga saya dari saudara kandung almarhum Nasruddin Zulkarnaen meminta publik memberikan dukungan moral untuk kebebasan Pak Antasari dan kiranya publik bisa memberikan pressure kepada lembaga hukum untuk membebaskan Pak Antasari,” katanya Sabtu (16/4). Syamsuddin menambahkan, kalau dia membuka dugaan rekayasa itu, tentunya akan banyak pihak yang merasa terusik. Bahkan, bisa menimbulkan instabilitas di Indonesia karena yang terlibat bukan orang-orang sembarangan. “Saya harapkan dalam pengajuan Peninjauan Kembali Pak Antasari dibebaskan. Dan saya harap saudara Antasari bisa mencari dan menjadi kewajibannya untuk mengungkap siapa dalang pembunuhan Nasruddin Zulkarnaen, saudara saya,” katanya. (okz)

Pembom= Jaksa Cirus M. Syarif Sinaga Gol Dikenal Warga Sebagai Pria Stress CIREBON (Waspada): Bom bunuh diri di masjid Mapolresta Cirebon Jumat kemarin yang diduga dilakukan seorang pria bernama Muchamad Syarif nampaknya mendekati kebenaran.

Waspada/Surya Efendi

KELUARGA dan tetangga mengangkat peti jenazah almarhum Hendra, TKI yang bekerja di Malaysia, sebelum prosesi pemakaman di kediamannya di JL. Bromo Ujung Medan, Sabtu (16/4). Menurut keluarga, Hendra ditemukan tewas di lokasi tempatnya bekerja pada 6 April 2011 dengan kondisi luka memar dan diduga tewas karena dianiaya.

Keluarga TKI Yang Tewas Dibunuh Di Malaysia Kecewa Dengan KBRI

Setelah paman Syarif, Elang Rasid yakin melihat foto yang disiarkan polisi melalui televisi, ternyata juga dibenarkan oleh istri Syarif di Majalengka, Jawa Barat. “Mereka mengatakan foto itu benar suaminya (M Syarif),” kata Rasid menceritakan percakapan dengan istri Syarif via telefon, Sabtu (16/4). Dikatakan Rasid, pembicaraan melalui telefon tersebut dilakukan saat kedua

JAKARTA (Waspada): Jaksa Cirus Sinaga, tersangka kasus korupsi dan pemalsuan dokumen, akhirnya gol (ditahan) penyidik Bareskrim Polri setelah menjalani pemeriksaan, Sabtu (16/4). Cirus ditahan di Rumah Tahanan Bareskrim Polri. Menurut Parlindungan Sinaga, penasihat hukum Cirus, ia dan kliennya telah menandatangani surat perintah penahanan yang diajukan penyidik. “Suratnya sudah kami tanda tangani untuk penahanan selama 20 hari,” kata Parlindungan seusai mendampingi pemeriksaan kliennya, Sabtu petang. Parlindungan mengatakan, dalam pemeriksaan Cirus hanya menjelaskan mengenai seluruh harta yang ia miliki. “Dijelaskan satu per satu. Itu lama menjelaskannya. Supaya tidak ditafsirkan ini dibeli karena berkaitan dengan kasus itu (Gayus Tambunan),” katanya. Lanjut ke hal A2 kol 3

TKW Indonesia Tetap Ikut Hosni Mubarak

Lanjut ke hal A2 kol 3

KEINDAHAN PULO BATEE (BATU) DI TENGAH SAMUDRA INDONESIA

Pulo Batee berarti Pulau Batu yang merupakan sebuah atol yang terletak di ujung Pulau Sumatera. Tepatnya di Kecamatan Meuraxa, Kabupaten Aceh Besar propinsi Aceh. Pulo yang luasnya sekitar 100 hektare ini tidak didiamin penduduk, tetapi banyak satwa liar di pulau seperti elang, babi hutan dan hewan unggas lainnya. l A6

BANDUNG ( Waspada): Kasus mafia pajak dengan terpidana Gayus Halomoan Tambunan yang ditangani Ko m i s i Pe m b e r a n t a s a n Korupsi (KPK) masih terkesan jalan di tempat. Wa k i l P i m p i n a n K P K Chandra Hamzah mengaku kesulitan dalam menentukan bagian mana dari kasus Gayus yang sesungguhnya menjadi lingkup KPK. “Situasinya sulit, untuk Lanjut ke hal A2 kol 7

Banjir Di Hilir Banjir Di Hulu

MEDAN (Waspada): Pihak keluarga TKI yang tewas dibunuh di Malaysia merasa kecewa dengan sikap Kedutaan Besar Republik Indonesia di Malaysia karena pengurusan kepulangan jenazah Hendra ,35, sempat terkendala karena pihak keluarga tidak memiliki uang untuk biaya pemulangan jenazah. “Seharusnya pemerintah membantu biaya pemulangan jenazah TKI yang meninggal dunia karena dibunuh orang tak dikenal, apalagi keluarga kami orang tak mampu,” ujar Syafrizal, Lanjut ke hal A2 kol 3

KAIRO (Antara): Para tenaga kerja wanita Indonesia yang sebelumnya bekerja di Istana Presiden Mesir saat ini mengikuti keluarga Presiden terguling Hosni Mubarak. “Mereka (TKW) semua baik-baik saja karena ikut keluarga Presiden ke Sharm El Sheikh,” kata Kepala Fungsi Protokol dan Konsuler KBRI Kairo Abdullah Muhammad di Kairo, Sabtu (16/4). Menurut Abdullah, sekitar sebulan yang lalu, dua TKW di keluarga Alaa Mubarak, salah satu putra Hosni Mubarak, datang ke KBRI untuk memperpanjang masa berlaku paspor mereka. “Kami tanya saat mereka datang ke KBRI, bagaimana keadaannya? Mereka jawab baik-baik saja

KPK Akui Sulit Usut Kasus Gayus Tambunan

Waspada/Hamdani

DESA Pamah, Kecamatan Deli Tua, Kabupaten Deli Serdang menjadi awal perjalanan Tim Waspada bersama anggota DPD RI asal Sumut Parlindungan Purba, SH, MM menyusuri Sungai Deli, Kamis (14/4) pagi. Dengan menggunakan perahu karet milik Pusat Penanggulangan Krisis Regional I Kementerian Kesehatan RI, tim melewati sejumlah rintangan berupa bebatuan, pohon bambu dan sampah di tengah alur sungai. Penyusuran yang dimulai pukul 08:30 itu, semula berjalan lancar. Arus sungai turut membantu menghanyutkan perahu karet yang diawaki tujuh orang ini. Namun setelah lebih satu jam perjalanan, laju perahu karet terasa begitu lambat. Arus sungai nyaris tidak terlihat lagi. Air di permukaan

dan anggota DPD RI asal Sumut Parlindungan Purba, SH, MM (kanan) ketika menyusuri sungai Deli di kawasan Pamah, Kecamatan Delitua, Kabupaten Deliserdang, Lanjut ke hal A2 kol 1 Kamis (14/4).

VARIASI OMELET

Omelet bila dikreasikan dengan bermacam bahan makanan lainnya seperti tahu, jagung, sayuran dan daging akan terasa lebih lezat dan bergizi, bisa dijadikan cemilan sehat atau lauk sarapan pagi.

l B1

TAMBANG EMAS MADINA SEMAKIN MARAK

Kegiatan tambang emas masyarakat di Kec. Hutabargot, Kab. Mandailing Natal (Madina) yang mulai sejak bulan Maret 2010 lalu makin marak dan merajalela. Ribuan masyarakat dari 23 kecamatan di Madina saat ini menggantungkan nasib dari hasil tambang emas. l B5

net

Jaksa Cirus Sinaga Sabtu (16/4) malam resmi ditahan di Rumah Tahanan Bareskrim Polri.

Apakah Anak Perempuan Pertama Dari William Dan Kate Langsung Calon Ratu Masalahnya Kini Jadi Perenungan Pemerintah Inggris

AKHIR bulan ini Pangeran William — pewaris kedua tahta kerajaan Inggris setelah ayahnya — akan melangsungkan perkawinannya dengan Catherine Middleton, yang berarti dia bakal menjadi raja sehari. Namun kapan dia akan menjadi raja sebenarnya? Apakah harus menunggu neneknya mangkat atau ayahnya menyerahkan mahkota kerajaan. Sehubungan dengan masalah pergantian pemangku tahta kerajaan Inggris itu, pemerintah negara tersebut sedang mempertimbangkan berbagai aturan yang ada, apakah harus di ubah karena dari perkawinan William dan Kate akan lahir keturunan baru yang ada kaitannya dengan tahta. Jika anak pertama William dan Kate seorang gadis apakah dia akhirnya nanti menjadi ratu. Lanjut ke hal A2 kol 7

Lirik Lagu John Lennon Dilelang Rp 1,7 Miliar LIRIK lagu ‘Lucy in the Sky with Diamonds’ yang ditulis tangan oleh John Lennon dilelang di Los Angeles, bulan depan. Seperti dikutip femalefirst, lagu yang merupakan salah satu koleksi the Beatles itu ditargetkan terjual seharga £122ribu atau sekitar Rp1,7 miliar. Lembaran lirik ‘Lucy in the Sky with Diamonds’ itu juga berisi baris pembuka lagu ‘She’s Leaving Home’

Lanjut ke hal A2 kol 7

GATAL-GATAL AKIBAT ULAT BULU

Serangan ulat bulu yang mewabah di beberapa daerah akhir-akhir ini kabarnya diakibatkan karena iklim yang ekstrim dan tak menentu.

l B7

Berita Utama

A2 Polsek Torgamba Ungkap Peredaran Upal Rp1 M TORGAMBA (Waspada): Polsek Torgamba dibawah pimpinan Kapolsek AKP Junjung Siregar membongkar mata rantai peredaran upal (uang palsu)Rp 1 miliar yang diedearkan di Labuhanbatu-Tapsel. Hal itu dikatakan Kapolres Labuhanbatu AKBP HirbakWahyu Setiawan SIK melalui Kasat Reskrim AKP Tito Hutauruk SIK SH kepada Waspada, Sabtu (16/4). Menurut Kasat kasus upal terungkap, Kamis (14/4) sekira pukul 20.00 wib, oleh pelapor Habnur sesuai dengan. Laporan Polisi Nomor : LP / 66 / IV / 2011 / SU / RES LBH / Sek Torgamba. Dari laporan Habnur PolsekTorgamba menangkap dua tersangka yaitu SRL, 21, warga Jalan Kampung Jawa, Kelurahan Kota Pinang, Kec. Kota Pinang Kab. Labuhanbatu Selatan dan RD, 17, warga Kampung Baru I, Kelurahan Kota Pinang Kecamatan, Kota Pinang. Menurut Kasat, kronologis penangkapan berawal dari informasi yang diperoleh pelapor dari masyarakat adanya orang sedang mengedarkan uang palsu di daerah dusun Teluk Pinang Desa Asam Jawa, Kecamatan Torgamba. Pelapor dan saksi menuju tempat yang dimaksud, setibanya di kios rokok pelapor melihat kerumunan warga yang sedang mengamankan pelaku. Mengetahui pelapor bersama petugas, masyarakat yang sempatmelakukantransaksidenganpelakuspontan menyerahkan sebelas lembar uang pecahan Rp 50.000 yang diduga palsu. Petugas kemudian mengamankan pelaku RD di mana sebelumnya tersangka diamankan oleh masyarakat. “ Masyarakat curiga uang yang digunakan tersangka adalah palsu, “ ungkap Kasat. Polsek kemudian melakukan pengembangan dan mencari asal usul uang. Petugas kemudian menangkap SRL saat berada di warnet Dragon Kota Pinang. Sementara itu KapolsekTorgamba AKP Mara Junjung Siregar kepada Waspada di Mapolres menambahkan para pelaku upal merupakan suatu sindikat. Mereka sudah mengedarkan upal sebesar Rp 1 miliar di wilayah Labuhanbatu dan Tapsel. (a17)

Waspada/Hamdani

SAMPAH menumpuk di pintu air kanal, Kamis (14/4). Selain itu, terlihat ketinggian bendungan kanal berkisar dua meter dari permukaan air. Ketika terjadi banjir, maka air tetap mengalir ke sungai Deli karena ketinggian bendungan yang mengarah ke hilir sungai lebih rendah dibanding bendungan kanal.

Banjir Di Hilir, ... sungai tidak bergerak dan perahu karet seakan berada di tengah kolam yang panjang. Tujuh awak perahu karet termasuk anggota DPD RI asal Sumut Parlindungan Purba terpaksa bekerja keras mengayuh dayung guna mempercepat perjalanan. Semakin perahu karet melaju ke arah hilir, air sungai terasa semakin tidak memiliki arus dan terlihat begitu tenang. Waktu telah menunjukkan pukul 10:30, namun tidak terlihat tanda-tanda adanya arus sungai guna membantu perjalanan perahu karet. Di tengah kebingungan akan kondisi sungai Deli yang seolah-olah ‘mati’ ini, tiba-tiba terdengar teriakan seorang wanita lanjut usia dari pinggiran sungai. “Pak, tolong kami. Air sungai ini tidak mengalir. Setiap kali kami buang air besar, kotorannya tetap tergenang di sini. Padahal air sungai ini kami pakai untuk mandi dan mencuci. Tolong lah pak, singgah ke sini dulu,” pinta Legiyem, 55, dengan nada memelas. Mendengar keluhan itu, Parlindungan Purba dan tim Waspada segera mengarahkan perahu karet ke pinggiran sungai. Dalam tempo sekejap, sejumlah warga langsung berkumpul dan menyampaikan keluhannya. Wajah-wajah mereka yang tidak muda lagi, terlihat begitu pasrah. Namun sorot matanya memancarkan pengharapan akan hadirnya seseorang yang bisa mengakhiri penderitaan mereka. “Di sana dibendung pak, makanya air tidak jalan. Tolonglah bilang sama mereka pak, agar pintu air dibuka supaya airnya mengalir. Tolong ya pak. Kami sudah melapor pada lurah dan camat tapi tidak ditanggapi,” tambah Poniseh, 37, warga Jln. Eka Murni. Jika hujan deras, lanjut Poniseh, genangan air sungai Deli tersebut makin tinggi, sehingga warga setempat tidak bisa memanfaatkannya untuk mencuci. “Dulu anak-anak masih bisa mandi di sungai. Tapi sekarang, sungainya makin dalam dan airnya jorok karena tidak mengalir,”ujarnya. Mendengar keluhan warga tersebut, tim Waspada makin penasaran dan mencari tahu penyebab air sungai itu tidak mengalir. Perjalanan kembali dilanjutkan dengan mengayuh perahu sejauh lebih 1 km. Sekitar pukul 11:25 siang, tim tiba di kawasan kanal yang dibangun dengan biaya Rp1,2 triliun tersebut. Setelah tiba di bendungan kanal, Parlindungan Purba dan tim Waspada langsung menemui Syamsul, selaku petugas penjaga pintu air. Menurutnya, hanya satu pintu air dibuka sehingga debit air yang mengalir sangat kecil. Syamsul sempat berdalih, jika dua pintu air dibuka, maka warga di kawasan hilir sungai akan marah. Mendengar pernyataan ini, Parlindungan Purba berang dan menyuruh Syamsul untuk membuka pintu satu lagi. “Ini tidak boleh ditutup-tutup, seharusnya sudah diatur berapa ketinggian air. Kasihan warga di atas, rumahnya nyaris tenggelam. Cepat buka pintu satu lagi,” ujarnya dengan nada keras. Syamsul berusaha membuka satu lagi pintu air agar debit air sungai menjadi lebih deras. Saat hendak dibuka, ternyata mesin penggerak pintu air mengalami kerusakan. “Rusak pak,” ujar Syamsul kepada Parlindungan sambil berusaha menelefon pihak kontraktor pemelihara. Pantauan Waspada di lapangan, kanal yang sengaja dibangun untuk menanggulangi banjir di Kota Medan terkesan tidak berfungsi. Sebab, bendungan kanal dibangun lebih tinggi ketimbang bendungan sungai Deli. Akibatnya, ketika terjadi banjir, maka air tetap mengalir ke hilir sungai Deli dan hanya sebagian kecil menuju kanal. Pada kondisi normal, terlihat ketinggian bendungan kanal berkisar dua meter dari permukaan air. Sedangkan di bendungan sungai Deli, terlihat permukaan air hampir sama deJawaban Problem Catur, ngan puncak bendungan. “Inilah yang menyebabkan Dari Halaman Sport. kanal tidak berfungsi dan Kota Medan tetap mengalami banjir. Lihat aja, bendungan kanal lebih Jawaban Problem Catur: tinggi dibanding bendungan sungai Deli. Akibatnya, air lebih banyak mengalir ke sungai 1. h5+, Rxh5. Deli ketimbang ke kanal,” ujar 2. Mh3+, Rg6 (Jika Parlindungan. Terkait dengan proyek pem2. ....., Bh4. bangunan kanal ini, Parlindungan berjanji akan membawa 3. Gf7+mat). permasalahan tersebut ke Menteri Pekerjaan Umum. “Proyek 3. Me6+, Rh5. ini sepertinya sia-sia dan tidak 4. Bh2+, Bh4. bisa dirasakan manfaatnya oleh masyarakat. Sejak kanal ini di5. Gd1+, g4. bangun, malah yang terjadi banjir di hilir dan banjir di hulu,” 6. Mxg4+mat. demikian Parlindungan. (tim)

WASPADA Minggu 17 April 2011

Teluknibung Juara Umum MTQN Ke-43 Kota Tanjungbalai TANJUNGBALAI (Waspada): Kecamatan Teluknibung berhasil meraih juara umum pada Musabaqah Tilawatil Qur’an Nasional (MTQN) ke43 Kota Tanjungbalai sehingga mencatat rekor juara bertahan selama sembilan tahun berturut-turut, di Kecamatan Tanjungbalai Utara, Jumat (15/4) malam. Berikut hasil perolehan juara I masing-masing cabang perlombaan. Cabang Khattil Qur’an golongan Mushaf putra dan putri diraih Hasan Basri dan Nur Sri Laini utusanTeluknibung (TLN),

kemudiangolongannaskahputra dan putri diraih Khairul Ar Rasyid dan Leni dari juga TLN. Sedangkan Khattil cabang Dekorasi putra dimenangkan Husnul dari Tanjungbalai Utara (TBU), untuk putri diraih Siti Zaitun membawa nama Kecamatan Tanjungbalai Selatan (TBS). Sementara cabang Syarhil Qur’an direbut tim TLN yakni, Herdiansyah, Siti Rahayu dan Nurhalimah. Cabang lainnya Fahmil Quran disabet Kecamatan Datukbandar dengan tim M Irwan, Jefri dan Sari Fatimah, sedang-

kan Tafsir Bahasa Inggris golongan putra dimenangkan Ramlan dari Tanjungbalai Utara. Tafsir Bahasa Indonesia putra dan putri diraih M Yusuf dan Fauziah dari kecamatan yang sama Tanjungbalai Utara. Untuk Tafsir Bahasa Arab golongan putra pemenangnya Satria Rambe dari Kecamatan Seitualang Raso (STR). Berikutnya perlomban Qiro’ah Sab’ah putra dimenangkan Jamaluddin dari Kecamatan Datukbandar Timur (DTB.Timur), dan untuk putri disabet Mariati utusan Kecamatan tuan rumah TBU.

SIGLI (Waspada): Bendera Gerakan Aceh Merdeka (GAM) yang dikibarkan di pematang sawah, Desa Pulo Pisang, Kecamatan Pidie, Kabupaten Pidie diturunkan polisi dari jajaran Mapolres Pidie, Sabtu (16/4) sekira pukul 16:00. Polisi sudah mengantongi nama pelaku pengibaran bendera GAM tersebut, namun belum mengetahui motif dari aksi pengibaran bendera tersebut.” Pelakunya kita duga berinisial A, 60 warga Desa Pulo Pisang. Saat ini tersangka sedang dimintai keterangan oleh anggota penyidik” kata Kapolres Pidie AKBP Dumadi, SSTmk kepada Waspada, Sabtu (16/4). Menurut Dumadi, bendera tersebut dikibarkan oleh A sekira pukul 13:00 persis di areal persawahan dibelakang PLTD Pulo Pisang. Tersangka datang keTKP

sendiri dengan membawa selembar bendera GAM. Lalu pelaku berjumpa dengan salah seorang petani yang sedang menanam padi. “ Saat mau dipasang bendera itu oleh tersangka A, petani tadi sempat melarangnya. Tetap pelaku tetap ngotot. Setelah selesai mengibarkan bendera GAM itu, tersangka kembali ke rumahnya” kata Dumadi. Kapolres Pidie mengungkapkan selama ini keamanan di Pidie berjalan baik dan masyarakat diyakininya tidak akan terpengaruh dengan adanya aksi pengibaran bendera GAM tersebut. Ketua Komite Peralihan Aceh (KPA) Pidie Abu Chiek kepada Waspada, kemarin menegaskan, pihaknya mengutuk sekaligus menyesalkan tindakan pelaku mengibarkan bendera

GAM dalam kondisi Aceh yang sudah aman seperti sekarang ini. Tindakan itu menurutnya dilakukan oleh pihak-pihak yang tidak bertanggungjawab yang tidak menginginkan daerah ini aman. “ Kami segenap unsur KPA Pidie berkomitmen tetap menjaga perdamaian di Aceh, dan pengibaran bendera itu bukan dilakukan oleh kami. Tetapi ada pihak-pihak lain yang tidak senang dengan kondisi Aceh hari ini” papar Abu Chiek. Petinggi GAM yang kini beralih menjadi KPA mengungkapkan pihaknya tidak membayangkan akan adanya aksi pengibaran bendera tersebut. Karena itu sebut dia, seluruh elemen masyarakat diharapkan tidak terpengaruh, karenatindakanitudilakukan olehpihak-pihakyanginginmerusak kedamaian di Aceh. (b20)

Cabang Mujawwad golongan anak-anak diraih M Aulia dan Qori Rizkina masing-masing utusan STR dan DTB.Timur, golongan remaja Muchid Arianto dan Rica Lestari dari Kecamatan Tanjungbalai Utara. Untuk golongan dewasa diperoleh Heri Candra dan Nuraini keduanya utusan dari TBU. Tartil Qur’an golongan putra dan putri dimenangkan Raihan Hanafi dari Teluknibung dan Samira Taufiqoh asal Tanjungbalai Utara. Cabang Hifzil Qur’an golongan 1 Juz dan tilawah dimenangkan MYeyentumena Harahap dari Kecamatan Seitualang Raso, sedangkan juara I putri Mabruroh dari Teluknibung. Golongan Hafiz 5 Juz diraih Khoiriah dari Kecamatan Seitualang Raso, namun untuk putra para peserta tidak dapat memenuhi point yang ditentukan sehingga hanya memperoleh juara III M Shohib dari Seitualang Raso. Untuk hafalan 10 Juz putra dimenangkan Rudi Syahputra dari Seitualang Raso, dan untuk putri tidak ada. Sedangkan untuk hafalan Al-Qur’an 30 Juz diraih M Nazri utusan dari Kecamatan Teluknibung, sementara golongan putri juga tidak ada. Untuk itu, Dewan Hakim memutuskan Teluknibung sebagai juara umum dengan perolehan nilai 61, disusul Tanjungbalai Utara 35 point danTanjungbalaiSelatande-ngan nilai 20. Para pemenang memperoleh hadiah masing-masing sepeda motor, sepeda elektrik, Televisi dan alat elektronik lainnya serta uang tabungan. (a32)

Keluarga TKI ...

telah meninggal dunia, dirinya langsung menghubungi KBRI di Kuala Lumpur untuk mempertanyakan proses pemulangan jenazah Hendra yang tewas dibunuh itu, namun pihak KBRI mengaku tidak punya biaya untuk mengurus pemulangan jenazah ke Medan, Keluarga kami orang susah dan jenazah harus segera dibawa ke Medan karena sudah beberapa hari menjadi mayat di rumah sakit. Saat ditanyakan bagaimana solusinya, “Staf KBRI itu menyarankan untuk mengurus surat miskin sehingga bisa dibantu untuk pemulangan jenazah,” sebut Syafrizal menirukan jawaban staf KBRI tersebut. Syafrizal menuturkan, seharusnya pihak KBRI lebih pro aktif untuk mengurus pemulangan jenazah tersebut sehingga jenazah tidak sampai berharihari menginap di rumah sakit Selangor. “Apa karena kami keluarga miskin dan tidak mampu sehingga pemerintah kurang Mubarak dan kedua putranya, Alaa dan Gamal, telah ditahan oleh Kejaksaan Agung atas tuduhan korupsi dan penyalahgunaan wewenang. Mubarak sendiri saat ini menjalani pengobatan di salah satu rumah sakit di Sharm El Sheikh karena sakit dan direncanakan akan dipindahkan ke rumah sakit militer. Menurut surat kabar Al Hayat, Jumat (15/4), Mubarak dan istrinya, Suzanne, dilayani oleh seorang TKW asal Filipina.

merespon pemulangan jenazah tersebut,” Untung saja, tambah Syafrizal, di saat kebingungan pihak keluarga, tiba-tiba saja teman Lia, adik korban, yang juga bekerja sebagai caddy golf di Negeri Sembilan, prihatin melihat peristiwa tersebut, apalagi mayat Hendra masih tertahan di Hospital Tengku Ampuan Rahimah Klang, Selangor, sejak 3 April 2011. Selanjutnya, teman Lia membantu biaya pemulangan jenazah tersebut hingga sampai ke Bandara Polonia Medan. “Total biayanya mencapai 6000 ringgit,” jelas Syafrizal. Dijelaskan Syafrizal, jenazah Hendra tiba di Bandara Polonia Medan, Sabtu (16/4) sekira pk 09:00. Setelah mengurus segala dokumen jenazah di bandara, sekira pk 10:00, jenazah Hendra tiba di rumah duka. Tanpa banyak acara, setelah pihak keluarga melihat kondisi jenazah, kemudian melaksanakan sholat jenazah dan sekira pk 11:00 jenazah langsung dibawa ke pekuburan muslim di Jalan Tuba IV Medan Denai. Menurut Syafrizal, kabar duka cita tersebut diketahui oleh pihak keluarga melalui seorang petugas Polsekta Medan Area yang datang ke rumahnya pada 13 April lalu. Begitu mendapat kabar mengejutkan itu, Syafrizal menelefon Lia, adik kandung Hendra, yang bekerja di Negeri Sembilan. Setelah dicek oleh Lia, barulah pihak keluarga percaya bahwa Hendra telah menjadi

mayat karena dibunuh oleh orang tak dikenal di lokasi tempatnya bekerja pada 3 April lalu. Ikhwal kematian TKI tersebut baru diketahui pihak KBRI pada 6 April, setelah melihat mayat Hendra berada di Hospital Tengku Ampuan Rahimah Klang, Selangor. Kepergian Terakhir Menurut Syafrizal, keberangkatan adik kandungnya itu ke Malaysia memang bukan yang pertama kalinya. Hendra sudah berkali-kali bekerja di Malaysia. Namun, saat berangkat ke Malaysia melalui Pelabuhan LautTanjungbalai, Hendra sempat berpesan bahwa kepergiannya itu merupakan yang terakhir kali. “Saat berangkat ke Malaysia pada pertengahan 2010, Hendra sempat mengatakan bahwa keberangkatannya itu yang terakhir kali. Artinya, bila dirinya kembali ke Medan dan tidak akan kembali lagi,” tutur Syafrizal menirukan ucapan adik kandungnya kala itu. Namun, tambah Syafrizal, sebelum meninggal, Hendra sempat mengirim uang senilai Rp 1 juta untuk membantu biaya hidup keluarganya. “Hendra mengirim uang tersebut pada Februari lalu,” beber Syafrizal sembari menambahkan keberangkatannya adik kandungnya itu tanpa melalui PJTKI karena Hendra berangkat sendirian dan sudah ada majikan yang akan menampungnya bekerja di perkebunan. (h04)

tu-satunya tersangka yang terlibat berbagai kasus mafia pajak Gayus Tambunan, yang tak ditahan. Mengenai kemungkinan pengajuan penangguhan penahanan, Parlindungan mengatakan, masih akan melihat perkembangan beberapa hari ke depan. “Itu kan (pengajuan penangguhan) hak ya,” ujarnya. Parlindungan telah menghubungi keluarga Cirus di Medan, Sumatera Utara, memberitahukan tentang penahanan Cirus. “Saya sudah telefon. Kebetulansayakeluarganyajuga.Kalau saya ngomong (Cirus ditahan), mereka terima,” ucapnya. Cari Kekayaan Sebelumnya penyidik Ba-

reskrim Polri membawa tersangka jaksa Cirus Sinaga ke rumah kontrakannya di daerah Petukangan,JakartaSelatan,Sabtu (16/4 ), untuk mengambil sejumlah dokumen pribadi. Parlindungan Sinaga, penasihat hukum Cirus, mengatakan, Cirus ingin mengambil dokumen daftar harta kekayaan dandaftarriwayathidup.Langkah itu terkait pertanyaan yang diajukan penyidik saat pemeriksaan semalam. “ Malam sebelumnya Cirus ditanya soal harta.Waktu dikasih untuk koreksi, saya bilang jawaban harus jelas tahun pembelian harta supaya jangan dikira sekaligus dibeli. Makanya diambil dokumen

LHKPN (laporan harta kekayaan pejabat negara),” terang Parlindungan di Mabes Polri, Sabtu. Setelah itu, kata Parlindungan, Cirus kembali diperiksa. Cirus baru menjawab 20 pertanyaan. Setelah itu, penyidik melakukan penangkapan untuk menahan sementara dalam waktu 1 x 24 jam. Kemudian Sabtu malamnya Cirus resmi ditahan oleh Mabes Polri. Cirus dijerat dua perkara, yakni dugaan pemalsuan dokumen rencana penuntutan bersama Haposan Hutagalung serta dugaan menghalang-halangi penyidikan kasus Gayus Halomoan Tambunan di Bareskrim Polri tahun 2009. (k/m09)

Suhu Politik Memanas, Bendera GAM Berkibar Di Pidie

38, abang kandung Hendra, saat ditemui di rumah duka Jalan Bromo Gang Tertib, Kecamatan Medan Denai, Minggu (16/4 ) sore usai pemakaman jenazah Hendra di pekuburan muslim Jalan Tuba IV Medan Denai. Ironisnya, tambah Syafrizal, biaya pemulangan jenazah Hendra malah dibantu oleh warga Malaysia yang merasa simpati dengan kondisi yang dialami oleh keluarga sehingga kami merasa kecewa dengan sikap pihak KBRI. Biaya pemulangan jenazah tersebut mencapai 6000 ringgit atau senilai Rp18 juta. “Kami sangat berterimakasih kepada warga Malaysia yang telah membantu biaya administrasi hingga pemulangan jenazah ke Medan,” ujar Syafrizal yang kesehariannya bekerja sebagai PNS di kantor Dinas Infokom Sumut ini. Dijelaskan Syafrizal, begitu adik kandungnya dikabarkan

TKW Indonesia ... dan bersedia mengikuti majikannya ke Sharm El Sheikh,” ujarnya. Setelah mengundurkan diri pada 11 Feberuari lalu, Mubarak dan keluarganya hengkang dari Istana Presiden di Kairo ke rumah pribadi mereka di Sharm El Sheikh, kota wisata tersohor di pesisir pantai Laut Merah, Semenanjung Sinai Selatan, sekitar 500 kilometer arah timur Kairo.

Jaksa Cirus ... Sehari sebelumnya, penyidik menahan sementara Cirus dalam waktu 1 x 24 jam dengan mengeluarkan surat perintah penangkapan. Cirus diwajibkan menginap di ruang kerja penyidik. Pemeriksaan dilanjutkan Sabtu siang dengan membawa Cirus ke rumah kontrakkannya di daerah Petukangan, Jakarta Selatan, untuk mengambil sejumlah dokumen. Polri pernah dikritik oleh berbagai pihak lantaran tak menahan Cirus. Selain itu, Cirus yang ketua tim jaksa penuntut umum kasus mantan Ketua KPK Antasari Azhar itu juga dinilai “sakti”. Pasalnya, Cirus sa-

Pembom= M. Syarif ... orang tua Syarif mengantarkan para penjemput yang diduga reserse ke rumah istri pelaku di Majalengka. Menurut Rasid, orang yang menjemput tersebut meminta diantarkan ke rumah istri Syarif yang berada di Majalengka sembari menunjukkan foto. “Sekira jam 10-an tadi malam, kedua orang tuanya dan adiknya ada yang jemput, mereka minta di antar ke rumah istri M. Syarif di Majalengka dengan melihatkan foto,” kata dia. Bertemu Istri Dua Minggu Lalu Sri Malita,27, istri dari tersangka pelaku bom bunuh diri M.Syarif mengaku terkahir bertemu suaminya sekitar dua minggu lalu. Sri Malita mengatakan, suaminya mengemukakan hendak pergi guna mencari biaya persalinan anak pertamanya. “Waktu itu suami saya bilang mau cari kerja, tapi nggak menyebutkan hendak pergi ke mana,” kata Sri Malina di Dusun Senen Desa Panjalin Kidul Kecamatan SumberWaras, Majalengka, Sabtu. Menurut Sri, suaminya bekerja di Cirebon di sebuah tempat sablon sebagai desainer. Sri yang menikah dengan Syarif pada Agustus 2010, dan masih tinggal di rumah orang tua. Ketika ditanya pers, apakah suaminya sering pulang setelah bekerja, Sri membenarkan hal itu. “Biasanya setelah bekerja suami saya langsung pulang. Kali ini nggak pulang karena katanya mau merantau untuk persiapan lahiran anak,” kata Sri. Ia mengaku sudah beberapa kali mencoba mengontak suaminya, namun ponselnya tidak bisa dihubungi. “Saya bingung mencari tahu keberadaan suami saya karena ia tidak bisa dikontak,” ujar Sri.Sri mengaku mengenal suaminya sebagai sosok yang humoris dan bukan tipe orang yang aneh. Namun, menurut Sri, suaminya jarang mengutarakan persoalannya. Sementara itu,Warini ,70, mertua Syarif juga mengaku mengenal Syarif sosok yang pendiam dan jarang ngobrol. Ia juga mengaku tidak mengetahui kemana perginya menantunya tersebut. “Mau merantau ke mana juga dia nggak bilang,”

kata Warini. Sementara warga Gang Nyi Gede Rara Kuning, Kampung Atsana Garib, Kelurahan Pekalipan, Kota Cirebon mengenali pelaku bom bunuh diri di Masjid Mapolresta sebagai Muchamad Syarif, anak keempat dari delapan bersaudara dari pasangan Sri Mulat dan Gofur yang tinggal di gang itu. Kadasabda ,84, dan Ibu Jaenah ,60, tetangga Sri Mulat membenarkan bahwa foto yang diperlihatkan Mabes Polri sebagai pelaku bom adalah tetangga mereka yang sudah sekitar satu tahun pindah ke Majalengka karena menikahi gadis di sana. “Saya yakin, ini Syarif karena dari mata, dahi, alis dan janggutnya,” katanya kepada wartawan yang memenuhi kampung itu, Sabtu (16/4) siang. Hal senada diungkapkan Jaenah yang letak rumahnya dekat dengan rumah ibu pelaku. “Saya yakin dari alis dan jangkutnya, wajahnya itu mirip ibunya,” kata Jaenah sambil memandangi foto pelaku di Blackberry. Supandi, Ketua RT03/06 yang rumahnya berdampingan dengan rumah Sri Mulat mengatakan, Jumat (15/4) malam sekitar pukul 22: 00 WIB, polisi menjemput Sri Mulat dan anak bungsunya, Muhamad Fatoni, untuk dibawa ke RS Bhayangkara, Kramat Jati, Jakarta Timur. Dikenal Warga Pria Stres Supandi menyatakan kepada wartawan bahwa Syarif dikenal warga sebagai pria yang stress dan kerap berbuat tindakan di luar batas. “Dia pernah membubarkan sekumpulan pemuda yang sedang mabuk sambil memecahkan botol. Tapi mereka tidak melawan karena mereka menganggap Syarif stres,” kata Supandi. Selain itu, Syarif juga dikenal keras dan temperamen. Dia pernah kedapatan memukuli adik kandungnya sendiri. “Dia memang tidak akrab dengan keluarganya, apalagi dengan warga lainnya,” tandasnya. Syarif Sakit Hati Kepada Polisi? Berdasarkan informasi berupa pesan singkat yang diterima sejumlah wartawan di Cirebon, Syarif nekat melakukan bom bunuh diri karena dirinya sakit hati kepada polisi yang tidak mengindahkan laporan orangtua Syarif.

Waspada/Rasudin Sihotang

PARA juara memperoleh hadiah sepeda motor dan tabungan sebagai penghargaan atas partisipasinya dalam mendakwahkan serta memasyarakatkan Al-Quran di Kota Tanjungbalai, pada malam penutupan MTQN ke-43 di Kecamatan Tanjungbalai Utara, Jumat (15/4) malam.

Apakah Anak Perempuan ... Deputi PM Nick Clegg mengatakan dia yakin bahwa peraturan yang ada sekarang ini yang menetapkan anak-anak laki-laki mendahului saudara-saudara mereka yang perempuan “akan mengesankan sebagian besar orang yang menganggap langkah itu sebagai sedikit cara lama.” Komentarnya Sabtu (16/4) muncul kurang dari dua minggu sebelum upacara megah perkawinan putra sulung mendiang Putri Diana dengan Kate pada 29 April mendatang. Clegg mengatakan pemerintahnya mempertimbangkan perubahan aturan supaya jika anak pertama pasangan tersebut seorang putri, maka dia akhirnya akan mewarisi tahta, meski dia memiliki seorang adik laki-laki. Dia menegaskan bahwa perubahan itu merupakan suatu proses yang kompleks yang membutuhkan konsultasi dengan negara-negara anggota Persemakmuran Inggris — sebagian mengakui monarkhis Inggris sebagai kepala negaranya. Monarkhi Inggris saat ini, Ratu Elizabeth II, mewarisi tahta kerajaan karena dia anak tertua dari dua perempuan bersaudara. Jika dia memiliki seorang saudara laki-laki, dia jauh lebih muda darinya, sehingga dia harus melangkahi banyak saudaranya dalam garis suksesi. Anak pertama Elizabeth seorang putra, Pangeran Charles — namun saudara perempuanya, Anne lebih rendah dalam garis suksesi dibanding saudara-saudara laki-lakinya, Andrew dan Edward. Charles, sebaliknya, memiliki dua anak laki-laki dan kini telah pun dewasa. Pada masa lalu, para wanita tidak dimasukkan dalam suksesi. Anak pertama Ratu Victoria seorang putri — yang juga bernama Victoria — namun adik laki-lakinya lah yang menggantikannya untuk menduduki singgasana, sebagai Raja George V. Akan lakukan debut televisi Perbincangan paling hangat pekan ini di Inggris adalah tentang kemungkinan pembuatan film khusus untuk televisi tentang hari-hari awal roman percintaan mereka. Namun respon sejauh ini tentang William and Kate Middleton: The Movie menunjukkan film itu mungkin mendapat sambutan audiens luas — meski film itu tidak sampai disejajarkan dengan film terbaik dalam perebutan Oscar. Suratkabar The Guardian memberikan respon Jumat dengan sebutan film itu jauh lebih buruk dari yang diperkirakan. Suratkabar itu mengatakan film itu demikian buruk dan sangkin buruknya mungkin banyak orang yang akan melemparkannya. Film tersebut buruk karena tidak ada orang yang cenderung tampil sebagai aktor atau aktris di sana, lokasinya pun buruk, dan aksennya pun tidak baik. Tetapi mereka serba kekurangan dalam banyak hal, baik nyata ataupun dari pembayangan, tidak akan menjaga film itu, yang shooting seluruhnya di Los Angeles, dari waktu tayang televisi semakin sempit di Inggris dan Amerika Serikat karena waktunya hanya tinggal dua minggu lagi sebelum apacara perkawinan 29 April itu. Setelah usai masa pesta perkawinan, film itu akan dijual dalam bentuk DVD, kemungkinan akan dijadikan sebagai dokumentasikan oleh para kolektor memorabilia. (ap/bbc/m10)

KPK Akui Sulit Usut ... suap itu domainnya polisi. Sementara pajak itu bukan domain KPK. Kita masih menyelidiki pembuktian apakah itu termasuk korupsi atau tidak,” katanya usai Lokakarya Peningkatan Wawasan Media di Bandung, Sabtu (16/4). Meski demikian, KPK tetap melakukan penyelidikan terhadap kasus tersebut. Sebelumnya, Kepolisian menyatakan terdapat 19 wajib pajak yang pernah ditangani bekas pegawai Pajak golongan III-A diduga berpotensi merugikan negara. “Kita kalau di penyelidikan memang cenderung tidak bisa berbicara,” tambah Chandra.(okz)

Lirik Lagu John Lennon .... – single lain the Beatles dari album mereka ‘Sgt Pepper’s Lonely Hearts Club Band’ yang dirilis tahun 1967. Lembaran yang akan dilelang itu diharapkan meraup hasil besar. Lembaran lirik lagu itu juga memuat gambar sketsa empat orang yang dipercaya anggota the Beatles, yaitu John Lennon, Sir Paul McCartney, George Harrisondan Ringo Starr. Mereka berempat digambar sedang berada di sebuah ruangan dengan tirai. Beredar desas-desus bahwa ‘Lucy in the Sky with Diamonds’ ditulis John Lennon di bawah pengaruh obat yang merangsang halusinasi. John sendiri selalu membantah rumor ini. Ia pernah mengatakan, inspirasi lagu itu berasal dari putranya, Julian, yang menggambar teman sekelasnya yang bernama Lucy. John terbunuh pada tahun 1980. Acara lelang bertema ‘Profiles in History’ akan berlangsung 14-15 Mei 2011 di Beverly Hills, Los Angeles. (vvn) “Ciri2 pelaku bom bunuh diri adalah sdr. Muhamad Syarif warga Pekalipan Rt 003/ Rw 05 Kel Pekalipan Kec Pekalipan yang dilatar belakangi masalah dendam pribadi dgn instansi kepolisian,” bunyi SMS tersebut, Sabtu (16/4). Menurut SMS tersebut, persoalan ini terjadi karena pada 2010 silam orangtua Syarif pernah melaporkan suatu kasus ke polisi. Namun, kasus tersebut tidak ditanggapi, bahkan kabarnya cenderung dipermainkan oleh pihak kepolisian “Diduga adalah pelaku pembunuhan Kopka Sutejo, karena dilihat dari wajah sama dg photo serta Nama dan Alamat sama,” demikian bunyi SMS tersebut. Ibunya Berjualan Kue Sri Mulat, ibu Syarif adalah penjual kue tapel, yaitu kue khas Cirebon yang sudah mulai jarang ditemui masyarakat. Jaenah, tetangga Sri Mulat mengatakan, Sri Mulat biasa berjualan setiap pagi di Pasar Kanoman. “Usaha itulah yang menghidupi keluarganya karena sudah beberapa tahun berpisah dengan suaminya,” katanya. Ia menjelaskan, keluarga Sri pindah ke Gang Nyi Gede Rara Kuning sekitar tahun 1999 dengan membeli sebuah rumah mungil ukuran 70 meter persegi yang berada di samping Mushala Nurul Huda. “Sebelumnya keluarga itu tinggal di Petratean Barat yang tidak jauh dari rumah yang dibeli itu,” katanya. “Keluarga itu baik tetapi sangat tertutup dengan tetangga di sini,” katanya. Supendi, Ketua RT03/06 juga mengatakan hal yang sama, jika keluarga itu tertutup dan jarang bergaul. “Makanya kalau ditanya Syarif, banyak anak-anak sini yang tidak kenal,” katanya. Ia mengaku belum pernah bertatap muka dengan Syarif, bahkan ibunyalah yang saat mengurus surat nikah Syarif untuk menikahi gadis Majalengka sekitar setahun lalu. Saat ini sampel darah Sri Mulat dan Muhamad Fatoni, adik Syarif masih dicocokkan dengan sampel darah pelaku bom bunuh diri oleh Tim Forensik Mabes Polri. Namun, sejumlah warga di Gang Nyi Gede Rara Kuning yakin bahwa pelaku bom adalah Syarif, bahkan mereka bertanyatanya kapan jenazah Syarif dipulangkan ke Cirebon. (okz/ant)

Sumut - Aceh

WASPADA Minggu 17 April 2011

WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: H. Akmal AZ. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Meneng BUMN Minta Dirut PTPN 1 Percepat Revitalisasi Perkebunan Di Aceh Utara ACEH UTARA (Waspada): Menteri Negara Badan Usaha Milik Negara (BUMN) Mustafa Abubakar, Sabtu (16/4) pagi, meminta Dirut PT PN 1 untuk segera mempercepat penyelesaian program revitalisasi perkebunan di Aceh. Padatahun2012programtersebuttelahharusselesaidilaksanakan. Sebelumnya, program ini dijadwalkan selesai pada tahun 2016. Hal ini terungkap pada acara pertemuan Bupati Aceh Utara Ilyas A Hamid dengan Dirut PTPN 1 di Kantor Pusat Jalan Gajah Mada Medan, No. 47. Selain bupati, acara ini juga dihadiri Dinas Perkebunan dan Kehutanan. Rapat tersebut digelar untuk mencari masukan untuk kelancaran pelaksanaan pencapaian target revitalisasi pada tahun 2014. Dihadapan Dirut PT PN 1, Bupati Aceh Utara Ilyas A Hamid menjelaskan, Aceh Utara memiliki lahan untuk program revitalisasi perkebunan seluas 2,950 ha, di enam kecamatan, yakni Langkahan, Tanah Luas, Geureudong Pase, Lhoksukon, Paya Bakong, dan Meurah Mulia. Bupati menilai, program ini sangat berarti untuk mendongkrak pertumbuhan ekonomi masyarakat di Kabupaten yang pernah mendapat julukan petro dolar itu. Program ini juga diyakini mampu menekan jumlah pengangguran. Program revitalisasi perkebunan ini mampu membebaskan Aceh Utara dari ketergantungan Pendapatan Asli Daerah dari sumber Minyak dan Gas (Migas), yang dipastikan akan berakhir pada tahun 2014. “Ini merupakan misi kami pada Pemilukada tahun 2007 lalu. Bersama DPRK setiap tahun kita alokasikan dna perkebunan dan pertanian dalam APBK, meskipun jumlahnya terbatas, sesuai dengan kemampuan daerah. Aceh Utara cukup berpotensi untuk melaksanakan program revitalisasi perkebunan itu. Kini jalur transportasi menuju ke titik lokasi sudah dibangun,” kata Ilyas A Hamid. Pada kesempatan itu, Dirut PT PN 1, meminta kepada semua pihakuntuk mendukung kelancaran program ini demi kesejahteraan dan kemakmuran masyarakat Aceh, khususnya Aceh Utara. (cmun)

A3

Usaha Karaoke Terus Berjalan

Warga Batubara Serbu Kafe Pattaya LIMAPULUH (Waspada): Ratusan warga mendatangi dan menyerbu kafe Pattaya di Desa Aras, Kec. Air Putih, Kab. Batubara, Jumat malam (15/4) sekira pukul 23:00. Akibatnya pemilik usaha beserta puluhan pekerja dan tamu yang datang ke kafe berhamburan keluar menyelamatkan diri.Warga tidak sampai berbuat lebih jauh karena ditengarai petugas keamanan yang turun ke lokasi. Menurut keterangan Waspada peroleh, aksi sponitas masyarakat itu dipicu karena merasa kesal melihat pemilik usaha tidak menutup hiburan karaoke meskipun Pemkab Batubara baik bupatimaupunKadisparporajauh hari sebelumnya menginstruk-

sikanditutup.Namunkenyataannya di lapangan mereka membandel sampai tadi malam usaha hiburan tetap berjalan alias beroperasi. ‘’Kamitidakakantinggaldiam dan terus memantau selagi usaha hiburan di kafe tidak ditutup, karena memicu keresehan di tengah-tengah masyarakat,’’ tutur warga. Kapolsek Indrapura AKP MA Ritonga dan Camat Air Putih yang turun ke lokasi mengamankan dua mobil BK 1625 VK dan BK 1822 GK disebut-sebut milik seorang oknum dan tamu yang sering datang ke kafe untuk selanjutnya menyuruh mereka pergi meninggalkan lokasi. Kemudian Kapolsek dan Camat bersama tokoh masyarakat, IrYahdi Khoir Harahap, MBA, Junaidi Raju, Ahmad Hadian dan seorang anggota dewan Ahmad Muktas menemui pengusaha

kafe. Setelah sebelumnya bertemu sama warga. Dalampertemuanitupemilik usahamengakukelirudanberjanji memulangkan sebanyak 35 pekerja sebagian besar di antaranya wanita muda yang direkrut dari berbagai daerah luar. Sedangkan tempat hiburan karaoke ditutup. Tokoh masyarakat Desa Aras H Surahmat mengharapkan pemilikusahaWagirahdanputranya Waris-Supriadi maupun oknum yang diduga sebagai backing untuk mematuhi instruksi menutup tempat karaoke. Sedangkan Pemkab melalui Satpol PP dapat melakukan penyegelan. ‘’Langkah ini perlu dilakukan agar peristiwa sama tidak terulang lagi,’’ katanya. Sampai pukul 02.00 warga baru bubar meninggalkan lokasi kembali pulang ke rumah masing-masing. (a13)

Delapan Kios Pedagang Terbakar Di Batangkuis BATANGKUIS (Waspada): Delapan kios semi permanen milikWiwikyangdibangunsejajar di pinggir parit/drainase kawasan Jalan Tembakau Deli, Desa Tanjungsari, Kec. Batangkuis, Kab. Deliserdang (depan eks Gudang Pemeraman Tembakau Deli PTPN-2-red), musnah dilalap si jago merah, Jumat (15/4) malam sekira pukul 21:00. Asal api disebut-sebut berasal dari kios JS yang menjual minyak bensin secara eceran. Tidak ada koban jiwa dalam peristiwa itu, namun kerugian yang dialami pemilik maupun para pedagang yang menyewa bangunan kios tersebut diperkirakan mencapai puluhan juta rupiah. Keterangan diperoleh di tempat kejadian perkara (TKP) menyebutkan, malam itu JS, 41 warga Jalan Batangkuis-Tanjung-

morawa, Dusun IX, Desa Tanjungmorawa B menuangkan bensin ke dalam botol-botol plastik (botol bekas minuman mineral-red) untuk dijual secara eceran di kios yang disewanya. Saat menuangkan bensin itu, tanpa sepengetahuannya di tempat yang sama salah seorang anaknya berusia sekira 3 tahun sedang bermain api. Diduga percikan api itu yang menyambar bensin yang sedang dituangkan. Kobaran api yang begitu besar langsung menjilat bangunan kios yang terbuat dari papan dan triplex. Warga sekitar yang begitu melihat terjadi kebakaran langsung memberikan berbagai pertolongan. Untuk menghindarkan kobaran api tidak menjalar ke bangunan kios lain yang berjejer di kawasanan Jalan Tembakau Deli itu, warga terpaksa mero-

bohkan sejumlah bangunan kios Sedangkan tiga unit mobil pemadam kebakaran milik PemkabDeliserdangyangtibadilokasi tidak dapat berbuat banyak. Petugas hanya menyiramkan air ke kobaran api di sisa-sia bangunan yang musnah dan telah rata dengan tanah. Kaspolsek Batangkuis AKP Kasmir, SH melalui Kanit Reskrim Iptu K Simanjuntak yang konfirmasi di kantornya, Sabtu (16/4) membenarkan. Untuk pengusutan lebih lanjut JS pemilik kios asalmunculnyaapitelahdimintai keterangan. Delapan bangunan kios milik Wiwik yang musnah masingmasing disewakan kepada JS (jual Bensin), Namboru (Sandal), Perangin-angin (ikan mas), Buk Ani (kelapa muda), Yanti (pakaian), MakEdi(pisang),Lubis(aksesoris) danSimanjuntak(masihkosong). (a06)

Wabah Ulat Bulu Serang Sekolah Di Bireuen BIREUEN(Waspada):Wabah ulat bulu yang dikabarkan menyerang sejumlah provinsi di Indonesia, kini mulai merambah juga ke Aceh khusunya ke Bireuen. Sehingga dua pelajar SMPN 3 Bireuen diduga terkena diwajahnya gatal-gatal dan menimbulkan bintil-bintil merah diwajahnya. Informasi yang diperoleh Waspada, Jumat (15/4), dua pelajar SMPN 3 Bireuen, dikabarkan gatal-gatal dan timbul bintikbintik yang diduga kuat akibat terkena ulat berbulu di bagian mukanya yang dalam beberapa hari ini menyerang beberapa provinsi di Sumatera dan di Pulau Jawa. Dua pelajar SMPN 3 Bireuen yangdikabarkanterkenaulatbulu itu, Rohayat dan M Reza Fahlevi pelajar kelas III. Namun setelah diobati dengan air gula, wajah mereka mulai membaik. Kepala SMPN 3 Bireuen, Asranul Arifin kepada wartawan di sekolahnya Jumat (15/4) mengatakan,sejumlahulatbuluyang belum diketahui asal-usulnya itu, sejak dua hari lalu mulai menyebar di pekarangan sekolah itu, bahkankemarinmulaimenyebar ke dinding dan lantai kelas. Sehingga membuat kepanikan guru, pelajar maupun sejumlah karyawan di sekolah yang dimpinnyadanterakhirdiperoleh kabar dua pelajarnya dikabarkan padanya menderita gatal-gatal danbentol-bentolmerahdiwajah

diduga akibat terkena bulu ulat itu. “Para guru dan anak-anak pelajar menduga ulat bulu itu adalahhamabiasa,namunsetelah menyerang dua pelajar di sekolah itu mereka menjadi khawatir apalagi saat ini kerab diberitakan di media elektronik maupun media massa terkait penyebaran ulat bulu tersebut. Kami mulai resah, karena ulat bulu jenisnya hitam dan jenis agak kekuningkuninganitubelumdiketahuiasalusulnya, namun saat itu menyebar ke dinding dan lantai kelas, sehingga pelajar dan guru serta seluruhkaryawandisekolahkami menjadi panik, kami khawatir jika tidak segera diantisipasi akan mengganggu proses belajar mengajar, apalagi sebentar lagi akan ujian nasional, “ katanya. Menurut Asranul, jenis ulat bulu yang ditemukan itu berbeda dengan ulat bulu yang sering menyerang tanaman. Namun pihaknyabelumdapatmengidentifikasi ulat bulu tersebut sebab jenisnya berbeda dari hama ulat bulu yang biasa menyerang tanaman. “Kami meminta kepada dinas terkait untuk segera mengatasinya sebelum bertambah banyak dan menyebar ke seluruh kelas,” harapnya. Kesurupan Selainitu,padahariyangsama lima pelajar SMPN 3 Bireuen, kesurupan saat sedang belajar diruangkelasnyamasing-masing.

Waspada/Edi Saputra Petuga Polres Sergai dan Polsek Tanjung Beringin ketika mengamankan Muhammad Yunus, 18, tersangka pembunuh ibu kandung di Gang Jawa Dusun I, Keramat Asam, Desa Pekan Tanjung Beringin, Kec. Tanjung Beringin, Kab. Sergai. Foto direkam, Sabtu (16/4) .

Remaja Depresi Bunuh Ibu Kandung TANJUNGBERINGIN (Waspada) Remaja depresi (kurang waras-red) MuhammadYunus,18, warga Gang Jawa Dusun I, Keramat Asam, Desa Pekan Tanjung Beringin, Kec.Tanjung Beringin, Kab. Serdang Bedagai tega menusuk ibu kandungnya, Marsini, 61 dengan pisau dapur hingga tewas, Sabtu (16/4) dinihari sekira pukul 05:00. Informasi yang dihimpun Waspada di lokasi kejadian menyebutkan, pelaku merupakan putra bungsu dari 3 orang anak korban yang tinggal satu rumah, sementara korban telah lama berpisah dengan suaminya Liyas alias Pikal, 63, yang saat ini tinggal di Indrapura Kab. Asahan bersama anak sulungnya, sedangkan anak keduanya tengah merantau sebagai TKW di Malaysia.

Zahara, 60, dan Syahrial, 33, keduanya tetangga yang tinggal persis di belakang rumah korban mengatakan, sekira pukul 06:00 mendengar jeritan pelaku yang mengatakan ibunya telah meninggal dunia, karena tidak berani kemudian kami mengabari tetangga lainnya, setelah itu baru memasuki rumah korban, jelas mereka kepada Waspada. “Setelah memasuki rumah, betapa terkejutnya melihat korban telah meninggal dunia dengan tubuh tergeletak bersimbah darah di ruang dapur, sementara M Yunus terdiam membisu dan sempat mengatakan telah menusuk ibunya dengan pisau dapur,” tambah Zahara. Sontak warga sekitar berhamburan menuju rumah korban dan melaporkan ke Polsek Tanjung Beringin, selanjutnya bersama warga mengevakuasi mayatnya ke RSU Sultan Sulaiman untuk di visum, sedangkan pelaku langsung bersembunyi di dalam kamar. Selanjutnya selang beberapa jam, personil Polres Sergai dan Polsek Tanjung Beringin mengamankan pelaku dari dalam kamar tanpa ada perlawanan

dibantu warga untuk membujuknya disaksikan ratusan warga yang melayat korban. Menurut warga sekitar korban yang tidak tamat Tsanawiyah itu tinggal berdua bersama ibunya dan memiliki riwayat pengguna lem kambing, sehingga menyebabkan gangguan syaraf dan jika kambuh ibunya selalu menjadi pelampiasan emosinya, hingga sampai terjadi pemukulan. Belakangan ini, kondisinya sempat membaik setelah orang tuannya membawa pelaku berobat, bahkan sempat bekerja di Medan, namun kami sangat terkejut, akhirnya nyawa korban berakhir di tangan anak kandung yang telah dilahirkannya, sebut warga. Dihadapan Petugas, Muhammad Yunus mengakui perbuatannya dilakukan karena pagi itu dirinya merasa lapar sebab malamnya belum makan, sehingga membangunkan ibunya untuk memasak mi instan, karena tidak mau bangun dirinya jengkel dan langsung mengambil pisau dari dapur dan menusukkan kebahagian perut kanan ibunya, jelasnya terbata-bata. “ Pisau ku buang ke belakang rumah, setelah mengetahui ibu telah meninggal aku langsung menjerit memanggil tetangga,” sebut Yunus tertunduk. Kapolres Sergai AKBP Drs Eri Safari didampingi Kapolsek Tanjung Beringin, AKP Yanto NH dan Kasubbag Humas AKP ZN Siregar ketika dikonfirmasi Waspada d i M a p o l s e k Ta n j u n g B e r i n g i n membenarkan peristiwa pembunuhan itu dan pihaknya telah mengamankan pelaku berikut barang bukti sebilah pisau dapur dan tengah memeriksa secara intensif pelaku, jelasnya. “Tewasnya korban diperkirakan karena pendarahan hebat yang diderita korban akibat tusukan pelaku, karena peristiwa terjadi sekitar pukul 05:00 sementara warga menemukan pukul 06:30 sehingga nyawanya tidak tertolong,” imbuh Eri Safari.(c03)

Kelima pelajar itu Meri Astina (kelas II-9), Nora Saputri, Cut Lisa, Reha Niljannah (kelas II-6), dan Syahrianti (kelas III-3). Setelah mereka ditangani guru setempat, kembali sembuh dan belajar lagi. Menurut Kepala SMPN 3 Bireuen, Asranul Arifin, kesurupan yang terjadi di sekolah mereka kemarin, merupakan yang terbesar sejak tiga tahun belakangan ini. “Biasanya kalau ada anak yang jatuh hanya satu orang itupun di saat olahraga dan upacara bendera hari senin karena diduga tidak sarapan pagi, tetapi kesurupan hari ini (kemarin-red) belum diketahui penyebabnya.

Oknum Polisi Jual Emas Hasil Rampokan Diperiksa

Baca Yasin Sementara itu, guru SMAN IPeudada,Bireuenbersamasiswa ratusan siswanya membacaYasin bersama di sekolahnya, Jumat (15/4) menjelang pelaksanaan Ujian Nasional (UN), Senin besok (18/4) secara serentak di seluruh provinsi di negara ini. Kepala SMA Negeri 1 Peudada Bireuen, Drs T Syukri Jumat (16/4) mengatakan, baca yasin inidilaksanakanuntukmenjelang siswanya mengikuti UN dan memohon supaya sekolahnya supaya tetap kompak sesama siswa. “Saat baca yasin bersama kali ini sebagian besar siswa sempat terharu, walaupun acara seperti ini juga kerap dilaksanakan setiap ujian triwulan serta acara rutin di mushalla sekolah,” katanya. (amh)

BIREUEN (Waspada): Seorang oknum anggota polisi bertugas di satu Polsek di Aceh Utara Bripka ZH, masih menjalani pemeriksaan di Mapolres Bireuen. Sehubungan pengakuan tersangka Tgk Safrizal bin Safwan alias Tgk Rizal, 28, tersangka perampokan toko emas di Peusangan, kabupaten setempat yang ditangkap belum lama ini dan sudah diamankan. Hal itu dikatakan Kapolres Bireuen, AKBP H Raden Dadik Junaedi Supri Hartono SH kepada wartawan, Jumat (15/4). Menurut Kapolres, oknum polisi yang disebut-sebut masih ada hubungan saudaranya dengan Tgk Rizal diduga terlibat ikut menjual emas hasil rampokan di toko Arifin Risyad di Peusangan akhir Desember 2010 lalu. “Oknum dapat dihukum sesuai ketentuan pidana. Untuk pelanggaran disiplin dan kode etik dikesatuanya, itu ditangani Kapolres Aceh Utara. Di Bireuen Bripka Zul ditindak sebagai pelaku tindak pidana,” katanya. Lanjut Kapolres Bireuen, pihaknya masih terus berupaya menangkap para pelaku lain ikut terlibat bersama Tgk Rizal yang ikut merampok

SPBU Paya Meuneng,Toko Grosir danToko Emas di Matang Geulumpang Dua.Tak hanya itu, orang ikut terlibat saat penjualan emas, termasuk penadahnya yang ada di Medan maupun Binjai, juga ditindak. “Untuk memastikan, apakah seluruh emas itu sudah dijual atau masih ada sisanya. Masih terus kita selidiki lagi. Termasuk hasil penjualan itu kabarnya dipakai buat beli senjata api,” tambahnya. Sebagaimana diberitakan sebelumnya, terungkapnya dugaan keterlibatan oknum polisi bertugas di satu Polsek di Aceh Utara itu, hal itu terungkap setelah menangkap Tgk Safrizal bin Safwan alias Tgk Rizal warga Peusangan, saat diperiksa tim Polres Bireuen. DalampemeriksaanTgkRizalmengaku,emas hasil curian di toko Arifin Risyad Matang Geulumpang Dua, pada 25 Desember 2010, dimintanya bantu jual, pada oknum polisi berinisial Bripka ZHitu,semingguusaiberaksi.Oknumitumengaku jual emas ke Medan Rp70 juta dan Rp 50 juta keBinjai,darihasilpenjualantersebutdiadiberikan Rp 5 juta. (amh)

Penjual Bakso Dihipnotis, Rp3,7 Juta Dibawa Kabur BIREUEN (Waspada): Nasib sial menimpa Rajini binti Marzuki, 38, penjual bakso Surabaya di kawasan Titi Cureh Bireuen dihipnotis pasangan orang tak dikenal (OTK) di warung Bakso miliknya, Kamis (14/4). Sejumlah barang dagangan belasan pak rokok yang baru dibeli di sebuah toko di Bireuen senilai Rp3.759.000 dibawa kabur pasangan OTK. Rajini binti Marzuki asal Tuban Su ra b a y a Ja w a Ti m u r d i dampingi suaminya Ismail yang dihubungi Waspada di warung

Bakso Titi Cureh, Jumat (15/4) mengatakan, Kamis (14/4) sekira pukul 10:37 dia sendirian berjualan di warung, suaminya Ismail se-dang keluar. Tiba-tiba seorang laki-laki dan seorang wanita paruh baya turun dari beca masuk ke warung miliknya, menulis selembar kertas memesan 20 bungkus bakso akan diambil sebentar lagi sambil menyerahkan nomor Hpnya 0853 68945401 untuk dihubungi. Kemudian wanita yang didampingi laki-laki tak dikenal mengusap kedua lengannya, saya

langsung merasa hilang ingatan. Lalu saya mengambil gelang emas seberat 5,9 gram diikuti pasangan OTK menuju ke PN Pegadaian Simpang IV Bireuen mengadaikan gelang emas Rp1,5 juta untuk menambah uang yang sudah ada untuk berbelanja barang dagangan rokok saya bayar sebesar Rp3.759.000. Pasangan OTK itu ter us membuntuti saya hingga ke toko membeli rokok, ingatan saya hilang total terkena hipnotis pa-sangan OTK dan barang dagangan rokok yang sudah lunas dibayar dibawa

kabur pasangan OTK, papar Rajini. Menurut beberapa saksi mata tetangga Rajini pasangan OTK saat turun dari beca masuk ke warung Baksi milik Rajini berbicara bahasa daerah Gayo. Kapolsek Jeumpa Iptu PM Kataren yang mendapat laporan itu sudah menurunkan anggotanya untuk memburu pasangan OTK pelakunya yang sudah diketahui wajahnya terekam di layar monitor saat masuk di PN Pegadaian. (b16)

Rileks

A4 Banyolan Ikan Paus Di sebuah kapal penumpang, terdapat 2 orang pemuda. Sebut saja nama mereka Jono dan Joni. Mereka berasal dari 2 daerah. Jono dari Madura sedangkan Joni dari Minahasa. Selama perjalanan mereka terjadi percakapan.... Jono :”Joni, di daerahku ada seekor ikan paus yang gedenya seperti kapal yang kita naiki ini” Joni : “Ah masa.... Sih”. Jono : : “Iya, memang....”. Joni : “Kalau di daerahku lain. Ada sebuah kuali yang besarnya seperti lapangan”. Jono : “Ah, yang benar saja!” Joni : “Ya iyalah….!” Jono : “Gunanya apa sih kuali segede itu di daerahmu?” Joni : “Untuk masak ikan pausmu. Bikin masakan paus rica-rica, tau!” Jono : ?!??&%??!??&!??$%???!

Ibu Mertua & Menantu Alkisah ibu mertua yang bawel, judes dan menyebalkan mempunyai 3 orang menantu dari ke-3 orang putrinya yang cantik-cantik. Sang ibu mertua ingin tahu apakah ketiga menantunya itu sayang juga kepada mertuanya atau cuma kepada putrinya saja. Dia lalu memutuskan menguji mereka secara bergantian. Suatu hari dia mengajak menantu pertama naik perahu motor ke tengah laut. Di sana dia sengaja menjatuhkan dirinya dari perahu terlempar ke dalam air laut. Sang menantu tanpa pikir panjang langsung terjun menyelamatkan ibu mertuanya. Besoknya ketika keluar rumah, sang menantu pertama melihat mobil TOYOTA KIJANG terparkir di depan rumah, secarik kertas bertulisan “Dari ibu mertuamu”.

Minggu 17 April 2011

Anak Kecil

Giliran menantu ke-2 yang diajak ke tengah laut. Sekali lagi sang mertua pura-pura terjatuh terlempar keluar perahu (Karena info yang pertama bocor) Menantu kedua ini pun purapura respect melupakan pakaian & dompetnya, langsung terjun demi menyelamatkan mertua tercinta. Besoknya di depan rumah menantu ke-2 terparkir TOYOTA ALTIS, disertai kertas bertuliskan “Dari ibu mertuamu” Ketika giliran menantu ke-3 diajak ke tengah laut, sang mertua kembali melakukan gerakan terjun bebas. Tapi sial, kali ini sang menantu malah berkecak pinggang memandangi ibu mertuanya yang megap-megap di dalam air. Sempat-sempatnya dia berkata, “Rasain kamu!”, (padahal dia tahu lho info dua orang saudara iparnya itu), sambil berputar membawa perahunya ke darat. Besok harinya ketika menantu ini keluar rumah, di depan rumahnya terparkir MERCEDES-BENZ S-600 terbaru lengkap dengan velg Brabus 20" beserta kertas bertuliskan, “Terima kasih, Dari: AYAH MERTUA...”

Pada suatu hari di sebuah Sekolah Dasar, waktu itu jam istirahat dan terlihat di halaman sekolah tersebut seorang anak kecil menangis dengan kerasnya. Lalu bertanyalah salah seorang gurunya.... Guru : “Nak...kenapa nangis?” Anak : “Uang saya hilang seratus perak bu…” Jawabnya sambil nangis Guru : “Ya udah sekarang diem ya…, nih ibu

kasih seratus” Tapi anak kecil tersebut malah nangis makin kenceng. Gurunya pun bertanya Guru : “Lho...kok nangisnya makin kenceng, kan udah ibu ganti seratus” Anak : “Iya bu…, tapi kalau tadi uangnya gak hilang, kan sekarang uang saya ada dua ratus” Guru : ??!!?%!#??!)$?!

TTS BERHADIAH

07.00 Daripada Mandi 08:00 Dora Emon 08.30 DAHSYAT 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Penyegaran Rohani Agama Kristen 13.00 Spongebob 15:00 Si Kriwil 17:00 Seputar Indonesia 17.30 Silet 18:30 Putri Yang Ditukar 20.15 Mega Sinetron : Anugerah 22.30 Box Office Movie Platinum Max Payne

07:00 Bimbingan Rohani 07.30 Disney Club 08.00 Tom & Jerry 09.00 Upin & Ipin 10.00 Grebek Nusantara 11:30 Sidik Kasus 12:00 Layar Kemilau 13.30 Cerita Siang 15:00 Indahnya Sore 16:00 Lintas Petang 16.30 Zona Juara 18.00 Sinema Spesial 19.30 Animasi Spesial 20.30 Sinema Utama Keluarga 22.00 Sinema Pilihan 23.30 Cerita Pilihan

Anak Yatim ?”

WASPADA

Faqih : “Eh, Bert! Mana kalimat yang benar

A. Anak Yatim itu dipukuli ayahnya. B. Anak yatim itu dipukulkan ayahnya. Albert : “Pasti . . . Anak yatim itu dipukuli ayahnya dong!!!” Faqih : “Salah!!”. albert : “Apanya yang salah?! Faqih : “Nggak ada yang bener, anak yatim mana punya ayah?!. Albert : ??!!?%?@#?$%!#?@??!

07:00 Inbox 09:00 Hot Shot 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Hip Hip Hura 17:00 Liputan 6 Petang 17:30 Uya Emang Kuya 18:00 Islam KTP 21.00 Pesantren & Rock n Roll 22:30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07.00 Morning Shock 08.00 Captain Tsubasa 08.30 Foody With Rudy 09.00 Mom Dad And I 10.30 Smart Mommy 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Kilau Emas 15.00 Djarum Super Indonesia 17.00 Topik Petang 18.35 Djarum Indonesia Super League 21.00 Penghuni Terakhir 22.00 Sinema Spesial 00.00 Topik Malam

Nama: ..................................................

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Gunakan pensil dan penghapus pada awal pencarian angka pengisi kotak, sebelum menuliskan angka yang benar dengan pulpen. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp. 50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jalan Brigjen Katamso 1 Medan paling lambat Jumat. Peserta dari luar kota bisa mengirimnya melalui faksimile ke (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu depan (24/4). ------------------------------------------- potong di sini ----------------------------------------------

S U DO K U P L US

5

A

3 0 4

0 3 9 8 B 4

4

5 3 B

1

3 A 4 5 8 2 4 B 9 7 0 7 A 8 6 1 B 9 6 6 2 8 1 A 9 4 9 1 5 2 A 9 6 A B 4 7 6 A 3 9 7 1 9 5 2 0 B

***09

Nama

:

.......................................................

Alamat

:

....................................................... ....................................................... Kode Pos . . . . . . . . .

No. KTP/SIM : . . . . . . . . . . . . . . . . . --------------------------------------------- potong di sini --------------------------------------------

Alamat: ................................................ No. KTP/SIM/Kartu Pelajar: ..............................

gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 22 April 2011, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 24 April 2011 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan. MENDATAR

MENURUN

1. Benda tajam berbentuk bulan sabit 5. Cepat 9. International Council of Reflexologists 10. Menunggu giliran 13. Sudut pandang 16. Tidak senang 18. Daftar pembetulan kesalahan yang terdapat di dalam buku yang sudah tercetak 20. Pancing 22. Kubis 23. Mawar 24. Lebihan 26. Masukan 29. Mengerjakan sesuatu supaya menjadi lain atau menjadi lebih sempurna 32. Suku 34. Orang yang melihat atau mengetahui sendiri suatu peristiwa 36. Kasihan 37. Nama universitas yang merupakan perguruan tinggi negeri di Bali 38. Matahari

1. Jalan (aturan, sistem) melakukan; gaya 2. Pekan, lekat sekali, tanah lempung 3. Tikus (Inggris) 4. Tingkat; deretan (Inggris) 5. Kuat sehingga tidak muda lepas 6. Makanan berkuah bercampur sayur dan daging 7. Duga 8. Apes 11. Lezat, enak 12. Hubungan; pertalian; kenalan 14. Peralatan; media; perlengkapan 15. Mempublikasikan ke media 17. Beras yang sudah dimasak 19. Rukun; damai 21. Mengeja (Arab) 24. Alat untuk membersihkan sampah 25. Pemakaian sesuatu dengan membayar uang 27. Benua terbesar yang berpopulasi terbesar di dunia 28. Nama buah dan rasanya sama 30. Perserikatan antara beberapa negara 31. Waktu dari pagi hingga pagi lagi 33. National Basketball Association 35. Korupsi Kolusi Nepotisme

Pemenang Sudoku Berhadia Minggu Lalu Maiya Nst, Jl. Melati Helvetia

2 4 6 5 7 8

A 9 7 2 4 0

8 5 3 1 6 B

6 8 2 3 A 0 3 5 B 1 0 9

3 1 7 4 0 9 5

A 0 B 6 7 2 3

9 4 5 8 1 B A

B 7 A 0 6 4 8

2 8 9 1 5 3 B 4 6 1 7 9 A 2

06.30 Apa Kabar Indonesia 09.00 World Boxing Erik Morels vs Marcos Maldana 12.00 Kabar Siang 13.00 Damai Indonesiaku 15.00 Volley Proliga 17.00 Kabar Petang 19.00 Bukan Jalan Jalan Biasa 20.00 Apa Kabar Indonesia Malam 21.00 Nostalgia 22.00 Document One 22.50 Liga Spanyol ( Live )

07.30 Harmoni Alam 08.00 Jelajah 08.30 Celebrity On Vacation 09.00 Ceriwis 10.00 Ala Chef 11.00 Insert 12.00 Bosan Jadi Pegawai 12.30 Ngulik 13.00 Peppy The Xplorer 13.30 Belajar Indonesia 14.00 Bioskop Keluarga 16.00 John Pantau 17.00 Reportase Minggu 18.15 Termehek Mehek 19:00 Bioskop TRANS TV 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.00 Sinema Dinihari

Pemenang TTS Berhadiah Minggu Lalu Dina Irmayanti Harahap,Komp PTPN IV-Link VI Martubung

JAWABAN MINGGU LALU B 1 A 6 7 0 2 4 5 3 8 9 0 5 4 7 9 8 B 3 A 2 1 6 9 3 2 8 1 5 A 6 B 4 7 0 3 8 7 5 B 1 9 0 2 A 6 4 A 6 9 2 4 7 5 8 3 B 0 1 1 B 0 4 A 6 3 2 9 8 5 7

07.30 Metal Fighr Beyblade 08.00 Pokemon 08.30 Ben 10 Alien Force 09.00 Power Rangers Jungle Fury 09.30 Dragon Ball 10.00 Arti Sahabat 12.00 FTV Siang 14.00 KiSS Minggu 15.00 Liga Premier Indonesia 17.00 Cintaku Melati 18.00 Dia Anakku 19.00 Nada CInta 20.00 Cinta Fitri 21.00 Antara Cinta Dan Dusta 23.00 Sinema Sinema 01.00 Fokus Malam

07.05 Dunia Kita 08.30 Agung Sedayu 09.30 Agung Sedayu 10.05 Showbizz 11.05 Oprah Winfrey 13.30 e Lifestyle 14.05 Rachael Ray Show 15.30 Kick Andy 16.05 Kick Andy 17.05 Metro Hari Ini 18.30 Metro This Week 19.05 Mario Teguh 20.05 Just Alvin! 21.05 Democrazy 22.05 Zona Memori 23.05 Journalist on Duty 23.30 Metro Sports

TRANS 7 07.30 U2 08.00 Tabir Sunnah 09.30 Masked Rider 10.30 Jalan Jalan Selebriti 11.00 Asli Enak 11.30 Redaksi Siang 12.00 Selebrita 13.30 Galeri Sepakbola 14.00 One Stop Football 15.00 Mancing Mania 16.30 Redaksi Sore 17.00 Paradiso 18.30 Wara Wiri 19.00 Gara gara Magic 21.00 Pas Mantab 22.00Mister Tukul 23.00 Kualifikasi MotoGP

08.00 Avatar 09.30 Mong 10.00 Mee Shee : Water Giant 12.00 Awas Ada Sule 13.00 Petualangan Panji 13.30 Teenlicious 14.00 Saat Teduh 14.30 Jelang Balap Formula 15.00 F1 Racing 17.00 Spongebob 18.00 Super Hero Kocak 19:00The Seeker 21.30 Barclays Premier League **m31/G

Medan Metropolitan

WASPADA Minggu 17 April 2011

Ansor Sumut Desak Mabes Polri Ungkap Motif Bom Bunuh Diri MEDAN (Waspada): PimpinanWilayah Gerakan Pemuda Ansor Sumatra Utara, mengutuk keras aksi bom bunuh diri di Masjid Mapolresta Kota Cire-

bon yang terjadi pada saat melaksanakan Sholat Jumat . “Kita mendesak agar Mabes Polri untuk mencari otak pelaku pengeboman dan motif yang

dilakukan dibalik peristiwa tersebut,” tegas Ketua Pimpinan Wilayah (PW) Gerakan Pemuda (GP) Ansor Sumut, Fadly Yasir kepada wartawan di kantornya,

Jumat (15/4). Fadli juga mengimbau kepada Ummat Muslim agar tidak terpancing dengan aksi bom bunuh diri yang terjadi di

500 Peserta Ikuti Festival Kreasi Seni Islam Harlah GP Ansor MEDAN (Waspada): Sedikitnya 500 peserta dipastikan mengikuti Festival Kreasi Seni Islam dalam rangka Harlah ke77 GP Ansor yang dilaksanakan di Istana Maimun, 22-24 April 2011. Kegiatan yang diperlombakan diantaranya Sholawat Badar, Kaligrafi Dekorasi, Marhaban, Baca Kitab Kuning, Mewarnai, Karya Tulis dengan tema Peran GP Ansor dalam pembangunan bangsa, Korelasi GP Ansor dari zaman ke zaman dan Pemuda sebuah harapan dan

1 CM 2 CM

Rp. 12.000 Rp. 24.000

tantangan. Hal ini disampaikan Ketua PW GP Ansor Sumut Fadli Yasir dan pengurus lainnya termasuk Ketua Panitia Harlah ke 77 GP Ansor PW GP Ansor Sumut Rusli AS didampingi Sekretaris Suwardi, Bendahara Dermawan Arfa, kepada wartawan di Sekretariat PW GP Ansor Sumut, Jalan Pelita VI No 33 A, Medan, Jumat (15/4) sore. “Kegiatan perlombaan yang dilakukan tidak sebatas acara seremonial belaka, akan tetapi bagaimana pemahaman terha-

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

PENDIDIKAN

5 CM 6 CM

JUAL SALAH SATU

Isuzu Panther High Grade Biru 95. BK Panjang, jok baru, remote, tape CD Kenwood, Siap pakai. Harga 65Jt/Nego. Isuzu Panther Grand Deluxe 95 Merah, P. Window. P. Steering, Alarm, jok, siap pakai. Hrg. 63/Jt Nego. Hub. 0812 6568 818 / 7730 5875

TOYOTA KIjang LSX Thn 2002 Warna Biru Mika Cat Orisinal, BK Medan sangat muls, Siap pakai, Jual cepat Hub. 0853.6090.7841 TOYOTA Kijang Kapsul LGX 1.8 EFi Bensin Thn 2000 W. Coklat Silver, AC double, Tape, CD, DVD, Power Subwofer, Spion Miror, PR, BR, CL, Remot, Mulus, Siap pakai dijual cepat B.U Hub HP. 0852.7618.0616 Mdn

DIJUAL CEPAT

TOYOTA Kijang Extra Th. 95 W. Hitam met, AC, Tape, V. Racing. Mobil cantik, T. Pakai. Pajak 1 Th. Hrg. 70Jt Nego. Peminat Langsung Hub. 061-734 8522

TOYOTA Kijang Super G Thn. 1994 Dijual. BK Asli Medan, 2 angka, warna abu2 mulus cantik. Harga Rp. 63,5Nego. AC, Tape, Velg Racing 15”. Hub. HP. 0812 6385 693 An. SYAHRUL TOYOTA Kijang Krista Silver 00-01. Desember BK panjang, Asli Medan, Asuransi All Risk & TLO, Body kaleng. Model 2004 semua, mulus luar dalam, alarm, DVD, Jok siap pakai. Lihat dulu baru tawar. Harga 127/Nego. Hub. 0812 6568 818 / 7730 5875

BURSA

SEPEDA MOTOR

HONDA ASTREA GRAND DIJUAL 2011 Start Belajar: 25 April 201 1

Thn ‘97, H. 3,5 Jt/ Net Hub. 0813.7027.7106

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

2011 Start Belajar: 25 April 201 1

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIKONTRAKKAN (3 Kmr + 1 Kmr Pembantu) di Komp. Citra Wista Blok VII/ 42 Jl. Karya Wisata - Medan Johor Hub. 0813.2121.2224 - (061) 9128.2984

DISEWAKAN

Mau Lulus UN 2011....!!!

Klik website:www.bima.net

Mau Lulus CPNS 2011..!!

Klik Website: www.bima.net BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

Dapatkan Nissan Ready Stock Plus cash back menarik. Grand Livina, X Trail, March, Serena DP 10 %. Kredit hingga 5 tahun. Hub. ICHSAN 0852 9693 2711

HYUNDAI Trajet Tahun 2000. Silver metalic. Mobil sehat, siap pakai. BK Panjang Medan. Asli Jual cepat. HP. 0813 7094 4002 / 7760 1080

DAIHATSU Espass 2002 warna biru. Hub. HP. 0852 2653 6417 dan 061.8960799 Harga Nego.

Rumah Tinggal, Di Villa Mutiara Blok i No. 4, Gedung Johor Medan (Depan Taman) HP. 0813.9714.3333 RUMAH DIJUAL

1 unit Rumah/ Toko: 1 Ruangan usaha, 2 Km TIdur, 1 R. makan/ TV, 1 R. dapur, 1 Kamar mandi, Luas Bangunan 4½x21m, Luas Tanah 4,90x39m alamat Jl. Psr. VII No. 12-14B Tembung depan Kusuk Refeleksi Famili, Hrg Rp. 500 Jt/nego Hub. 0813.9706.0654 - 0821.6073.8581

RUMAH DIJUAL (B.U) Luas Tanah 854m², Ukuran bangunan ±400m², 2 Lantai, 9 Kamar, 8 Kamar mandi,Garasi,SHM Jl. Tuba I No. 21AA Harga nego Hub. (061) 5022.0868 - 0888.732.4404

RUMAH PERMANEN DIJUAL

Komplek Surya Regency Blok C No. 13, Jl. Persatuan Helvetia Timur, Type 75/ 120m² FASILITAS: 1 K a m a r Ta m u , 1 R u a n g keluarga, 1 Dapur, 1 Ruang makan, 3 Kamar Tidur, 2 Kamar Mandi HARGA NEGO Hub. 0852.6030.0420

syarakat. Begitu juga perlomba mewarnai untuk tingkat TK/RA/ PAUD, peminatnya cukup banyak,” jelas fadliYasir sambil menambahkan acara dibuka Ketum PP GP Ansor Nusron Wahid. Pengumuman pemenang akan dilaksanakan pada acara puncak Peringatan Harlah ke 77 GP Ansor PW GP Ansor Sumut di Istana Maimun, 24 April 2011 dengan total hadiah mencapai Rp40 juta. Masing-masing pemenang I-VI akan mendapatkan hadiah berupa tropi, tabanas dan sertifikat. (m39)

Sumur Biorpori Mengurangi Pemanasan Global

dalam Masjid Mapolresta Cirebon. “Islam tak pernah mengajarkantindakankekerasanseperti ini. Islam cinta perdamaian. Mudah-mudahan dengan kejadian ini tetap meningkatkan silaturahmi,” tegasnya. Menurutnya, akibat adanya aksi bom bunuh diri tersebut, jelas memberikan akses negatif terhadap kekondusifan yang terjalin selama ini. Karena aksi teror bom ini jelas memicu ketakutan pada masyarakat luas. Kepada wartawan, Fadli juga meminta agar seluruh komponen masyarakat untuk bersatu melawan aksi terror yang dinilai sudah melewati batas ambang prikemanusian. Ditegaskannya, bahwa siapapun pelaku yang melakukan itu adalah orang yang kurang pemahaman tentang kedamaian, persaudaraan dan persahabatan. (m39)

MEDAN (Waspada): Ahli geologi Ir Gagarin Sembiring mengatakan, manfaat sumur biorpori dapat mengurangi pemanasan global /tidak cepat mengemisikan gas rumah kaca ke atmosfer dan menghindari penyakit yang diakibatkan oleh genangan air (malaria, demam berdarah dan kaki gajah). “Selain itu, sumur biorpori membuat lingkungan menjadi nyaman, lestari serta menjadi ajang pengembangan agribisnis perkotaan,” jelas Ir Gagarin Sembiring yang juga Ketua Ikatan Ahli Geologi Indonesia (IAGI) Sumut saat mema-parkan makalahnya Menjaga Air Tanah Dengan Memanen Air Hujan pada seminar Earth DayProtecting Our Environment, Selamatkan lingkungan hidup yang digelar Lions Club Medan Cinta Alam, Distrik 307 A-2 bekerja sama dengan Sekolah Alam Bukit Hijau, Sabtu (16/4) di Desa Laucih Kecamatan Medan Tuntungan. Seminar bertemakan: Satu Hati Selamatkan Rumah Kita-Bumi. Dijelaskan Gagarin Sembiring, sumur-sumur biorpori hanya berupa lubang atau rongga lurus dengan diameter 10 cm hingga 20 cm dengan kedalaman 1 meter hingga 2 meter yang dibuat dengan alat bor khusus. Lubang sumur -sumur mini ini dibuatkan begitu tapi bisa difungsikan rutin sebagai tempat pembuangan sampah organik rumah tangga atau kantor. Menurut Gagarin Sembiring, reaksi pembusukan organik dalam sumur atau lubang itu akan memunculkan sejumlah hewan tanah

WASPADA

Rp. 65.000 Rp. 78.000

DIJUAL SALAH SATU 1.Isuzu Panther Bravo Cruiser Thn. 94 2.Isuzu Panther Miyabi Thn. 94 Sudah P. Steering, P. Window, C. Lock, Alarm, AC, V. Racing, Cat 2 warna. H. 45Jt. Per unit. 3. Toyota Corolla GL Thn. 84. 1300cc. AC, V. Resing. H. 17 Jt. Hub. Bu Hajjah HP. 061-7624 7369 - 0852 9641 9220 (maaf sms TP)

Start Belajar: 25 April 201 1 2011

dap islam itu sendiri. Sebab di zaman era globalisasi ini, diperlukan adanya meningkatkan keimanan sehingga tidak terpengaruh dengan adanya upaya yang menyesatkan,” jelasnya. Fadli juga sangat berterimakasih atas antusias masyarakat dalam memeriahkan acara dengan mengikuti perlombaan sembari belajar tentang Islam. “Kegiatan yang diprioritaskan membaca kitab kuning untuk umum diikuti dosen dari IAIN dan UMSU. Marhaban juga dapat antusias dari ma-

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

A5

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

KIOS/ RUKO

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

BURSA

M. Fair Plaza, Lt. 1/ 70, Strategis, damai Jl. Abdullah Lbs M. Baru, SHM, Permanen, Nego Call. 0819.827.459

seperti cacing atau ulat tanah yang berkembang biak dalam tanah dan menambah pori-pori tanah. Pori-pori tanah sebagai biorpori inilah yang akan berfungsi sebagai alat penyerap air yang melimpah ke permukaan. “Sehingga secara makro akan mengurangi luapan air di permukaan dan akan mengurangi volume banjir,” beber Sembiring seraya menambahkan pihaknya sudah melakukan uji coba pembuatan sumur-sumur biorpori di sekitar kompleks Sekolah Alam Bukit Hijau Gardenia di Desa Laucih, Kecamatan Medan Tuntungan. Sebelumnya, Gubernur Distrik 307 A2 Lions Club Indonesia Drs. Tarman Hartono, SE, MM yang membuka seminar tersebut menyatakan usia bumi kita semakin tua sehingga pencemaran lingkungan harus segera dicegah dan saatnya kita menyelamatkan bumi sehingga ekosistem tetap terjaga. “Bila kita galakkan gerakkan cinta lingkungan hidup maka bumi ini bisa kita selamatkan dari kerusakan eksosistem,” jelas Tarman Hartono. Sementara itu, ketua panitia seminar Dr Eva Sembiring mengatakan, seminar tersebut bertujuan memunculkan inisiatif sendiri dari masyarakat untuk mengenali serta memecahkan masalah sehingga tercipta kerjasama yang baik diantara masyarakat dalam meningkatkan partisipasi pelestarian lingkungan hidup melalui pembuatan sumur biorpori. (h04)

BURSA

BURSA

LOWONGAN

GENERATOR

RUMAH PERMANEN DIJUAL

DIBUTUHKAN

DIBUTUHKAN

Jl. Karya Gg. Suka Damai No. 3 Kel. Sei Agul PxL: 12,5x63,5, 5 Kamar Tidur, 4 Kmr mandi, Hrg nego Hub. 0821.6615.9665

LOWONGAN

Tenaga kerja yang berpengalaman bidang Reperasi Kursi Tamu dan membuat baru Hub Telp. 734.2493 HP. 0813.7015.2844

Tenaga kerja yang berpengalaman bidang Reperasi Kursi Tamu dan membuat baru Hub Telp. 734.2493 HP. 0813.7015.2844

RUMAH DIJUAL CEPAT

Harga nego (Ukuran 8x55m), Hubungi langsung: 0812.6317.508 / 0813.7674.2374 Jl. Sei Mencirim No. 15 Sunggal (Sebelum Simpang Lowok)

DISEWAKAN

Satu pintu Rumah Kopel Permanen 2 (dua) Kamar Tidur, Ruang Tamu, Ruang Dapur, Kamar Mandi, Ada Air Pompa, Listrik Alamat Jl. Bustamam Gg. Wijaya Asri Psr. X Bdr. Khalifah masuk mobil Hubungi Telp. 4148650 HP. 0813.6224.1512

RUMAH DIJUAL

GR, KM 3, KT 3, Ruang sholat, LB. 9x15,5m LT. 10x30m, Psr. 1 Marelan HP. 0812.649.7447

RUMAH DIKONTRAKKAN

Bisa utk kantor di Jl. Sakti Lubis Gg. Bengkel No. 7, Kp. Baru, KT 4, Grasi bisa 2 mobil Hub. 0852.7542.4775

180 JUTA/ NEGO

Rumah siap huni 1½ Tkt,SHM, Uk. 6x14m, Permanen, PLN, Air PDAM, Lt. Keramik, 3 Kmr Tidur, Jl. Laksana Lorong 17 No. 6 (depan Gd. Adat IKGS) HP. 0852.7782.9960

TANAH DIJUAL

Sawah Luas 44,36 Rante (Darat ±2 Rante) di Psr. Katib Darus - Gebang (dkt Tj. Pura), Hrg 8 Jt/rante Hub. 0813.7078.4600 (Lsg. pemilik)

TANAH DIJUAL

I. Ukuran: 10x18m II. Ukuran: 11,5x18,5m 15 meter dari Aspal/ Pajak, SK Camat Harga 22 Jt/ persil Jl. Turi Sei Mencirim Sunggal Hub. H. Raja Doli Srg 0815.308.6463

TANAH DIJUAL CEPAT DI MEDAN KOTA

- Ukuran: 10x19m, SK Camat, Jalan 4,5M - Lokasi: Jl. Saudara Gg. Kelapa VII (depan Hotel Grand Antares SM. Raja) (3 menit dari UISU) - 1 Gang 12 Rumah sudah berdiri, Tinggal 3 Tanah yg belum bangun - Harga: 130 Jt/nego Hub. 0813.7655.8095 / 786.9530 (Serianan Hsb)

BURSA

PELUANG BISNIS HANYA 15 JT

BISA BUKA LOUNDRY KILOAN + DIAJARKAN DRYCLEAN HP. 0852.6298.7114 KAMI TERMURAH & PROFESIONAL DI DUNIA

BURSA

PENGIRIMAN KIRIM BARANG PINDAH &MOBIL

Door to Door Domestik & Int’l.SRT-MOVING, Tel. (061) 7711.8811 Jl. B. Katamso 557 Medan, www.srt.co.id - Ritra Group

BURSA

KOMPUTER

UMROH MULTAZAM 1. UMROH 9HR, 13 HR 02, 09 MEI 2. UMROH PLUS MESIR 15 MEI 3. UMROH PLUS TURKEY 27 JUNI 4. UMROH PLUS AQSHO 10 JUNI 5. UMROH RAMADHAN 1 BULAN 10HR AWAL, PERTENGAHAN AKHIR 6. HAJI KHUSUS 2012 Rp. 61.000.000 7. MANASIK HAJI SETIAP SABTU, MINGGU DIBIMBING USTADZ BERPENGALAMAN

HUB: JL. TITIPAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. (061) 457.6116 - 451.2319 0813.6137.2321 - 0812.6495.8456

HILANG/ TERCECER

1 Surat Jual Beli Rumah dari Tuan Mohammad Sjarif Nasution Kepada Tuan Oesman Nasution, berdasarkan Akte Tgl. 18-12-1963, No. 59 yang diperbuat Notaris Marah Sutan Nasution

TELAH HILANG

1 (satu) Surat Pernyataan Melepaskan Hak Atas Tanah SK Camat No. 593.83/ 1030/2007 Tanggal 02 Mei 2007 Atas nama Syaiful Iskandar, yang terletak di Jl. Klambir Lima Gg. Amal Dusun V Desa Tanjung Gusta Kec. Sunggal Kab. Deli Serdang

HILANG/ TERCECER

1 (satu) Asli Sertifikat Tanah Hak Guna Bangunan No. 451, Tercatat Atas Nama Hj. Mursida Syazli, bagi siapa yang menemukan harap hubungi ke Telp. (061) 735.7101 HP. 0852.6131.9644

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda BURSA

KESEHATAN

ANDA BERMINAT MEMBUAT PRODUK

Kebutuhan rumah tangga Spt: Spt deterjen, sabun cuci piring, sabun cuci tangan, pel lantai, dll, ikuti presentasiCV, mega, lintas nusa Yang serius hubungi: 0812.279.7395 - 0856.4334.5336 Waktu dan tempat akan kami SMS ke Anda !!!

6 THN AHLI TOTOK SYARAF DAN KEBATHINAN

Urat syaraf terjepit 2 s/d 3x trapi, Nyeri lutut 1 s/d 2x terapi, 200 Rb/ trapi tanpa alat, kanker payudara baru/ lama dgn jamu (±3 bln Insya sembuh), pengalaman dalam dan luar negeri, Terapi dirumah Pak Hery 0852.6114.7129

KUSUK & LULUR

MBAK ALIN

WASPADA

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

TERAPI VITALITAS PRIA

Jadikan Pria Jadi Idaman Para Wanita

Harian

Centrino 1,5 GHZ HD 60 GB MM. 512 CDRW. 15” Harga 1.6 Jt Mobil Holden Camira 83 Harga 13 Jt/Nego. Hub. 0813 971 94182 / 7701 9954

* Melayani berbagai macam keluhan penyakit antara lain: - Tambah ukuran >P anjang : 13 - 15 - 17 - 19 - 21 cm Panjang > Diameter : 3,5 - 4 - 4,5 - 5,5 - 6cm - Kuat keras tahan lama - Impotensi total - Mani encer, ejakulasi dini - Lemah syahwat - Kurang perkasa, diabetes dll * Juga Melayani: Pelaris, pemanis, pasang susuk, buka aura ketampanan, kecantikan kewibawaan, kharisma, ingin cepat dapat jodoh, disegani atasan, menaklukkan lawan jenis dll * Bergaransi, hasil permanen, alami tanpa efek samping bebas untuk semua agama, jg bebas pantangan Alamat Praktek:

Jl. SM. Raja Gg. Mengkudu No. 1 depan Toko Cemerlang HP. 0821.6120.9323

BURSA

TERCECER

CALL CENTER: (021) 9862000 0878 8200 0020

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

KLINIK

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

ANDA GAGAL DITEMPAT LAIN...???

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN

-

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

H. UST. YUSUF/ M. DADAN

MENGOBATI PRIA

Satu sertifikat Hak MIlik Tanah No. 222, Kelurahan Pasar Merah Timur, A/n. Hj. Kesuma Iriani Hasibuan, yang terletak di Jl. Halat Gg. Wakaf No. 18 Medan. Bagi yang menemukan dapat menghubungi (061) 7797.5090

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

HILANG/TERCECER

TELAH TERCECER

BPK. ABDUL JAELANI

A.H. AMRIL ZAENAL

NEC VERSA PS20

Surat Penyerahan Hibah Tanah An. MUSNI. Dan Grant Sultan No. 705. Hub. 0813 9724 3465

HADIR DI KISARAN

TERAPI KEJANTANAN ALAT VITAL PRIA PALING SPEKTAKULER DARI BANTEN SELATAN Ditangani langsung:

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA GG. BAJA III NO. 4D MEDAN SAMPING STASIUN BUS MEDAN JAYA HP: 0812.6350.4441

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100%

Alamat praktek: Jl. Amaliun Gg. Santun No. 11 HP. 0821.6655.3222 - 0821.6655.1222

PUSAT PENGOBATAN SPESIAL ALAT VITAL

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

DITANGANI LANGSUNG

BPK. HARYONO

ASLI DARI BANTEN IZIN DINKES 448/503/III/2008

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI

Popular

WASPADA Minggu 17 April 2011

Ilmuwan Temukan Cara Petakan Rumitnya Jaringan Otak

Salah satu alat untuk petakan otak yang pernah ada.

SEJUMLAH ilmuwan mengatakan, mereka telah melangkah lebih dekat untuk mengembangkan model komputer yang memetakan otak setelah menemukan cara untuk memetakan koneksi dan fungsi sel syaraf di dalam otak secara bersamaan untuk pertama kalinya.

Dalam satu penelitian di jurnal Nature, para peneliti dari Universitas Akademi London (UCL) Inggeris menggambarkan teknik yang dikembangkan pada tikus yang memungkinkan mereka mengkombinasikan informasi tentang fungsi syaraf dengan keterangan rinci koneksinya. Penelitian tersebut bagian dari munculnya penelitian bagian neurosains yang dikenal sebagai ‘connectomics’. Sedikit mirip genomics, yang meme-

takan pembentukan gen kita, connectomics bertujuan memetakan koneksi otak, yang dikenal sebagai sinapsis. Dengan mengurai dan mampu memetakan hubungan-hubungan syaraf ini – dan menafsirkan bagaimana informasi dikirimkan lewat sirkuit otak – para ilmuwan berharap bisa memahami bagaimana proses pemikiran dan persepsi bisa dilakukan dalam otak dan bagaimana fungsi-fungsi ini bisa rusak

bila seseorang menderita penyakit seperti Alzheimer, Schizophrenia dan Stroke. “Kami mulai berhasil mengurai kerumitan yang terjadi di dalam otak,” kata Tom Mrsic-Flogel, yang memimpin penelitian itu. “Setelah kami memahami fungsi dan konektivitas sel syaraf, mencakup lapisan otak yang berbeda, kami mulai bisa mengembangkan simulasi komputer tentang bagaimana organ penting ini bekerja.” Namun dia mengatakan, masih dibutuhkan waktu beberapa tahun lagi bagi para ilmuwan dan proses kmputer besar-besaran sebelum pemetaan itu bisa dilakukan. Dalam satu laporan tentang penelitiannya, Mrsic-Flogel, menjelaskan bagaiama pemetaan koneksi otak itu bukan lah langkah kecil: Ada sekitar seratus miliar sel syaraf, atau syaraf, di dalam otak manusia, setiap sel ini terhubung ke ribuan sel syaraf lainnya, katanya, sehingga terjadilah 150 triliun sinapsis. “Bagaimana kita menggambarkan cara kerja sirkuit syaraf otak? Yang terlebih dulu dilakukan adalah memahami fungsi setiap syaraf dan mengetahui ke sel otak mana syaraf itu terhubung,” katanya. Dalam penelitian ini, tim pimpinan Mrsic-Flogel memusatkan perhatian pada penglihatan manusia dan memperhatikan korteks penglihatan otak tikus, yang berisi ribuan syaraf dan jutaan ko-

neksi yang berbeda. Dengan menggunakan penggambaran ber-resolusi tinggi, mereka mampu mendeteksi syaraf mana yang merespon stimulus tertentu. Dengan mengambil sehelai tisu, para ilmuwan kemudian mengaplikasikan arus kecil ke jaringan syaraf untuk melihat syaraf mana yang merespon dan yang mana di antara syaraf itu terhubung secara sinapsis. Dengan mengulang teknik ini beberapa kali, mereka mampu merekam fungsi dan konektivitas ratusan sel syaraf dalam korteks penglihatan. Dengan menggunakan metode ini, tim tersebut berharap bisa memulai menghasilkan diagram wayar otak dengan fungsi tertentu, seperti korteks penglihatan. Teknik tersebut juga akan membantu mereka memetakan jaringan yang mengatur sentuhan, pendengaran dan gerakan. John Williams, pemimpin kesehatan neurosains dan mental di Wellcome Trust Medical Charity, yang membantu mendanai penelitian itu, mengatakan memahami cara kerja bagian dalam otak merupakan satu dari ‘tujuan utama’ ilmu sains. “Penelitian penting ini memberikan para ahli neurosains satu kunci penting yang akan membantu mereka memulai menyusuri dan mensurvei otak,” katanya.

nia, perusahaan ini melengkapi lagi versi masa depan iPods dan iPhone untuk bisa memainkan file-file yang berkualitas lebih tinggi lagi. Paul McCartney dapat menguasai album-album musik The Beatles yang ia inginkan. “Namun ketika anda ingin mendengarkan tembang-tembang kelompok musik legendaris itu melalui komputer Dell, suaranya seperti anda menikmati karya The Beatles melalui televisi portabel,” ujar Iovine. Apple menghargai hak cipta untuk mulai menjual katalog the Beatles pada bulan November sebagai retailer digital eksklusif. Apple telah meng-upgrade kulitas katalog musiknya sebelumnya. Pada Januari 2009, iTune Store mulai menawarkan lagu-lagu dalam bit dua kali lebih baik dari standar sebelumnya dan membebaskan potensi tembang Apple telah mengerjakan program dua tahun sebelumnya dengan raksasa musik EMI. Kontrol iTune sekitar 66 persen pembayaran pemasaran download digital. Amazon MP3 dengan 13 persen keuntungan, begitu menurut riset dari group NPD. Apple dan Amazon menolak berkomentar untuk masalah ini. Waki-wakil dari empat industri rekaman juga tidak merespon untuk menanggapi komentar itu. eMusik, satu retailer digital sedang menginvestigasi apakah pelanggan sudi membayar untuk kualitas download musik yang lebih baik lagi, begitu kata Adam Klein, CEO perusahaan itu dalam satu statemen. Situs eMusik baru-baru ini mulai menjual album untuk label musik terkenal termasuk Universal Music Group yang juga bernegosiasi dengan Iovine, eksekutif Universal dan eMusik telah bertemu secara regular untuk mendiskusikan inisiatif mendatang. Sony Network Entertainment meluncurkan servis musiknya yang disebut Music Unlimited Powered by Qriocity di Amerika Serikat dan negara-negara lain. Perusahaan baru itu kepunyaan Sony yang juga memiliki label utama Sony Music Entertaiment. Shawn Layden, kepala bagian operasi Sony Network mengatakan banyak orang tidak peduli jika musik mereka tidak menarik karena menurut mereka ini merupakan sentimen para pengamat industri musik. “Saya tidak ingin melempar isu yang akan menjadi perdebatan, namun yang pasti

Logo Apple tantangan musik saat ini adalah penggemar musik dari seluruh dunia lebih rajin . mengakses musik. Servis musik the Qriocity menayangkan musik 48 kilobits perdetik. Download dari iTune

lima kali lebih berkualitas dan lebih baik. The Qriocity menggunakan metode kompresi terbaru, maka musik terdengar sangat menarik,” tambah Layden. Menawarkan download

kualitas premium dapat membantu retailer seperti iTune menjadi pusat perhatian para penggemar musik berkualitas tinggi. Sebaliknya konsumer cenderung pada sejumlah servis musik yang lagi berkembang seperti Sony’s dan Napster yang menawarkan tembang-tembang dengan bayaran bulanan untuk satu album single. Inisiatif dapat juga melayani penjualan musik digital secara umum. Dari seluruh dunia pendapatan dari download musik sebagaimana penjual CD format 16 bit tidak begitu menggembirakan, begitu menurut laporan industri internasional Federation of Phonographic. Nurhayati Baheramsyah/cnn

SpaceX Buat Roket Murah SPACE Exploration Technologies tengah membuat roket dengan kapasitas angkut dua kali lipat dari pesawat ulang-alik ruang angkasa milik NASA yang juga akan mengurangi biaya peluncuran, kata Kepala Eksekutif perusahaan itu. Roket baru itu, diberinama Falcon Heavy, dibuat berdasarkan roket Falcon 9 produksi perusahaan itu, yang berhasil melakukan dua kali penerbangan dan dibeli NASA untuk mengangkut kargo ke Stasiun Ruang Angkasa Internasional setelah program pesawat ulang alik ruang angkasa NASA berakhir pertengahan tahun ini. Uji terbang Falcon Heavy direncanakan dilakukan tahun 2013 dari Pangkalan Angkatan Udara Vandenberg di California, kata Elon Musk kepada wartawan pada satu konferensi pers yang disiarkan lewat Internet. Falcon Heavy bisa membawa beban seberat 53.071

kilo ke orbit, dua kali lipat dari kapasitas angkuta pesawat ulang alik yang hanya sekitar 22.680 kilogram. Penerbangan itu juga akan dilakukan dari kompleks peluncuran perusahaan itu di Stasiun Angkatan Udara Cape Canaveral di Florida, dan mungkin dari Pusat Ruang Angkasa Kennedy, yang mengumpulkan proposal dari sejumlah perusahaan dan badan yang tertarik dalam mengambil alih landasan peluncur pesawat ulang alik ruang angkasa itu. Program pesawat ulang alik ruang angkasa berakhir setelah dua pesawat terakhir yang masih berfungsi karena tingginya biaya dan untuk menghentikan dana bagi pembuatan roket yang bisa melakukan perjalanan di luar batas ketinggian orbit stasiun ruang angkasa sejauh 354 km. Dengan biaya 100 juta dolar setiap peluncuran, Falcon Heavy akan menyerap biaya setengah dari biaya yang

Inilah situs Internet SpaceX, yang tengah membuat Falcon Heavy, pengganti pesawat ulang-alik ruang angkasa buatan NASA.

Apakah Jepang Terhubung Ke Amerika Utara? HOKKAIDO Lempeng Pasifik

Lempeng Amerika Utara

Sapporo

Lempeng Pasifik menghunjam ke bawah lempeng Amerika Utara di timur Jepang.

HONSHU

Laut Jepang

Pusat gempa

J E PA N G

SHIKOKU

Tokyo

Osaka

Lempeng Amerika Utara

Nagasaki

KYUSHU

Lempeng Eurasia

Lempeng Pasifik

U

Lempeng Filipina

1000 MIL 100 MIL M

Lempeng Amerika Utara ASIA AMERIKA U TA R A

DIPERBESAR DI ATAS

Lempeng Pasifik K AT U L I S T I WA

AU S T R A L I A

Lempeng tektonik

LEMPENG

CINCIN API

A N TA R K T I K A nfoartz.com • Hak cipta © 201

Samudera Pasifik

G

empa dahsyat berkekuatan 9,0 skala Richter yang mengguncang Jepang Maret lalu merupakan peringatan keras tentang betapa dinamisnya planet kita bisa terjadi. Seperti yang selalu diajarkan kepada murid-murid di sekolah, kulit bumi tidaklah menyatu, tetapi seperti kepingan raksasa yang terdiri dari belasan keping yang mengapung dan disebut lempeng tektonik. Lempengan-lempengan itu terus-menerus saling dan bergesekan satu sama lain, menciptakan ribuan peristiwa seismik setiap hari. Hampir semuanya terjadi tanpa terasa, kecuali yang kuat-kuat seperti gempa di Jepang yang disusul tsunami, atau gempa di Haiti pada 2010. Wilayah yang aktivitas tektoniknya paling aktif terletak di sepanjang tepi lempeng Pasifik, lempeng teknonik masif yang meliputi hampir seluruh Samudera Pasifik. Dikenal sebagai “cincin api,” tepi lempeng Pasifik adalah tempat kira-kira 75 persen dari keseluruhan gunung api berada, yang aktif dan yang tidur. Di kawasan itu juga terjadi paling banyak gempa, termasuk 80 persen gempa yang paling kuat. Gempa dan gelombang tsunami yang menghancurkan Jepang terjadi ketika tepi dari lempeng Pasifik masuk ke bawah lempeng Amerika Utara. Ketika kedua lempeng bertubrukan, lempeng Amerika Utara terdorong ke atas, menyisihkan air laut dalam jumlah sanga besar yang menyebabkan munculnya tsunami. Separuh bagian utara Honshu, pulau utama Jepang, dan keseluruhan pulau paling utara Hokkaido berada di lempeng Amerika Utara. Artinya, bila berbicara dari sisi tektonik, Jepang sebenarnya bagian dari Amerika Utara. ew York Ti Times Syndicate

Syafri/reuters

Apple Kerjasama Dengan Industri Musik Perbaiki Kualitas Download Musik APPLE dan retailer musik digital lainnya bekerjasama dengan label-label rekaman untuk mengembangkan dan memperbaiki kualitas file lagu-lagu yang mereka jual selama ini, begitu menurut keterangan para eksekutif yang terlibat dalam perundingan dengan label-label rekaman itu. Akibatnya, toko-toko musik online akhirnya menawarkan tembang-tembang yang bersuara lebih baik daripada rekaman aslinya. Produser musik profesional bekerjasama dengan studio rekaman dalam 24 bit, format audio yang tinggi sebelum merekam yang asli atau ‘master’ dalam istilah industri musik dikenal dalam bentuk CD atau didistribusikan pada pedagang digital macam iTune Apple yang kemudian dikurangi menjadi file musik 16 bit. Kemudian audio dapat meringkas untuk mengurangi tempo musik yang akan didownload atau ditayangkan di internet. Jimmy Iovine, seorang eksekutif musik sekaligus pemimpin label rekaman Univer-sal Music’s InterscopeGeffen A&M kini sedang bekerjasama dengan artis hip hop Dr. Dre yang dijuluki Beats Audio termasuk komputer tablet Touchpad dari HewlettPackard (HP). HP telah menjual satu juta laptop dengan teknologi Beats Audio. Iovine secara ringkas membicarakan topik pengembangan musik kaliber yang ditawarkan servis-servis download selama dua jam konperensi pers Hewlett-Packard ketika merilis Touchpad dan produk lain ke pasaran. “ Kami sekarang kembali ke Universal, kami merubah suara produk kami menjadi 24 bit dan Apple merupakan yang menakjubkan karena beberapa produk industri ini akan mengalami perbaikan. Maka tampaknya kami memiliki kerjasama yang tidak sebentar,” jelas Iovine. HP mengumumkan ponsel baru yang dijuluki Pre 3 tampaknya juga sudah menjajaki kerjasama dengan beberapa industri musik meskipun produk baru HP itu hanya memiliki mono speaker, begitu menurut spesifikasi tehnik HP. Banyak model komputer Mac dapat memainkan suara 24 bit dan program iTune sanggup menangani file-file semacam itu, namun sebahagian besar elektonik portabel dan banyak komputer tidak mendukung audio 24 bit. Untuk membuat lompatan raksasa kualitas musik atraktif lebih tinggi lagi bagi Apple, Cupertino dan Califor-

A6

ditelan roket AS buatan Boeing Co dan Lockheed Martin Corp saat ini. “Saya pikir kami bisa memulai secara realistik memperkirakan misi penerbangan ke Mars, yang membutuhkan kemampuan angkutan yang besar sekali karena Anda harus mengirim pendarat ke Mars yang masih menyimpan pelontar untuk kembali ke Bumi,” kata Musk. “Jika Anda mencoba melakukan misi seperti itu dengan kenderaan yang lebih kecil, maka Anda harus melakukan beberapa kali peluncuran, baik itu untuk mengorbit atau untuk melakukan misi yang lebih lengkap.” Saat ini, biaya untuk mengirim barang ke orbit 10.000 dolar per ponnya. Falcon Heavy akan mengurangi biaya tersebut menjadi hanya sekitar 1.000 dolar per ponnya, kata Musk. “Kami sangat, sangat yakin mampu mempertahankan biaya sebesar itu,” kata Musk, pendiri PayPal dan ketua dan pemimpin eksekutif perusahaan pembuat mobil listrik Tesla Motors. Falcon Heavy, seperti halnya Falcon 9, dirancang untuk memenuhi tuntutan NASA bagi keberadaan kenderaan ruang angkasa bagi manusia, kata Musk. Dia mengatakan perusahaan itu, yang bermarkas di Hawthorne, California, tengah mempersiapkan produksi massal mesin Merlin, yung akan menggerakkan roket Falcon. Syafri/reuters

Google terus melakukan inovas, yang terbaru rilis aplikasi pengenalan wajah.

Google Rilis Aplikasi Pengenalan Wajah GOOGLE merilis aplikasi mobile yaitu aplikasi pengenalan wajah atau facial recognition. Aplikasi ini membolehkan konsumer memotret foto-foto wajah agar dapat mengakses informasi personal orang yang bersangkutan, begitu kata direktur proyek itu. Aplikasi ini bertujuan agar identitas seseorang dapat diidentifikasikan oleh software pengguna untuk mengecek satu kotak persetujuan guna memberikan izin pada Google mengakses gambar-gambar dan informasi profil mereka,” kata Hartmurt Neven, direktur engineering Google untuk pengembangan pengenalan imajinasi atau recognition imagination. Produk profil Google termasuk nama pelanggan, nomor telepon dan alamat e-mail. Google tidak menyebutkan data personal macam apa yang dapat diberikan seseorang yang diidentifikasi oleh sistim pengenalan wajah. “ Kami mengakui bahwa Google harus ekstra hati-hati pada masalah isu-isu privasi. Aplikasi pengenalan wajah yang kami rekayasa dapat diterima oleh banyak orang dengan berbagai isu privasi,” tambah Neven pada CNN pada satu wawancara eksklusif. Ketika google mulai menciptakan fitur-fitur privasi , Neven tidak mengatakan perusahaan itu bermaksud merilis produk baru itu dan juru bicara Google mengatakan tidak ada perilisan yang mucul pada waktu yang sangat tepat. Teknologi tidak dibangun dalam aplikasi terpisah meskipun pengenalan wajah dapat menjadi isu keberadaan peluncuran peralatan Google yang baru seperti peluncuran mesin pencarian imej atau image search engine yang baru. Google memiliki kemampuan teknis untuk mengimplementasikan tipe mesin pencarian imej ini selama bertahun-tahun. Sistim ini dapat diprogram untuk mengasosiasikan gambar-gambar yang dapat dipublikasikan di Facebook, Flickr dan situs-situs photo-sharing yang lain dengan identitas orang yang dimaksud dan itu mudah dilakukan saat ini. Namun usaha-usaha itu jarang dilakukan secara internal karena Google melihat dulu minat masyarakat pada produk barunya. “Orang-orang bertanya tentang semua hal rilisan Google, namun sebagai perusahaan besar Google harus memiliki visi yang jelas sebelum menjawab dan meluncurkan produknya. Secara tehnis, kami melakukan banyak hal untuk memberikan yang terbaik bagi pelanggan,” ujar Neven yang perusahaannya Neven Vision diambil alih Google tahun 2006. Neven Vision Specializen dalam objek dan mengembangkan aplikasi pengenalan namun tidak berhasil. Objeknya dihubungkan dengan program-program yang diimplementasikan dalam satu mesin pencarian imej yang disebut Goggles. Teknologi pengenalan wajah dipadukan dengan Picasa, satu situs photosharing Google dengan membantu software yang berguna memperkenalkan teman-teman dan anggota keluarga dalam perpustakaan poto di komputer pribadi. Tahun 2009, Google mengambil alih satu perusahaan yang disebut Like.com yang bergerak di bidang khusus pada produk image search engine dan bekerja untuk menginterpretasikan gambar-gambar pelanggan. Tak mau ketinggalan Google juga mere-kayasa program pengenalan wajah. Dite-ngah-tengah

berkembangnya pengaruh kuat Google, muncul kritikan yang menyatakan perusahaan itu sudah menganggu privasi orang lain. Selama bertahun-tahun Google telah membuat kesalahan sehingga perusahaan itu rela membayar 8,5 juta dolar tahun lalu dalam penyelesaian kasus keluhan servis jaringan sosial dan segala sesuatu yang berhubungan dengan aktivitasnya. Google mengumumkan satu persetujuan dengan komisi perdagangan federal Amerika Serikat untuk menerima peninjauan ulang prosedur privasi setiap dua tahun sekali. Google juga menghadapi sejumlah penyelidikan pemerintah mengenai informasi yang dikumpulkan servis jalanan Google. Para developer yang melapor pada Neven bekerja pada aspek-aspek layanan jalanan, inisiatif level potografi khususnya privasi, fitur seperti otomotif dan lisensi gambar. Google berminat merekayasa implikasi legal pengenalan wajah, bahkan selama masa uji coba yang dilakukan para karyawan Google. Google telah mengambil langkah untuk menjamin para tester setuju untuk membuat layanan lebih memuaskan. “Online, banyak orang tidak berfikir tentang privasi. Mereka hanya memikirkan tentang aktivitas menyenangkan yang mereka lakukan. Mereka akan mempelajari dengan hati-hati agar mereka mendapat kemudahan dan kesenangan dari produk teknologi,” jelas Karen Worth, direktur universitas Southern California yang mempelajari privasi online. Neven mengatakan, ia percaya Google memiliki tendensi menghilangkan hambatan untuk mengalahkan para kompetitor dan pihak layanan yang berkompetensi untuk menghilangkan kesulitan dan hambatan itu dengan mengumpulkan setiap poto pelanggan internet dengan memberikan mereka cara termudah untuk mengakses imej khsusus. Google mengetahui cara-cara tidak fair pihak-pihak yang mampu mempengaruhi tek-nologi pengenalan wajah. Banyak orang merasa takut jika poto dan identitas mereka dapat diakses orang lain. Apalagi jika mereka mengetahui alamat dan poto pelanggan. Itu merupakan pemikiran yang menakutkan. Maka Google melakukan hal terbaik dengan menciptakan aplikasi pengenalan wajah. Neven dan jubir Google menggambarkan aplikasi pengenalan wajah sebagai konsep konservatif dalam kaitannya dengan privasi. “ Saya kira kami sudah melakukan yang terbaik. Itu merupakan aplikasi sen-sitif. Jika anda seorang aktor di Los Angeles, anda tentu saja sangat berambisi agar setiap orang mengenal anda,” ujar sang jubir. Aplikasi pengenalan wajah dapat mengikat jaringan inisitif Google yang sedang berjalan, contohnya konsumer dapat melihat koneksi online yang menggunakan ponsel mereka untuk mengambil gambar dan secara instan mengendalikan profil pelanggan atau merubah kartu bisnis atau mengingat nama pelanggan. Bulan April ini Google mendisain kembali halaman profilnya dalam satu perubahan yang mirip dengan situs Facebook. Nurhayati Baheramsyah/cnn

Sport

WASPADA Minggu

17 April 2011

A7

Bintang Medan Pukul Tangerang Wolves 3-1 MEDAN (Waspada): Bin-tang Medan FC tampil gemilang dengan mengungguli lawannya Tangerang Wolves 3-1 lewat gol Cosmin Vansea dan Gaston Sa-lasiwa, dalam lanjutan Liga Primer Indonesia (LPI) di stadion Teladan Medan Minggu (16/4) malam. Meski sama-sama dirundung cedera pemain, Bintang Medan tampil lebih baik, CosminVansea membuka gol pertama setelah mendapat umpan terobos dari Gasto Salasiwa pada menit ke-19. Namun, Tanggerang Wolves pada menit ke32, berhasil menyamakan kedudukan melalui kaki Walace. Skor 1-1 bertahan hingga babak pertama usai.

Memasuki babak kedua, daya tahan para pemain Tanggerang Wolves mulai mengendur. Arsitek Bintang Medan Michael Feichtenbeiner menarik keluar Paharuddin menggantikannya dengan Guti Ribiero. Pemain asing asal Portugal yang telah lama istirahat karena cedera. Kehadirannya telah dimanfaatkan dengan baik oleh para pemain Bintang Medan untuk melakukan serangan bertubi-tubi ke daerah pertahanan lawan. Menit ke-55 terjadi pelanggaran di luar kotak pinalti Tanggerang Wolves. Gelandang Naturalisasi, Gaston yang mengambil eksekusi itu,berhasil membobol gawang Tanggerang Wolves pada menit ke-57.Score berubah untuk tuan rumah 2-1. Permaianan ditujukkan Soldier Kinantan semangkin

tinggi dan terus membombardir benteng pertahanan lawan. Gelombang serangan itu akhirnya berbuah gol, kembali striker asal Serbia Cosmin Vansea, berhasil membobol gawang TangggerangWolves pada menit ke-89. Keunggulan tuan rumah 3-1 bertahan hingga peluit akhir wasit tiup. Usai pertandingan terjadi insiden kecil antara Steve Pantelidis denganWalace nyaris menyulut baku hantam entah apa penyebabya.Walace terus mendatangi Steve untuk memanasi emosi pemain lainnya. Hal ini dapat dilerai oleh para pemain yang meninggalkan lapangan. Menurut pelatih Bintang Medan Michael Feichtenbeiner usai pertandingan mengakui dalam pertandingan ini, performa pemainnya sangat baik. Sehingga mereka terus semangat dan semakin termotivasi untuk

Menang Harga Mati PSMS

Waspada/Austin Antariksa

KEMENANGAN menjadi harga mati bagi Doni F Siregar (tengah) dan kawan-kawan kala PSMS menjamu PSAP Sigli di Stadion Teladan Medan, Minggu (17/4) malam ini. Seluruh pemain, minus Zulkarnaen yang sedang menjalani operasi urat tendon kaki kirinya, harus bermain keras dan fanatik sebagai ciri khas PSMS. Fityan mengakui, absennya striker PSAP dan top skor Osas Saha bersama M Ali akibat akumulasi kartu kuning sangat menguntungkan Ayam Kinantan. Dari kubu PSAP, Asisten Manajer Tim MuhammadYusuf menyahuti ancaman dari kubu PSMS. Kepada wartawan,Yusuf menegaskan PSAP tidak takut demi mendapatkan nilai dari laga tandangnya di Teladan. “PSAP baru akan puas bila dapat nilai dari PSMS. Tidak perlu tiga poin, satupun sudah puas bagi kami karena PSMS sulit dikalahkan di kandangnya sendiri. PSAP tidak takut dengan permainan keras dan fanatisme PSMS. Kami siap meladeninya,” katanya. Sebelumnya, pihak panpel Julius Raja SE dan Drs H Freddy Hutabarat menyebutkan, akan dilakukan hening cipta untuk mengenang mendiang Syamsuddin Panjaitan yang juga mantan pemain PSMS sebelum pertandingan. Syamsuddin meninggal Sabtu (16/4) pagi di kediaman-

Problem Catur Putih melangkah, mematikan lawannya enam langkah.

Jawaban lihat halaman A2.

Waspada/Austin Antariksa

COSMIN VANSEA (dua kanan) tampil gemilang bagi Bintang Medan kala mencetak dua gol ke gawang Tangerang Wolves dalam lanjutan Liga Primer Indonesia di Stadion Teladan Medan, Sabtu (16/4) malam.

SMPN 1 Dan SMAN 1 Tamora Duta DS Ke LPI Sumut 2011

Vs PSAP Malam Ini Di Teladan

MEDAN (Waspada): Mengalahkan pimpinan klasemen Divisi Utama Liga Indonesia 2010/2011, PSAP Sigli, menjadi harga mati bagi PSMS Medan dalam laga bigmatch di Stadion Teladan, Minggu (17/4) malam ini. Asisten Manajer Tim PSMS Drs Benny Tomasoa, Sabtu (16/ 4), menegaskan tidak ada pilihan lain bagi Ari Yuganda cs selain menang dari PSAP. Kalau tidak, harapan lolos ke putaran delapan besar kian menjauh. Mengingat dua lawan PSMS berikutnya berupa laga tandang menghadapi Persikabo Bogor dan Persitara Jakarta Utara, perjuangan hidup mati dan bertarung tanpa mengenal takut harus diterapkan anak-anak asuhan pelatih Suharto. “Jangankan mandi keringat, mandi darah pun harus berani mereka lakukan demi mencapai kemenangan,” kata Benny. Pernyataan Benny itu bukan berarti harus bermain tanpa kontrol, melainkan tetap menegakkan fair play. Sama halnya dengan Benny, Sekretaris Tim PSMS Ir Fityan Hamdi menegaskan pelatih Suharto telah meminta seluruh anggota skuad The Killer siap mendulang tiga angka atas PSAP.

menaklukkan Tangerang di kandang sendiri dan berhasil. Katanya, apalagi dengan masuknya Guti bekerja sama dengan Gaston Salasiwa dan Cosmin membuat serangan lebih hidup lagi dan terus melakukan tekanan. “ Banyak peluang Bintang Medan yang gagal dimanfaatkan dengan baik oleh pemain,” ucap dia. Asisten pelatih Tangerang Wolves Deca Dos Santos mengatakan babak pertama anakanak mampu untuk mengimbangi pertandingan tuan rumah. Namun memasuki babak kedua stamina pemain mulai kendor, sehingga sulit untuk memasuki pertahanan Bintang Medan. “ Nah, Bintang Medan membuat kewalahan barisan belakang Tangerang sehingga mereka mampu untuk memenangkan pertandingan,” ucap Deca. (m17)

nya di Jl STM Gg Suka Aman Medan. Menurut rencana, jenazahnya akan dikebumikan Senin (18/4) besok.(m17)

LUBUK PAKAM (Waspada): Siswa SMPN 1 dan SMAN 1 asal Kecamatan Tanjungmorawa berhasil menunjukkan “kepiawaiannya” di ajang Liga Pendidikan Indonesia (LPI) Kabupaten Deliserdang tahun 2011, dengan menjadi duta Deliserdang ke LPI Sumut 2011, Juli mendatang. Kebolehan yang dipertontonkan para generasi muda calon pemimpin bangsa di hadapan ribuan suporter yang umumnya siswa-siswi SMP-SMA/SMK terlihat jelas dalam pertandingan final, sekaligus penutupan LPI Tahun 2011 tingkat SMP dan SMA se-Kabupaten Deliserdang di Stadion Baharoedin Siregar Lubuk Pakam, Jumat (15/4) sore. Pada final sore itu, yang turut disaksikan Bupati Deliserdang Drs H Amri Tambunan didampingi Wabup H Zainuddin Mars dan unsur Muspida, SMPN 1 Tanjungmorawa menang adu penalti atas SMPN 2 Sunggal. Sedangkan SMAN 1 Tanjungmorawa dalam final memetik kemenangan dari SMKN 1 Lubukpakam 3-1. Atas keberhasilan yang diraih para siswa asal Kecamatan Tanjungmorawa itu, selain memboyong Piala bergilir, dan tetap juga menerima uang pembinaan yang diserahkan Bupati. Bupati Deliserdang mengaku bangga atas sikap sportivitas, kekompakan serta keterampilan yang dipertunjukan para siswa. Kepada seluruh siswa yang terlibat di ajang LPITahun 2011 diminta untuk terus melatih kemampuan dan keterampilan dengan serius sepakbola hingga ke depan bibit-bibit pemain muda ini dapat menjadi lebih baik lagi. “Teruslah berlatih agar lebih baik dan menjadi pemain andalan Deliserdang”, kata Bupati saat penutupan. LPI Tahun 2011 diikuti 36 tim terdiri dari 24 tim siswa SMP Negeri/Swasta dan 12 tim siswa SMA/SMK Negeri/Swasta digelar 4 sampai 15 April. Ketua Panpel LPI Tahun 2011 Drs H Asli Rambe SH MPd menjelaskan atas keberhasilan yang diraih siswa asal Kecamatan Tanjungmorawa, maka kedua tim (SMPN 1 dan SMAN 1 Tanjungmorawa) menjadi utusan Deliserdang ke LPI 2011 Sumut yang digelar Juli. Pemenang I-IV; SMPN 1 Tanjungmorawa, SMPN 2 Sunggal, SMPN 1 Lubuk Pakam dan SMPN 1 Galang. Tim fair play diraih SMPN III Percut SeiTuan, dan pencetak gol terbanyak Putra Rinaldi (SMPN II Lubuk Pakam) dan pemain terbaik Putra Azis (SMPN 1 Tanjungmorawa). Untuk tingkat SMA, juara I-IV ; SMAN 1 Tanjungmorawa, SMKN 1 Lubuk Pakam, SMAN 1 Lubuk Pakam dan SMA Nusantara Lubuk Pakam. Tim fair play SMAN 1 Lubuk Pakam, pencetak gol terbanyak Agung Surya (SMA Nusantara), dan pemain terbaik Dedek (SMAN 1 Tanjungmorawa). (a06)

Skuad PSMS Janjikan Yang Terbaik MEDAN (Waspada): Skuad anggota PSMS Medan menegaskan akan berjanji mengulangi penampilan ter-baiknya dan siap merebut tiga poin melawan PSAP Sigli di Stadion Teladan, Minggu (17/4) malam ini. Atas nama rekan-rekannya di Stadion Kebun Bunga Medan, Sabtu (16/4), Kapten PSMS M Affan Lubis menegaskan skuadnya tidak mau sesum-

bar tanpa alasan. Pastinya, Minggu nanti Ayam Kinantan mengulang penampilan impresif seperti dua laga sebelumnya menghadapi PS Bengkulu dan Persiraja Banda Aceh. “Impian terbesar kami adalah menembus Liga Super Indonesia (LSI). Saya harap kami tampil baik. Sebagai individu, saya akan berusaha bermain seperti saat mengalahkan PS

Waspada/Austin Antariksa

M AFFAN LUBIS dan segenap anggota skuad PSMS Medan bertekad mengulangi performa gemilang kala mengalahkan Persiraja Banda Aceh.

Bengkulu dan Persiraja,” ucap pemain bernomor punggung 8 itu. Saat ini, PSMS menduduki posisi ketiga klassemen sementara setelah menang 2-0 di laga terakhirnya atas Persiraja, Affan berharap performa gemilang PSMS dapat terulang lagi saat menghadapi PSAP yang juga pemegang tahta klasemen sementara. “Kekalahan putaran pertama tempo hari di Sigli membuat kami lebih kuat dan adanya suntikan motivasi menjadi kekuatan tambahan untuk tampil lebih baik di putaran kedua ini,” ujar Affan. Secara terpisah, Faisal Azmi mengisyaratkan tidak ada pilihan bagi PSMS kecuali menghabisi lawan demi memuluskan perjuangan lolos ke putaran depan besar. “Kami tidak mau mencurangi tim tamu secara tak sportif, tetapi harus dibalas lewat membombardir gawang PSAP dengan tujuan mencatat kemenangan,” kata Faisal. (m17)

2.800 Anak Medan Sekitarnya Bertarung Wujudkan Mimpi Ke Madrid Aqua-Danone Nations Cup 2011 MEDAN (Waspada): 2.800 Anak Medan dan sekitarnya dari 200 tim betarung mengikuti festival akbar sepakbola internasional terbesar di dunia untuk anak-anak usia 10-12 tahun, Aqua-Danone Nations Cup (Aqua DNC) 2011 di kota Medan untuk tingkat regional, Sabtu

dan Minggu (16-17/4). Babak penyisihan menggunakan tiga lapangan, yakni lapangan Paskhas AU Karang Sari, lapangan Kosek AU dan lapangan Sejati Pratama. Kemarin sudah terjaring 32 tim masuk ke babak knock out dan mereka bertarung, Minggu pagi ini. De-

Waspada/Setia Budi Siregar

Brand Manager Danone-Aqua Daniel Pieter berfoto di sela-sela pelaksanaan pertandingan Aqua-Danone Nations Cup 2011 di lapangan Paskhas AU Karang Sari, Sabtu (16/4).

mikian disampaikan Brand Manager Danone-Aqua Daniel Pieter, Sabtu (16/4). Babak penyisihan regional yang berlangsung di Medan adalah bagian dari rangkaian pertandingan babak penyisihan di tingkat provinsi. “Medan dan Banjarmasin waktunya bersamaan,” terangnya. Kemudian di Jayapura (2021 April), Padang dan Makassar (21-22 Mei),Semarang danYogyakarta (28-29 Mei), Surabaya dan Pekanbaru (4-5 Juni) dan DKI JakartadanTangerang(11-12Juni). Pada tahun 2011, Aqua-Danone Nations Cup diperkirakan akan diikuti total 3.300 tim sepakbola anak-anak Indonesia dengan sekitar 45.500 pemain dari 13 kota, naik lebih dari 25% dibandingkan jumlah peserta 2010. Pada tahun ini pula, Pekanbaru masuk menjadi salah satu kota yang berpartispasi dalam kompetisi tersebut. Hal ini dilakukan mengingat tingginya antusiasme anak-anak Indo-

nesia dalam mengikuti AquaDanone Nations Cup. SementaraFebbyIntan,Brand Director Danone-Aqua menambahkan, melalui Aqua-Danone Nations Cup, kami berupaya membuka kesempatan sebesarbesarnya bagi anak-anak yang memiliki minat tinggi terhadap sepakbola agar dapat mewujudkanmimpimerekauntukmenjadi bagian dari se-buah festival akbar sepakbola internasional yaitu Piala Dunia untuk anak-anak. Ini merupakan salah satu bagian dari tanggung jawab sosial Danone-Aqua untuk membangun masyarakat Indonesia yang sehat, bukan saja melalui produk kami namun juga melalui sebuah kegiatan yang nyata. Dalam acara ini, kami juga mengedepankan nilai-nilai universal yang penting bagi kami yaitu keterbukaan, keikutsertaan, sportivitas, dan kegembiraan.” Pemenang dari babak final nasional tersebut akan mewakili Indonesia berlaga di ajang Final

Dunia Danone Nations Cup 2011 pada 6 – 9 Oktober 2011 di Stadion Santiago Bernabeu, Madrid, Spanyol. Diperkirakan lebih dari 2,3 juta anak akan berpartisipasi dalam Danone Nations Cup tahun ini. “AQUA bangga dan senang bahwa selama sembilan tahun berturut-turut sejak tahun 2003 kami menyelenggarakan kompetisi DNC di Indonesia telah memperoleh sambutan yang luar biasa dan mendapat duku-ngan dari Kementerian Pemuda dan Olahraga dan PSSI, bahkan Presiden Republik Indonesia Bapak Susilo BambangYudhoyono dan Wakil Presiden Bapak Boediono menyempatkan waktunya untuk melepas dan menyambut Tim DNC Indonesia tahun 2009 dan2010saatberkompetisidifinal duniaDNCdiJohannesburg,Afrika Selatan,” tambah Febby Intan. Pada tahun 2010, tim SSB Banteng Muda dari Malang masuk lima belas besar, dan berhasil mengejutkan semua orang

denganmencatatkemenanganatas tim-tim unggulan seperti Italia dan Mesir. Dari total 14 anggota SSB Banteng Muda Malang yang mewakili Indonesia di ajang Final Dunia Danone Nations Cup 2010 tersebut, 10 anak di antaranya telah berhasil masuk tim nasional Indonesia U-13. Sedangkan tim SSB Pengcab Semarang(PemenangAqua-DNC Indonesia2009)bermaingemilang dan berhasil menduduki posisi enam terbaik dari 40 negara, yang artinyahampirmenyamaiprestasiterbaiktimDNCIndonesiatahun 2006 yang sukses masuk babak semifinal. Prestasi lain diantaranya adalah pada tahun 2005, tim Indonesia meraih gelar sebagai The Best Attack Team dan memecahkanrekorgolterbanyaksepanjang sejarah DNC dengan 24 gol. Padafinalduniatersebut,pesepakbola Indonesia Irvin Museng terpilih sebagai The Best Striker, dan dikontrak oleh Ajax Amsterdam Junior. Pemain lainnya adalah Syamsir Alamsyah. (m18)

Sport

A8

WASPADA Minggu 17 April 2011

Chris John: Lima Ronde, Cino Merendah JAKARTA (Waspada): Juara dunia tinju kelas bulu 57, 1 kg versi WBA Super, Chris John, melontarkan sesumbar bakal mampu mempertahankan gelar dengan memukul jatuh lawannya, Daud‘Cino’Yordan yang juga sesama petinju dari Indonesia, saat bentrok di Jakarta International Expo, Kemayoran, Jakarta, Minggu (17/4) malam ini. Kepada wartawan ditemui usai mengikuti sesi timbang badan sekaligus konfrensi pers kemarin, petinju asal Banjarnegara tersebut mengatakan, optimis bisa memukul jatuh penantangnya kali ini pada ronde kelima. Hal tersebut karena melihat persiapan yang ia lakukan bersama pelatih jelang

menghadapi laga bertajuk Moment Of The Truth yang merupakan pembuktian petinju terbaik di tanah air. “Target saya memang lima ronde. Kalau pun lewat, tidak akan sampai lebih dari sepuluh ronde,” koar Chris John yang langsung disambut sorak-sorai wartawan. “Kenapa saya berani memasang target seperti ini, karena melihat persiapan yang saya lakukan lebih dari cukup,” sambung petinju yang dijuluki The Dragon ini mantab. Lebih lanjut, petinju yang dikenal cukup lincah di atas ring ini mengatakan, dirinya berharap bisa menampilkan permainan terbaik saat menghadapi tantangan Cino, yang merupa-

kan kali pertama baginya menghadapi lawan sesama petinju Indonesia sejak menobatkan diri sebagai juara dunia WBA Super kelas bulu. Dengan begitu, sesumbar menjatuhkan lawan hingga ronde lima tadi bisa terpenuhi Mendengar sesumbar yang dilontarkan Chris John, kubu Cino tampak memilih merendah. Pelatih sekaligus kakak kandung Cino, Damianus Jordan, dengan nada datar mengatakan, pihaknya cukup respek dengan Chris John. Maklum saja, karena yang bersangkutan adalah juara dunia dan sudah membuktikan ketangguhannya dengan selalu merontokkan lawannya di atas ring.

“Tapi bukan berarti kami pesimis dan takut menghadapi laga ini. Bagaimana pun, kami memiliki tekad yang kuat untuk membawa pulang sabuk juara dunia. Besok (hari ini-red) akan ada juara dunia baru,” kata Damianus. Ditanya mengenai pernyataan Cino di akun jejaring sosialnya yang menyebutkan akan menjatuhkan Chris John di ronde kedua, Damianus ha-nya tersenyum dan mengata-kan, semuanya dilihat saja di atas ring. Sebab, tidak baik terlalu sesumbar,apalagimenghadapilagayang memang cukup krusial. Maklum saja, karena ini adalah kesempatan bagi anak asuhnya untuk meraih gelar juara dunia, sekaligus menapaki karir

tinju internasional. “Se-muanya akan kita lihat di atas ring. Bagaimana pun, ini adalah moment bagi kami untuk meraih gelar juara dunia, sehingga sangat disayangkan kalo dilewatkan begitu saja,” tandas Damianus. Sementara itu, selain menampilkan Chris John kontra Daud Jordan yang akan disiarkan secara live oleh RCTI mulai pukul 21.21 wib, pihak penyelenggara juga akan menampilkan partai international non gelar kelas berat (+90,7 kg) antara petinju Australia, Alex Leapai, kontra Okhello Peter dari Uganda, serta partai eksebisi selebriti yang akan mempertemukan duel artis Rafi Ahmad menghadapi Mario Lawalata. (yuslan) 4).

Chelsea Dekati Arsenal

AP

Striker Chelsea Didier Drogba menguasai bola yang coba direbut dua pemain West Bromwich Albion’s Paul Scharner (tengah) dan Yossuf Mulumbu di Hawthorns stadium, West Bromwich, Sabtu (16/4).

WEST BROMWICH (Waspada): Chelsea menambah tiga poin berkat kemenangan atas West Bromwich Albion 3-1 untuk mendekati Arsenal yang menduduki posisi kedua dengan nilai 62. The Blues berada di posisi ketiga dengan nilai 61 dari 32 pertandinga, sedangkan Arsenal menyelesaikan 31 laga. Lehat yang digelar di Hawthorns stadium, Sabtu (16/4) malam Wib, The Blues yang sempat ketinggalan 0-1 berhasil comeback dan unggul 3-1 di 45 menit pembuka. Pelatih Carlo Ancelotti mencadangkan Fernando Torres dan Nicolas Anelka. Untuk starter Don Carlo menampilkan Didier Drogba dan Salomon Kalou. The Blues semapt ketinggalan 0-1 lewat gol Peter Odemwingie. Namun tim London Barat berhasil comeback dan mencetak tiga gol melalui Didier Drogba, Salomon Kalou, dan Frank

Lampard. Tuan rumah mengancam di menit ketujuh. SepakanYoussuf Mulumbu setelah menerima umpan Chris Brunt, masih melintasdiatasgawangTheBlues. Peluang Chelsea hadir lima menit berselang. Dari sebelah kanan, Salomon Kalou melepas tembakan yang juga masih melayang di atas gawang WBA. West Brom unggul 1-0 usai Peter Odemwingie menjebol gawang Petr Cech. Gol berawal serangan yang dibangun Chris Brunt dan Jerome Thomas. Kemudian bola dioper ke arah

Odemwingie. Pemain bernomor 24 itu tak mendapat kawalan ketat. Ia kemudian berlari ke arah kotak penalti dan mengakhiri aksinya dengan sepakan yang gagal dibendung Cech. Empat menit berselang, Chelsea mampu mencetak gol penyama melalui Didier Drogba. Gol ini berawal dari umpan silang Malouda dari sisi kiri yang gagal dihalau dengan sempurna oleh Carson. Bola kemudian coba dibuang Nicky Shorey, namun usaha clearance dia juga tidak sempurna. Kondisi ini dimanfaatkan Drogba untuk merobek gawang WBA. Chelsea tak butuh waktu lama untuk unggul. Menit ke25 kedudukan berubah menjadi 2-1 untuk tim London Barat lewat gol Salomon Kalou. Gol ini berawal dari sepakan Didier

Drogba yang sempat dihentikan Carson. Bola rebound mengarah ke Kalou yang berada di sebelah kanan gawang lawan. Kalou kemudian melepas tembakan ke arah tiang jauh dan bersarang ke gawang tim tuan rumah. Unggul 2-1 tak membuat Chelsea mengendurkan tekanan. Menit ke-31 David Luiz memiliki kesempatan mencetak gol setelah menerima umpan dari tendangan bebas Drogba. Namun sebelum Luiz melepas tembakan pergerakannya sudah dicegah pemain tuan rumah. Dua menit berselang, giliran Frank Lampard yang menghadirkan peluang bagi Chelsea. Namun tendangan bebas Lampard masih bisa digagalkan Carson. Semenit menuju turun

Pole Beruntun Ketiga Vettel GP China

minum, Chelsea unggul 3-1 dengan Lampard sebagai pencetak gol-nya. Gol ini berawal dari umpan Drogba kepada Malouda. Malouda yang tak terkawal menerobos lewat sisi kiri. Kemudian dia mengumpan ke Lampard. Sepakan pemain timnas Inggris itu gagal dibendung Carson. Memasuki babak kedua, WBA kembali mencoba melancarkan tekanan. Namun begitu Chelsea juga beberapa kali menghadirkan ancaman ke gawang Scot Carsson. Menit ke57 Malouda dan Drogba bertukar umpan. Kemudian pemain Pantai Gading itu mengoper ke arah Salomon Kalou. Namun umpan tersebut gagal dijangkau Kalou. Satu jam pertandingan berjalan, Malouda melepas tembakan dari luar kotak penalti yang masih bisa ditepis Carson. Semenit kemudian peluang Chelsea kembali kandas. Tendangan Kalou sempat membentur kaki Brunt, kemudian bola mengarah ke gawang West Brom. Beruntung bagi tuan rumah karena si kulit bundar menerpa mistar.Di sisa waktu kedua kesebelasan memiliki sejumlah peluang. Bahkan menuju bubaran, WBA lebih sering melancarkan serbuan. Tendangan bebas Brunt lima menit menuju bubaran masih tipis di samping gawang Chelsea. Dua menit berselang Brunt kembali memiliki peluang bagus. Menerima umpan Carlos Vela dari sisi kiri, Brunt menanduk bola yang masih bisa ditangkap oleh Cech. Pertandingan lainnya, Everton berhasil meraih angka penuh usai menundukkan Blackburn Rovers 2-0. Kemenangan ini membuat perolehan angka The Toffees mendekati perolehan angka Liverpool. Koleksi angka Everton kini adalah 47 poin dari 33 pertandingan. Mereka cuma tertinggal satu angka dari Liverpool yang duduk di posisi enam tetapi baru bermain 32 kali. Liverpool akan menghadapi Arsenal pada Minggu (17/4). (euro/m18) Hasil Liga Inggris: Blackpool - Wigan West Ham -Aston Villa West Brom - Chelsea Everton - Blackburn Birmingham - Sunderland

1-3 1-2 1-3 2-0 2-0

Sinar Sakti Vs Rajawali Generasi Medan Vs Kebun Bunga Semifinal Manchester United Premier Cup 2011 MEDAN (Waspada): SSB Sinar Sakti bertemu SSB Rajawali pada babak semifinal Manchester United Premier Nike Cup 2011 Zona Kota Medan dan sekitarnya. Sedangkan semifinal lainnya berhadapan SSB Generasi Medan versus SSB Kebun

Bunga. Keberhasilan keempat tim melaju ke babak semifinal, setelah memperoleh juara grup pada pertandingan yang digelar di lapangan Pusat Pendidikan latihan Pelajar (PPLP) Sumut Jalan Sekolah Pembangunan

Medan Sunggal, Sabtu (16/4). Babak semifinal digelar Minggu (17/4) pukul 14.30. Kemudian dilanjutkan dengan babak final. Manchester Premier Cup 2011 merupakan kualifikasi untuk mengikuti tingkat nasional diikuti 12 tim yang

Waspada/Setia Budi Siregar

SSB Generasi Medan (berdiri) foto bersama dengan SSB Mabar Putra dalam pertandingan Manchester United Cup 2011 Zona Kota Medan dan sekitarnya di lapangan PPLP Jalan Sekolah Pembangunan Medan Sunggal, Sabtu (16/4).

Waspada/Yuslan Kisra

Chris John dan Daud ‘Cino’ Yordan usai melakukan timbang badan di Jakarta, Sabtu (16/

terbagi dalam empat grup. Juara grup langsung maju ke babak semifinal. Sinar Sakti juara Grup D dengan perolehan nilai empat dari sekali seri melawan Sejati Pratama dan menang atas Patriot 1-0. Sedangan Rajawali yang merupakan juara Grup C juga memperoleh nilai 4. Sedangkan Generasi Medan memperoleh nilai sempurna 6 dari dua pertandingan. Sebagai juara Grup A, Generasi Medan menang atas Surya Putra Sampali dan memetik kemenangan atas Mabar Putra 20.Kebun Bunga yang menjadi

lawan Generasi Medan memperoleh nilai 4 setelah mengalahkan medan Soccer 0-1 dan bermain imbang lawan Generasi Kosek 0-0. Kegiatan Manchester United Premier Cup merupakan turnamen sepakbola usia 15 tahun yang diselenggarakan setiap tahun di 43 negara. Babak final di Jakarta, sebutnya digelar pada 14 dan 15 Mei 2011. Pemenang dari tingkat nasional berhak mewakili Indonesia untuk maju ke babak regional final yang akan diselenggarakan di Thailand, Juni mendatang. (m18)

Hasil Pertandingan Sabtu: Grup A: Generasi Medan vs Surya Putra Sampali 1-0 Surya Putra Sampali vs Mabar Putra 1-0 Mabar Putra vs Generasi Medan 0-2 Lolos Semifinal: Generasi Medan

Grup C: Surya Putra Mariendal vs Rajawali 0-0 Rajawali vs Gumarang 1-0 Gumarang vs Surya Putra Mariendal 1-0 Lolos Semifinal: Rajawali

Grup B: Medan Soccer vs Kebun Bunga 0-1 Kebun Bunga vs Generasi Kosek 0-0 Generasi Kosek vs Medan Soccer 0-0 Lolos Semifinal: Kebun Bunga

Grup D: Patriot vs Sejati Pratama 0-0 Sejati Pratama vs Sinar Sakti 0-0 Sinar Sakti vs Patriot 1-0 Lolos Semifinal: Sinar Sakti

SHANGHAI, China (Waspada): Sebastian Vettel mencatatkan hasil sempurna dalam persiapannya melakoni seri Grand Prix China, Minggu (17/ 4). Setelah mencatatkan hasil terbaik di tiga sesi latihan, pembalap andalan Red Bull Racing ini melengkapinya dengan menjadi yang tercepat pada sesi kualifikasi. Melahap Sirkuit InternasionalShanghai,padasesikualifikasi, Sabtu (16/4), Vettel kembali menunjukkan keperkasaannya. Pembalap muda Jerman ini berhasil mengalahkan kecepatan rivalnya dan mengakhiri sesi dengan catatan waktu tercepat 1 menit 33.706 detik. Ini merupakan pole position ketiga beruntun Vettel sepanjang musim ini, setelah melakukan hal yang sama di dua GP terdahulu, di Australia dan Malaysia. Sama seperti pada sesi latihan terakhir, Jenson Button kembali menebar ancaman serius buat Vettel. Pembalap McLaren mencatatkan waktu tercepat kedua dengan hanya terpaut 0,7 detik dari Vettel. Driver McLaren lainnya Lewis Hamilton juga sukses mempertahankan posisi ketiga, menempel ketat Button dan Vettel. Pembalap Mercedes Nico Rosberg juga tampil konstan dan akan mengambil start di posisi keempat. Ini merupakan

hasil terbaik yang dicatatkan Rosberg sepanjang musim ini. Pembalap muda Jerman bahkan unggul jauh atas rekan setim yang juga seniornya, Michael Schumacher yang harus puas berada di urutan 14. Tim kuat Ferrari, tampil konsisten dengan menempatkan dua pembalapnya di grid ketiga. Fernando Alonso akan mengawali start di posisi lima, sedangkan tandemnya Felipe Massa menguntit di belakangnya. Namun, hasil ini jelas kurang menggembirakan buat awak Kuda Jingkrak dimana catatan waktu terbaik mereka terpaut lebih dari satu detik dari Vettel. Jika Vettel meraih hasil impresif pada sesi kualifikasi kali ini, hal sebaliknya justru dialami rekan setimnya Mark Webber. Pembalap vetetan Australia harus menerima kenyataan tercecer di urutan 18 karena, harus menghentikan aksinya sejak Q1 karena mobilnya bermasalah. Hasil kualifikasi GP China: 1. Sebastian Vettel (Jerman/Red Bull) 1:33.706 2. Jenson Button (Inggris/ McLaren) +0.715 detik 3. Lewis Hamilton (Inggris/ McLaren) 0.757 4. Nico Rosberg (Jerman/ Mercedes) 0.964 5. Fernando Alonso (Spanyol/

Ferrari) 1.413 6. Felipe Massa (Brazil/ Ferrari) 1.439 7. Jaime Alguersuari (Spanyol/ Toro Rosso) 2.452 8. Paul di Resta (Inggrisl/ Force India) 2.484) 9. Sebastien Buemi (Swiss/ Toro Rosso) 2.497 10. Vitaly Petrov (Rusia/ Renault) 11. Adrian Sutil (Jerman/ Force India) 1.388 12. Sergio Perez (Portugal/ Sauber-Ferrari) 1.567 13. Kamui Kobayashi (Jepang/ Sauber-Ferrari) 1.750 14. Michael Schumacher (Jerman/Mercedes) 1.971 15. Rubens Barrichello (Brazil/ Williams) 1.979 16. Nick Heidfeld (Jerman/ Renault) 2.125 17. Pastor Maldonado (Venezuela/Williams) 2.470 18. Mark Webber (Australia/ Red Bull) 1.196 19. Heikki Kovalainen (Finlandia/ Lotus-Renault) 2.622 20. Jarno Trulli (Italia/ Lotus-Renault) 3.046 21. Jerome D’Ambrosio (Italia/ Virgin) 3.847 22. Timo Glock (Jerman/ Virgin) 4.436) 23. Tonio Liuzzi (Italia/ HRT 4.940) 24. Narain Karthikeyan (India/HRT) 5.173 (crs/m47)

reuters

Sebastian Vettel, diapit duo McLaren-Mercedes, Jenson Button (kanan) dan Lewis Ha milton.

Barcelona Siap Jajal Timnas Indonesia LONDON (Waspada): Barcelona FC “El Barca” siap menjajaki berbagai kerjasama dalam bidang sepakbola dengan Indonesia, termasuk untuk melakukan pertandingan persahabatan dengan Timnas dan pembukaan sekolah sepakbola di Indonesia. Hal tersebut disampaikan Presiden klub Barcelona FC, Sandro Rosell, dalam pertemuannya dengan Duta Besar RI, Adiyatwidi Adiwoso, di Camp Nou, Barcelona, demikian Sekretaris Tiga KBRI Madrid, Krisnawati Desi Purnawestri kepada Antara London, Sabtu (16/4). Selain pertandingan persahabatan dan pembukaan sekolah sepakbola, dijajaki pula pelaksanaan trainning of trainers bagi para pelatih sepak bola

Indonesia, yang diharapkan akan mencetak para pemain muda Indonesia yang berkualitas untuk dapat membawa nama Indonesia di kancah persepakbolaan internasional. Pertemuan tersebut dilangsungkan dalam upaya KBRI Madrid mempererat hubungan antara Indonesia dengan Spanyol, dengan sepak bola dipandang sebagai salah satu media yang paling tepat, mengingat kecintaan masyarakat dua negara tersebut akan sepakbola. Duta besar dalam pertemuan tersebut menyebutkan bahwa dengan banyaknya penggemar klub Barcelona di Indonesia, kedatangan tim Barcelona FC untuk melakukan pertandingan persahabatan akan sangat dinantikan oleh para suporter setia klub nomor

satu Spanyol tersebut. Disebutkan bahwa KBRI Madrid berkomitmen dalam mendorong kerjasama olahraga Indonesia dengan Spanyol, khususnya untuk saat ini dalam cabang sepakbola. Hal itu ter-bukti dengan berbagai upaya yang telah dilakukan, di anta-ranya dengan pertemuan baru-baru ini antara Duta Besar dengan klub ternama Spanyol lainnya, Real Madrid. Jika kerjasama tersebut dapat segera terwujud maka tidak lama lagi publik Indonesia akan dapat menikmati pertandingan-pertandingan cantik berkelas dunia melalui permainan yang disuguhkan oleh para pemain Spanyol dalam kunjungannya ke Indonesia. (ant/ m18)

WASPADA Minggu 17 April 2011

Mode & Masakan

Nikmati Sajian Sate Memeng MALAM baru saja menjelang, tetapi Jalan Irian Barat Medan yang dikenal tempat mangkalnya para penggemar sate memeng, mulai ramai dikunjungi konsumen. Ada yang nampak sangat santai duduk di kursi yang berdekatan dengan jalan raya,sambil menunggu pesanannya lalu menyantap sate di warung milik pak Zul ini. Ada juga yang nampak terburu-buru ingin membawa pulang sate dengan kuah yang kental plus taburan bawang goreng dan sedikit cabai halus. Sate, pastilah tidak asing lagi bagi masyarakat. Umumnya di berbagai kawasan Kota Medan, tidak sedikit para penjaja sate, namun yang satu ini tetap diburu para konsumen. Sate memeng termasuk makanan yang sangat digemari warga Medan, hal ini terlihat dari antusias mereka datang ke tempat ini, bahkan sampai antre menanti pesanannya disiapkan oleh pedagangnya. Ingin tahu rasanya? Tak ada salahnya mampir ke tempat ini. Cita rasanya yang lezat tentu menjadi alasan tersendiri mengapa Anda mampir ke sana di sore menjelang malam hari. “Wah, bukan anak Medan namanya kalau tidak punya nostalgia di sate memeng ini, “kata pembeli mengaku bernama Aditya yang memesan tiga bungkus sate untuk dibawa pulang. Dia mengaku sejak masa remaja sudah sering mampir ke warung sate ini, hingga sekarang sudah punya anak, dia tetap suka mampir sepulang bekerja dan ingin membawa sate memeng untuk disantap bersama keluarganya. * Anum Saskia

B1

Variasi Omelet OMELET bila dikreasikan dengan bermacam bahan makanan lainnya seperti tahu, jagung, sayuran dan daging akan terasa lebih lezat dan bergizi, bisa dijadikan cemilan sehat atau lauk sarapan pagi, berikut resep yang bisa dicoba.

Omelet Tahu & Jagung Bahan: 2 sendok makan minyak untuk menumis 3 siung bawang putih, iris halus 1 buah bawang bombay, rajang halus 100 gram filet ayam, iris halus 300 gram jagung manis yang sudah disisir, cincang kasar 50 gram kapri, iris halus 200 gram tahu, potong dadu kecil 2 batang daun bawang, iris halus 2 sendok makan kecap inggris 4 butir telur (kocok lepas) garam dan merica secukupnya Cara membuatnya: Tumis bawang putih dan bawang bombay sampai harum. Tambahkan ayam. Tumis sampai matang Masukkan jagung , kapri, tahu dan daun

bawang. Tumis sampai layu. Bubuhi garam, merica dan kecap inggris. Tumis sampai matang. Angkat dan pindahkan ke dalam mangkuk Setelah agak dingin, tambahkan telur. Kocok

hingga rata. Panaskan minyak di wajan anti lengket. Tuang satu sendok sayur campuran telur, masak sampai matang, balik. Diamkan hingga matang.

Omelet Kepiting & Sayur Bahan: 5 btr telur kocok lepas 75 gr daging kepiting 1 btg daun bawang, iris tipis ½ bh bawang bombai, iris tipis 75 gr sayuran beku ¼ sdt garam ¼ sdt merica bubuk 1 sdm kecap ikan 4 sdm minyak goreng Cara membuat: Aduk telur, daging kepiting. Masukkan daun bawang, bawang bombai, bawang putih dan sayuran beku, bumbui garam, merica dan kecap ikan, ratakan. Panaskan minyak di wajan anti lengket. Tuang campuran telur, masak sampai matang, balik. Diamkan hingga matang. * Tri K/Taste

Keluarga

B2

WASPADA Minggu 17 April 2011

Ciri Kartini Masa Kini

Mampu Kelola Potensi Diri

Ny Sutiyas Gatot Pudjo Nugroho

Ny Iskandar Hasibuan

Salon Kecantikan Bukan Hanya Untuk Perempuan DI masa lalu, salon masih banyak diidentifikasikan dengan wanita. Karena itu, jarang sekali pria mau datang ke salon. Alih-alih mau mendapat perawatan, pria bisa dibilang ‘banci’. Tapi kini tidak lagi. Pria di perkotaan yang notabene sangat memperhatikan penampilan sudah semakin banyak datang ke salon atau klinik kecantikan. Namun, tentu saja, bukan salon sembarang saloon, tapi yang mampu memberi nuansa maskulin dan mengerti arti seorang pria sejati. Hal itu menjadi perhatian tersendiri bagi Tim GANESHA dari School of Business Management Institut Teknologi Bandung. Mereka terpilih sebagai pemenang Nasional L’Oréal Brandstorm 2011. Lomba diadakan sebagai bagian strategi pemasaran di kalangan pria. Konsep produk Koffie yang dirancang oleh tim ini dinilai sebagai konsep strategi pemasaran yang paling menyeluruh dan ekspresif melalui tagline “give your hair a coffee break”. Konsep coffee shop yang diusulkan memberikan nuansa bersabahat bagi konsumen pria untuk datang ke salon. Ti m p e m e n a n g j u g a mengusulkan penambahan rangkaian produk yang melengkapi produk L’Oreal Professionel Homme yang sudah ada. Sedangkan Tim Ganesha terdiri dari Desita Herdini

Arumsari, Teuku Fariz Riandi, dan Fabila Mahadira akan mewakili Indonesia bersaing dengan tim-tim terbaik dari 43 negara di dunia untuk memperebutkan gelar L’Oréal Brandstorm International Champion 2011 yang berhadiah perjalanan kemana pun di seluruh dunia senilai •10,000. Teuku Fariz Riandi, perwakilan dari Tim Ganesha mengatakan tertarik untuk mengikuti L’Oreal Brandstorm karena biasanya kompetisi serupa mengikuti tren , sedangkan dalam kompetisi peserta justru ditantang untuk menciptakan tren. Jean Christophe Letellier, Presiden Direktur L’Oréal Indonesia memberikan ucapan selamat kepada Tim GANESHA dari School of Business Management Institut Teknologi Bandung atas kemenangannya. “Ide mereka adalah konsep yang brilian. Para pria memang sudah saatnya dimanjakan sebagaimana layaknya wanita selama ini saat berada di salon,” kata Christophe. Tampil sebagai Runner Up adalah tim BEAST dari Universitas Prasetiya Mulya yang terdiri dari Joy Kartika, Marvin Pramudita, dan Flegon Koen. Tim ini mempresentasikan konsep produk CONTURE sebagai rangkaian produk dari L’Oreal Professionnel Homme dilengkapi dengan konsep lounge khusus pria.(dianw)

ERA Globalisasi yang diwarnai dengan beragam kemajuan ilmu pengetahuan dan teknologi diharapkan lebih meningkatkan pola pikir kaum perempuan saat ini . Seperti halnya yang diwariskan oleh RA Kartini, tokoh perempuan Indonesia yang selalu dikenang dan diperingati setiap tanggal 21 April, karena mewariskan pokok pikirannya untuk perempuan Indonesia, sehingga memiliki kesempatan untuk setara dengan kaum pria. Meski begitu perempuan diharapkan tetap membanggakan kodratnya sebagai perempuan yang punya kelebihan,yakni menjadi seseorang yang penuh kasih sayang karena mempunyai rahim. Demikian antara lain,pendapat dari kaum perempuan dengan berbagai profesi dalam rangka memperingati Hari Kartini tahun ini. Ny Sutiyas Gatot Pudjo Nugroho Kelola Potensi Diri Isteri Plt Gubsu ini berpendapat bahwa setiap perempuan Indonesia pastilah mempunyai potensi yang bisa diandalkan, karenanya sangat perlu dikelola sehingga menjadikan perempuan itu memiliki sesuatu yang bisa dibanggakan. Seperti yang telah dilakukan RA Kartini pada masanya. Seorang perempuan yang cerdas, memilih menjadi seorang isteri bupati dan berusaha mempotensikan diri dengan beragam kegiatan diantaranya menjadi seorang pendidik di lingkungan tempat tinggalnya. “Karenanya seorang perempuan yang sudah menentukan satu pilihan terhadap profesi yang mereka lakoni, harus serius dan penuh tanggung jawab. Jika pilihannya menjadi ibu rumah tangga, harus serius melakoninya dan berbuat secara maksimal. Apa yang diperbuat hari ini pastilah akan menuainya suatu hari nanti,” ujarnya. Dia menambahkan, begitu juga dengan karir lainnya, harus dilaksanakan dengan baik karena hal itu adalah pilihan. Jangan menyesali diri, apalagi untuk hal-hal yang tidak berguna. Tetapi bagaimana orang lain bisa memandang kita sebagi sosok yang mampu unggul dengan potensi diri yang dikelola dengan baik. “Pengelolaan potensi diri perempuan ini, hendaknya mulai diajarkan oleh seorang ibu dalam tatanan rumah tangga. Disana ia perlu diberikan bekal dan penguatan bahwa perempuan itu adalah mahluk yang diciptakan Allah dengan segala kelebihan, termasuk kelebihannya yang memiliki rahim untuk tempat mengan-

dung janin,suatu hari kelak. Dengan rahim itu pula, perempuan mempunyai sifat kasih sayang yang harus dimanfaatkan dalam perjalanan hidup. “Rumah sebagai sentra pendidikan, seperti yang dilakukan RA Kartini pada masa itu. Dia menjadi seorang guru di rumahnya, hendaknya Kartini masa kini juga bisa melakukan hal yang sama bagi Kartini berikutnya,” ujarnya sembari menyebutkan harapannya di Peringatan Hari Kartini tahun 2011 ini perempuan itu unik, dengan keunikan itu bisa menghasilkan sesuatu, dan mengelola potensi diri secara maksimal, karena Allah telah mengatur tatanan kehidupan perempuan sebagai sosok yang punya kelebihan. Orang tua perlu mengarahkan setiap potensi pada diri Kartini masa kini, peran orang tua menjadi sesuatu yang menentukan kiprah Kartini di masa depan. Ny Zakaria Siregar Bicara Dan Menulis Bagi Ketua BKOWSU, Ny Zakaria Siregar Kartini masa kini perlu mencontoh apa yang dilakukan oleh RA Kartini, dengan memanfatakan kemampuan diri dengan kemampuan berbicara, yakni seorang yang mampu menyampaikan pokok pikirannya melalui berbagai tulisan. Saat ini, kata Ny Zakaria Siregar, kemampuan berbicara sebagai bekal seorang perempuan menjadi seorang pemimpin sesuai dengan posisi yang didapatkan dalam jenjang karir yang mereka pilih. “Saat ini kesempatan perempuan untuk menjadi seorang tampuk pimpinan sangat terbuka luas, karena itu, seorang perempuan perlu belajar kemampuannya untuk berbicara, yang sangat diperlukan jika menjadi seorang pemimpin,”katanya. Hal lain yang perlu ditumbuhkan kaum perempuan, sambung Ny Zakaria Siregar agar perempuan mengelola kemampuannya untuk menulis, seperti yang dilakukan oleh RA Kartini, yang dikenal karena tulisan-tulisannya meskipun tulisan itu sifatnya seperti buku diary. Namun dengan tulisan itu pula, Kartini dikenal sebagai sosok yang menulis Habis Gelap Terbitlah Terang. “Setiap orang pasti punya potensi menulis. RA Kartini, menulis dengan mengandalkan otodidak saja, tetapi akhirnya dia mampu mengumpulkan berbagai karya tulis. Saat ini banyak sarana yang bisa menampung tulisan, ada majalah, surat kabar bahkan dunia maya (internet) dan tulisan itu

bisa memberikan penghasilan baru. Jadi saya lihat apa yang dilakukan RA Kartini dengan kemampuannya sebagai seorang yang suka menulis, sangat perlu dicontoh Kartini masa kini,” ujarnya. Ny Iskandar Hasibuan Lakukan Pembinaan Ketua Ikatan Isteri Dokter Indonesia (IIDI-Cabang Medan) ini mengajak Kartini masa kini untuk melakukan sebuah kegiatan berkaitan dengan pembinaan terhadap masyarakat yang membutuhkan kehalian dan kemampuan yang mereka miliki. “Bangun desa atau kelurahan binaan dengan membuat program kegiatan. Kaum perempuan pasti bisa melakukannya, karena pada dasarnya mereka sangat cerdas, punya kesempatan dan bisa menjalin jaringan kerjasama yang baik untuk menghasilkan program yang bermanfaat bagi masyarakat,” kata Ny Iskandar. Menilik kepada sifat RA Kartini yang menjadi isteri seorang bupati diJepara, tetapi dia masih memikirkan nasib kaumnya. Karena itu dia mau menjadi seorang guru bagi masyarakat dan membina mereka agar tidak buta huruf. “Berangkat dari optimisnya RA Kartini dalam melakukan pembinaan terhadap warganya itu, saat ini dalam melakukan pembinaan pada masyarakat, banyak hal yang bisa dilakukan. Membina masyarakat agar cerdas, sehat atau membantu mempotensikan hasil desa atau kelurahan mereka sebagai sumber ekonomi agar bisa menopang ekonomi keluarga. Jika ekonimi keluarga baik, insyaallah akan baik mutu keluarga itu kedepan. Jadi, dengan membuat desa atau kelurahan binaan itu, akan tubuh Kartini-kartini yang potensial dan bisa berperan dalam pembangunan bangsa ini kedepan,” katanya bersama pengurus lainnya yang sedang mengembangkan kelurahan binaan di Ladang Bambu Kecamatan Medan Baru. Nurhasanah S Sos: Kembangkan Tradisi Membangun Anggota DPRD-SU, Nurhasanah S.Sos mengingatkan kaum perempuan (Kartini masa kini), untuk tidak menanggalkan tradisi khas perempuan Indonesia, yakni mengenakan kebaya. “Kita prihatin, banyak perempuan Indonesia kini yang lebih senang mengenakan busana ketat yang diadopsi dari negara luar, hingga memamerkan lekuk tubuhnya. Padahal kondisi itu justru kembali merendahkan kaum

wanita,” kata Nurhasanah yang mengaku bangga terhadap kemajuan yang dicapai perempuan Indonesia saat ini. Disebutkannya, dari sisi pendidikan kaum wanita mampu menonjolkan diri lewat prestasi. Sederet nama kaum wanita seperti Sri Mulyani yang kini menjabat Direktur Bank Dunia. Prestasi luar biasa diraih wanita anggun tinggi semampai ini, ketika dirinya mampu mengangkat posisi pertumbuhan ekonomi Indonesia beberapa waktu lalu, Sri pun dipromosikan memangku jabatan Dirut Bank Dunia. “Jabatan ini baru pertama diduduki seorang srikandi, justru dia dari Indonesia dan menjadi warga negara Indonesia pertama menjabat Dirut Bank Dunia,” ucapnya sembari menyebut nama lainnya yang punya kesempatan di posisi atas, yakni Karen Agustiawan sebagai Dirut Pertamina, Endang Rahayu Sedyaningsih sebagai Menteri Kesehatan menggantikan Siti Fadilah Supari, yang keduanya merupakan wanita-wanita pintar. Na m u n , Nu r h a s a n a h sebagai wakil rakyat di Komisi E yang salah satunya tentu banyak mengangkat persoalan kaum perempuan di komisinya, dia melihat kondisi majunya perempuan masih sebatas segelintir. Karena untuk tingkat daerah, kabupaten/kota sepertinya Kartini masih harus mengelus dada. “Dari sisi pemerintahan saja, kita masih merasakan keengganan pemerintah provinsi dan kabupaten/kota menempatkan perempuan di posisi pemberi kebijakan, bahkan di Pemprovsu dari 17 dinas dan Badan masih minim dijabat oleh perempuan. Sedangkan di badan legislatif DPRDSU,masih 16 persen kursi diduduki oleh perempuan, tentunya belum memenuhi kuota 30 keterwakilan perempuan di parlemen. “ RA Ajeng Kartini yang lahir pada 21 April 1879 di Kota Jepara Jawa Tengah, hingga kini memang tinggal sebatas sejarah. Namun bangsa yang besar harus menghargai sejarah dan pahlawannya. Begitu juga wanita-wanita Indonesia harus tetap menghargai perjuangan RA Kartini, tetap harus membesarkan hari bersejarah ini. Jadi sangat perlu menanamkan kebiasaankebiasaan RA Ajeng Kartini kepada puterinya. Jangan kita malah menghancurkan citacita Kartini dengan tidak menghargai kodrat kita sebagai wanita,” ujarnya. Naskah dan foto: Anum Saskia

Puluhan Perias Pengantin Ikuti Uji Kompetensi TEMPAT Ujian Kompetensi (TUK) Nova di Jalan Garuda Raya Perumnas Mandala kembali mengadakan Uji Kompetensi Tata Rias Pengantin (TRP) Melayu dan Gaun Panjang di Jalan. Garuda Raya Perumnas Mandala, Rabu lalu dihadiri pihak Dinas Pendidikan Deliserdang, Drs Surya Jaya SH, MPd serta dari Dinas Pendidikan Sumut, Drs Zainnur. Para peserta berasal dari berbagai daerah di Sumatera Utara dan Sumatera Barat. Pimpinan TUK Nova , Ny. Zuraida menyebutkan kegiatan ujian ini memberikan banyak manfaat kepada para penata rias pengantin. Diantaranya, mengukur kemampuan mereka dalam merias dan mendapatkan berbagai informasi tentang masalah tata rias ini. “Saya sangat berterima kasih kepada pemerintah karena telah mempercayakan TUK Nova untuk menyelenggarakan ujian kompetensi (UK) TRP. Karena tidak sembarang Lembaga Kursus Pendidikan (LKP) dapat menyelenggarakan

Waspada/Anum Saskia

Pengelola TUK Nova Ny Zuraida dan peserta ujian, dewan juri dan pihak Dinas Pendidikan Deliserdang dan Sumut berpose bersama usai kegiatan. ujian kompetensi. ” kata Zu- dak nantinya dengan hasil uji nambahkan pihak-nya tidak melihat peser ta dari ketiori dan praktiknya. raida. “Uji Kompetensi di TUK seniorannya. Jika merasa mamSaat ujian berlangsung menghadirkan dewan juri da- Nova berlangsung selama dua pu dan sudah cukup bekal ri Jakarta yakni Kartini Bach- hari. Sehari untuk TRP Melayu ilmunya, silahkan mengikuti tiar, sedangkan dari Medan, dan sehari untuk TRP Gaun UK. Hanya saja kemungkinan Hj Suryaningsih dan Rukmini. Panjang yang diikuti peserta tidak lulus bisa saja terjadi. Ketiga dewan juri ini menye- dari Sumatera Barat, Kisaran, Karena penilaian sepenuhnya butkan kegiatan ujian ini Deli Serdang, Binjai dan Me- di tangan pusat (Kementerian mendapatkan penilaian untuk dan Ujian melingkupi dua Pendidikan Nasiona). Kami hanya menyerahkan bagian teori dan praktek. Deajang tiori dan praktik. Semua nilai akan dibawa ngan nilai maksimal 21 untuk nilai saja. Mereka yang meke Jakarta untuk memutuskan teori dan 59 untuk praktek,” nentukan lulus atau tidaknya. apakah peserta lulus atau ti- kata Rukmini sembari me- (m37)

PKK Bawa Perubahan Di Pedesaan

Waspada/Dian

Presiden L’Oreal Indonesia, Jean Christophe saat menyerahkan hadiah kepada Tim Ganesha dari ITB.

TIM Penggerak Pembinaan Kesejahteraan Keluarga (TP PKK) telah banyak membawa perubahan kepada kehidupan masyarakat di pedesaan. Ketua Tim Penggerak PKK Kabupaten Labuhanbatu Ny Hj Fitra Laila Tigor Panusunan Siregar,Sp.THT menyampaikan itu dalam sambutannya saat membuka Lomba Simulasi Pola Asuh Anak Dalam Keluarga dan Lomba Pidato di Pendopo Rantauprapat, Rabu (13/4). Fitra Laila mengatakan, TP PKK pernah mengalami masa jaya, khususnya pada masa pemerintahan Presiden Suharto. Pada masa itu PKK benar-benar diberi peran yang cukup besar dalam member-

dayakan kaum wanita dalam mengatasi berbagai permasalahan khususnya di pedesaan. Namun dalam perjalanannya, PKK telah banyak dimanfaatkan untuk kepentingan politik, sehingga keberadaan PKK sempat terkotak-kotak dan mengalami masa surut yang cukup panjang terutama diawal reformasi. Pada masa pemerintahan Presiden Susilo BambangYudoyono, jelas Fitra Laila, keberadaan PKK kembali diletakkan pada fungsinya yakni sebagai motor penggerak kaum ibu dalam mensejahterakan keluarganya. Pada bagian lain Fitra Laila mengatakan, dalam rangkaian menyambut peringatan Hari

Kartini, TP PKK Kabupaten Labuhanbatu melaksanakan berbagai kegiatan yang bertujuan menambah pengetahuan bagi anggota dan masyarakat. Kegiatan tersebut antara lain lomba membordir, lomba mars PKK, lomba simulasi pola asuh anak dalam keluarga, lomba pidato, cerdas cermat, lomba pembuatan tumpeng dari bahan non beras, lomba membuat parsel dan seminar. Seluruh kegiatan dilaksanakan di Pendopo Rantauprapat mulai 1118 April 2011. Pada kesempatan itu Fitra Laila berpesan kepada seluruh peserta dan juri agar jangan ada KKN dalam penilaian lomba nantinya. (a18/c07)

Waspada/ist

Nurhasanah S Sos

Ny Zakaria Siregar

Tim Supervisi Lomba Desa Percontohan PKK SU Kunjungi DS BUPATI Deliserdang Drs H Amri Tambunan melalui Wakilnya H Zainuddin Mars menerima kunjungan Tim Supervisi Lomba Desa Percontohan Pelaksanaan 10 Program PKK, Desa Menuju Daerah Wisata dan Desa Program Terpadu P2W-KSS Tahun 2011 Sumut. Tim dipimpin Ny Hj Sutiyas Handayani Gatot Pujonugroho dan diterima di Aula Cendana kantor bupati Deliserdang, Lubuk Pakam, Senin (11/4). Wabup didampingi Ketua TP PKK Deliserdang Ny Hj Anita Amri Tambunan beserta unsur pengurus, Kakan Pemberdayaan Masyarakat Kab. Deliserdang H. Syafrullah, S.Sos,MAP, pimpinan SKPD, para camat dan Ketua TP PKK kecamatan serta sejumlah Kepala Desa dan lainnya. Ketua Tim Supervisi Ny Hj Sutiyas Handayani Gatot Pujonugroho dalam pertemuan yang berlangsung penuh rasa kekeluargaan dan keakraban itu menjelaskan, dilaksanakannya perlombaan desa dalam upaya meningkatkan kesejahteraan masyarakat sehingga terlepas dari kemiskinan. Meskipun kabupaten Deliserdang selama ini telah mampu meraih berbagai keberhasilan, namun pada lomba desa percontohan ini diharapkan tidak sematamata untuk mengejar target juara akan tetapi mampu menjadi contoh bagi daerah lain. Oleh karenanya pemerintah sebagai mitra kerja yang ditetapkan menjadi Dewan Penyantun PKK diharapkan dapat terus menunjukkan kepeduliannya sebagaimana yang telah disepakati bersama, terutama dalam menyahuti tuntutan kebutuhan masyarakat yang berada di pedesaan, ujar Ny Gatot Pujonugroho. Sementara, Wabup Deliserdang H Zainuddin Mars mengatakan, dalam percepatan pembangunan guna meningkatkan kesejahteraan masyarakat khusus di sektor infrastruktur Pemkab Deliserdang meski telah memiliki APBD Rp 1,6 triliun namun tetap mengandalkan tiga pilar kekuatan dalam membangun melalui program Gerakan Deli Serdang Membangun (GDSM) dengan melibatkan peran

swasta, dukungan pemerintah serta partisipasi aktif masyarakat. Melalui program GDSM, saat ini telah terbangun sarana jalan kabupaten mencapai 3.200 km dari sebelumnya hanya 1.300 km. Pencapaian yang cukup tinggi ini tidak terlepas dari dukungan dan partisipasi masyarakat termasuk bantuan pelebaran badan jalan milik masyarakat yang direlakan tanpa ganti rugi. Selain program GDSM di sektor infrastruktur, Pemkab Deliserdang dalam meningkatkan mutu pendidikan menerapkan konsep Cerdas dan di bidang kesehatan melalui program Ceria tanpa meninggalkan program pembangunan bidang lainnya.Setelah program GDSM, konsep Cerdas dan program Ceria dilaksanakan dan hasilnya telah dinikmati masyarakat, kini Pemkab Deliserdang dibawah kepemimpinan Drs H Amri Tambunan membuat terobosan baru melalui program Baru Yakin (Bedah Rumah Masyarakat Miskin) terhadap 10 ribu unit rumah tidak layak huni yang direncanakan selesai dalam kurun waktu 3 tahun, ujar Zainuddin Mars.Ketua TP PKK Kab.Deliserdang Ny Hj Anita Amri Tambunan dalam paparannya menjelaskan tahun ini telah dilaksanakan pembinaan terpadu 44 desa percontohan pelaksanaan 10 program pokok PKK, 1 desa percontohan menuju daerah wisata dan 2 desa pelaksanaan PT P2WKSS. Terpilih mengikuti perlombaan di tingkat Sumut untuk desa percontohan pelaksanaan 10 program pokok PKK adalah Desa Pasar V, Kebun Kelapa, Kec.Beringin, Desa menuju daerah wisata Desa Sidomulyo Kec. Biru-biru dan pelaksanaan PT P2WKSS terpilih Desa Jumatombak Kec. STM Hilir. Khusus Desa Pasar V Kebun Kelapa, Kec.Beringin yang terpilih menjadi desa percontohan pelaksanaan 10 program pokok PKK, diharapkan dapat mempercepat pembangunan dalam mensejahterakan masyarakat terlebih daerah ini sangat berpengaruh terhadap keberadaan Bandara Kuala Namu.(a06)

Cemerlang

WASPADA Minggu 17 April 2011

B3 Puisi Puisi

Dilema Rindu & Patah Hati Cerpen

Karya: Mahdi Idris

Jam Mungkinkah ada jam yang bisu berhenti detak, tanpa satu angka menyelinap pada baris waktu melaju ke persimpangan jalan, di tubuhnya tertulis kedunguan dan kegersangan?

Erny Wirda Ningsih

Tidak! tak ada jam yang berhenti, selain perintah

SEBENTAR, aku ingin bertanya apakah ini namanya rindu? Tunggu dulu, jangan beranjak dari dudukmu sebab masih banyak pertanyaan yang ingin kutanyakan. Sungguh! Aku tak mengerti tentang perasaan ini. Jam di dinding kamarku masih berkutat pada angka setengah 12 malam. Aku masih sibuk membiarkan jemariku menari-nari di atas keypad keyboard laptopku. Kata demi kata terangkai begitu saja. Aku tidak mengerti apa yang ingin ku tulis, aku juga tidak paham gemuruh apa yang kini menyesakkan dadaku. Saat kusandarkan punggungku sejenak di badan kursi, ingatanku tiba-tiba kabur dan sosok Reza membayang di sana. Entahlah, kesibukan yang akhirakhir ini menyita waktu kami seolah melukis jarak yang seharusnya tak berjarak. Akh, rinduku makin lekat! Sosok itu mendekapku, merangkulku dan membiarkan kepalaku bersandar di bahunya. Ada percikan bintang di aksara langit yang seolah turut berkesan menyumbangkan suasana. Sejenak tapi pasti, aku bisa merasakan detak jantungku yang berdegub semakin kencang saat kurasakan bulu-bulu kudukku merinding, sebab rindu yang bercampur dingin hawa gerimis di luar sana. ** Malam semakin larut, hawa dingin kian menusuk sum-sum tulangku. Kuambil secarik kertas, lalu kutulis sebuah surat. Seperti biasanya, saat rindu dan malu untuk mengungkapkan rindu, aku kerapkali menuliskannya pada selembar surat, lalu kusimpan di dalam agenda kecil. Kali ini aku melakukan hal

kau tikam pada angka, tanpa jenuh mengitari perputaran matahari; keliling musim. Lalu aku mengejarmu, seperti jam kejar waktu kupandangi gelisah wajah, mata dan kakimu pada bayangku sendiri Kini aku berhenti igau agar engkau tetaplah jam yang tak pernah bisu

yang sama. Sesuatu yang sudah lama tak pernah lagi kulakukan. Untuk kekasihku: Reza Ini tulisan tanganku, ku tulis sebab aku rindu Ada jiwa meramu Qalbuku jadi satu Pecah-pecah Dan berantakan! Ini tulisan tanganku yang kutulis saat rindu meng-anak kata Dalam diam lisanku, dalam sahaja sikapku Sebenarnya aku rindu padamu Rindu ingin temu. Kasihku, biar malam membawamu terlelap Dan dingin merantai tubuh kita Tetap hangatkan hatiku Seperti kemarin yang selalu kau janjikan Kita satu. *Rindy Aku berjalan mengibas mentari yang masih tampak malu-malu menyelinap di balik dedaunan muda sepanjang perjalanan ke kampus. Sayup temayup lembut sentuhan angin memberikan kesan damai. Aku terus berjalan sembari membiarkan anganku sesekali menyelipkan sosok Reza. Akh, seperti baru pertamakali jatuh cinta rasanya. Perasaan ini mempermainkan hatiku. Tak lama kemudian aku sampai di kampus. Seperti biasa pula, aku mengambil tempat duduk paling depan dan mulai membuka novel terbaru yang

Kepada-Mu Apa yang dapat kuberi kepada-Mu selain janji, abdiku yang kau pinta selain sembahku tak pernah sempurna Aku tahu, tanah mana yang pantas jasadku disemayamkan, air penyiram dahaga terakhir kali di situlah benih terpancarkan; takdirMu tak jua berpaling KepadaMu sesayat panjat kalam tersebab kudrat tanpa dayaku Engkau maha tahu; sesungguhnya aku paling nista Karya: Nurwidasari Lubis

Kepiluan

kubeli 2 hari lalu. Sampulnya biru muda, covernya seorang gadis duduk sendirian menatap langit dengan pandangan hampa. Ceritanya sederhana, hanya berkisah tentang perjalanan cinta seorang gadis yang ditinggalkan mantan kekasihnya menikah dengan gadis lain. Itu saja! Sekilas mungkin novel ini tak menarik untuk dibaca, tapi di lembar pertengahannya ada kalimat yang sangat kusuka. “…seumpama hati bisa bicara, ingin kusampaikan padamu tentang luka saat kau bersanding dengannya”. Akh, kalimat yang cengeng

Semua Karena Rindu Cerpen

“GINA…!! Gina!! Cepat siniii…. kelas sebelah tawuran……!!” “Ha..??? Apaan ..sih, Tita!? Masa sih sekolah kita ada tawuran!!” “I…i..iya..beneran..yuk kita lihat ke sono..!” Tita dengan semangat empat lima menarik lengan sobat karibnya itu. Maka, dengan terpaksa Gina akhirnya mengikuti kemauan Tita. “Yaelah…lu Ta.. Jangan lebay, deh! Masak cuma karena dua orang berkelahi, lo bilang tawuran…bikin heboh aja!!”Gina ngomel sambil bibir merat merot. Di hadapan mereka dua pelajar berseragam sedang tegangtegangan urat leher alias saling gertak, saling hina. “Dasar preman simpang lo!!” Enggak bakalan si Rindu mau sama muka kaya tukang

NeZa

bangunan kaya lo!! Ngaca dong ngaca!!” “Puih..lo pikir mentangmentang lo tajir, anak yang punya sekolah, trus si Rindu bakalan milih lo… jangan ngimpi deh…ayo kita buktikan!!! Dia lebih milih gue, apa lo?! “Hahhh??? Jadi lo masih berani nantangin gue, ayo..sini sebelum kita nemuin tu cewek.., gue kasih tahu dulu jurus Avatar..biar rasa!! Ciiiiatttt???!!!” Keduanya bergerak cepat saling mendekat dengan emosi yang sudah membuncah. Gubraaakkk….!!! Tiba-tiba terdengar suara seperti nangka super gede jatuh ke ubin..…dua orang yang bersaing untuk mendapatkan perhatian dan cinta Rindu itu sama-sama terjatuh di lantai yang licin, sebelum tangan mereka saling beradu kuat. Spontan keduanya mengaduh kesakitan…. dan

yang lebih menyakitkan adalah karena malu, sebab begitu banyak pasang mata yang melototin tingkah mereka berdua sedari tadi. “Gadiiinngg!!! Aldooo!! Apaapaan sehhh… kalian ini!!! Malu-maluin aja..!!” bentak Rindu sewot setengah koma. Ternyata cewek yang mereka ributkan, sudah berdiri tegak di depan mereka. Dengan berkacak pinggang cewek tinggi langsing dan berkulit putih itu memonyongkan mulutnya hampir 10 cm. “Eh..yayang Rindu..udah datang ya…kok tadi gak nunggu jemputan aku mau ke sekolah…??”Gading menyapa dengan sok mesra pada cewek yang telah membuatnya gelisah dan resah akhir-akhir ini. Tangan Gading sebelah kanan mengelus-elus pinggangnya yang serasa mau patah akibat

memang! Tapi apa boleh buat, kalimat itu mengisahkan sedikit tentang perasaanku saat seseorang yang dulu pernah ada dalam hidupku, kini harus berlalu dan memilih untuk tidak lagi bersama denganku. Sungguh! Satu-satunya yang bisa membuat luka ini sembuh hanyalah kembali menemukan cinta yang benar-benar mencintaiku, yang cintanya jauh lebih tulus dari seseorang yang dulu pernah kusayangi. Aku membuka resleting tasku, dan tanpa sengaja sebuah surat terjatuh keluar. Belum sampat aku mengambilnya, Reza ternyata sudah lebih dulu

mengambilnya. Aku panik, sejenak pikiranku kacau. Reza mengedipkan matanya seraya merangkul pundakku kemudian ia duduk di sebelahku. “Rumah Sakit Umum Kimia Farma” Reza membaca kepala surat di sampulnya. Aku diam dan tertunduk bisu. Reza merangkulku sekali lagi, lalu mengelus kepalaku – manja. Aku tersenyum. Reza mulai membaca isi surat itu. Setelah dibacanya, ia pun melipat dan memasukkannya kembali ke dalam amplop dan diberikannya kepadaku. Saat itu ruang kelas masih sepi, dan Reza sempat mendaratkan kecupan

di keningku – hangat! “Aku mencintaimu Rindy. Sungguh! Apa pun kamu,” ucap Reza meyakinkanku. “Walaupun aku hanya seorang gadis penderita leokimia?” ucapku dengan mata berlinang. Dia mengangguk, meyakinkanku.

kebanting di ubin yang maha keras. “Ih..sok kecakepan..udah dibilang muka kaya kuli bangunan masih aja kepedean!! He..eh…Rindu…Rindu cantik, jangan mau ya diboncengin sama cowok kere ini… ntar alergi lho…gatal-gatal gitu?!”sindir Aldo gak mau kalah. “Sudah!! Sudah!! Jangan ribut lagi, sudah mau bel masuk, awas kalau kalian ribut lagi!!” hardik Rindu sambil mengancam dan secepatnya ingin berlalu dari dua orang penggemar beratnya. “Trus kalian-kalian??? Sudah… kalian semua juga bubar dong…ngapain seh… masih pada ngumpul di sini, juga!! Kaya gak ada kerjaan aja..!!”para penonton yang notabene teman-teman satu sekolah mereka ternyata kebagian semprotan Rindu. Buru-buru mereka ngacir menuju kelasnya masing-masing. “Deee….yang jadi rebutan para cowok….kok sewot seh…. harusnya bangga dong …”Gina dan Tita yang memang teman se-gengRindumeledekbarengan. “Kalian ini, bukannya bantuin aku.. kok malah ngejek…!!” sambar Rindu kesal. “A m p u n … neng cantik…hehe…kita kan Cuma bercanda…ya kan…Gin…” ceplos Tita santai. “Iya…tenang dong non… makanya siapa suruh jadi orang cakep…kan capek tuh direbutin terus…” “Iya..ya..Gin…kalo dipikirpikir lebih kasihan juga mikirin nasib kita….jangankan ada cowok yang suka….laler juga kayanya ogah singgah di kita….hahaha..” Tita tanpa diminta malah curhat. “Memang mauku punya wajah cakep?? Sono gih ambil tuh cowok-cowok sinting… masih kelas dua SMA aja udah mikirin cowok… Nanti sekolah kita pada terganggu..kan gawat… Jalan masih panjang ...aku pengin kuliah dulu, kerja dulu… baru deh mikirin cowok..!! Lagian catet ya dalam pikiran kalian, nih Rindu…gak bakalan suka dan jatuh cinta sama cowok-cowok…kecuali nanti kalau udah sukses!!” Rindu berkoar sambil menepuk dadanya sendiri. “Ah yang bener Rin…. Awas lo ya kalau ntar-ntar nyukai cowok….” Ucap Gina sedikit mengancam. “Bohong lo Rin…. bukannya kemarin di kamarmu ada poster Irfan Bachdim yang su-

per gede. Berarti lo ada rasa dong sama dia….bahkan udah jatuh cinta…kale… Kan maksud lo tempel gambar cowok cute itu di dinding kamar, supaya makin asyik aja ngayalin dia…”ceplos Tita sambil mengerdip genit. “Kalian ini norak banget, seh…kalau sekedar mejengin foto bintang begitu mah kagak dosa kale…dan bukan juga karena aku cinta mati ma Irfan Bachdim.. ..itukan Cuma karena aku salah seorang penggemar beratnya… di mana letak salahnya coba… gak bisa bedain apa…mana penggemar benaran mana yang nggak…” Bel pulang sekolah berbunyi panjang… Terdengar suarasuara kegirangan karena terbebas dari pelajaran yang memusingkan kepala. Para pelajar berlomba keluar kelas … mungkin dikarenakan perut mereka sudah keroncongan dan pengin secepatnya diisi. Ada yang berniat langsung pulang tapi tak sedikit yang pengin nongkrong lagi di kafe depan sekolah. Tapi tak lama setelah itu.. terdengar suara riuh yang berasal dari depan gerbang sekolah Tunas Bangsa. Sejenak Gina, Tita dan Rindu yang sedanga berjalan santai keluar kelas terkesima. “Suara apa itu???”mereka bertiga saling berpandangan bingung. “Lho kok kayak orang bersorak-sorak…jangan-jangan……”timpal Gina dengan kalimat menggantung. “Duh…perasaan ku kok jadi gak enak ya…”Rindu ikutikutan menimpali. “Jangan-jangan tawuran lagi!!! Yukkk kita ke sana!!!”Tita berteriak sambil menyeret lengan kedua sobatnya Gina dan Rindu yang terlihat pasrah diseret ke arah keramaian. Sepertinya firasat Rindu memang sangat tepat. Begitu tiba di depan gerbang sekolah ternyata mereka disuguhi pemandangan orang yang sedang berkelahi habis-habisan. Bak di atas ring ke dua pasangan itu saling meninju dan menunjukkan jurus masing-masing. Dan kali ini yang terlibat perkelahian ada 2 pasang pelajar. Mereka berempat adalah Gading, Aldo, Panji dan Oki. Sorak sorai penonton yang terdiri dari pelajar berbaur dengan tukang beca, tukang somay, tukang bajaj makin menyemangati kedua pasang jagoan itu menunjukkan tajinya. Setelah tanya sana sini,

barulah ketiga sobat karib itu ngeh…Ternyata Panji adalah teman Aldo sementara Oki adalah teman Gading. Masing-masing mereka membela teman karibnya yang sudah seperti kucing dan tikus sedari dulu. Spontan Rindu yang notabene merupakan akar permasalahan yang menyebabkan mereka berkelahi menyeruak di tengah kerumunan penonton. Dengan wajah memerah karena menahan emosi yang memuncak, Rindu yang cantik itu berkacak pinggang dan mengeluarkan teriakan bak suara halilintar. Para penonton spontan menutup kuping mereka mendengar teriakan dahsyat itu, begitu pula dua pasangan petinju itu. Mata mereka melotot karena merasa tak senang dihentikan dengan paksa. Tapi demi melihat sosok jelita di depan mereka, berbareng mereka tertunduk dan tersipu. Gading dan Aldo berusaha memasang senyum tergantengnya agar terlihat macho di depan Rindu, padahal badan mereka sudah terasa nyeri sana-sini akibat pukulan . “Kalian ini punya malu enggak seh??!!! Dengar ya!! Aku gak akan memilih kalian berdua, sampai kapanpun. Kalau kalian berkelahi lagi aku putuskan untuk pindah sekolah saja, besok!!” “Hah??? Ja…jangan dong Rindu… ntar kami tidak bisa melihat senyum manismu lagi…”ucap Aldo memelas. “Iii …ya ..yayang Rindu…maafin kami ya… jangan pindah sekolah dong…please???”Gading ikut-ikutan memelas. “Sudah…Sudah…kalau begitu kalian harus saling memaafkan. Ayo sekarang, kamu Gading dan Aldo salaman dulu…”Akhirnya Gina dan Tita ikut angkat bicara. Gina menarik Aldo sedangkan Tita menarik Gading. Mereka mendekatkan kedua orang cowok tersebut, yang akhirnya saling bersalaman. Wajah mereka bersemu merah, tak bisa menahan rasa malu karena di tolak cintanya oleh Rindu. Apalagi ditonton begitu banyak pasang mata. “Nah… gitu dong…. suit…. suit….”spontan penonton berteriak berbarengan. ***

** Tuhan yang penyayang, jika cinta telah engkau tetapkan, maka biarkan hatiku bersabar untuk meraihnya. Sebab aku percaya segalanya telah engkau persiapkan yang terbaik. *end.

Deburan ombak memecah kekosongan jiwa Buih-buih putih kapas menjilati jemari mungil Pasir putih lembut memberi kenyamanan tuk berpijak Semilir angin mengeringkan air mata yang membasahi pipi Kicau burung menghibur hati yang terluka Tapi alam tak mau membasahi bumi dengan hujannya

Kincir Api Ku terpanggang di atas bara kecemburuan Mengasapi hati yang telah hitam Kincir api pun berputar secepat kilat Angin pun memarakkannya Dan aku terbakar olehnya Karya: Darah Syahadah

Noktah Mimpi wibawamu tak lagi fana dalam serpihan luka-luka bisu pada muara keangkuhan yang pekat membungkus angan berdesir di sayup-sayup pilu dan aku terus memujamu meski pun jiwamu kelu sebab tersipu menyapa cemburu

Celah Bayangmu nafas ku memuja pada temaram sebaris kabut dinihari kau bagiku jelmaan jutaan pertanyaan dan cahaya berlianmu menari dalam denting dedaunan lautan mendamba harapan seakan ku tatap riak di beranda menggaungkan langit temaram di balik desiran tangis malam Karya: Desy Annisa

Diam Tak Terarah Gemuruh terdengar Ketakutanku menyeringai Segelintir jiwa melayang Petir menyambar dunia Seolah ingin mengenai ku Namun, angin yang tetap berhembus Menyentuh lembut wajah ku Berbisik akan kedinginan ini Gelapnya malam Semakin membuatku takut Kesendirianku menelan kesepian ku Seolah ku hidup hanya sendiri Tak terlihat... Tak terjamah... Akan harapan untuk bersama dalam satu kehidupan Aku kembali terusik Aku seolah bungkam Saat cinta bersama cintanya Hati berbisik dalam raungan kesakitan hati Hanya terpaku membisu, diam tak terarah..

Tangisanku Bukan Tanda Aku Lemah Waktu itu tak dapat berputar kembali Sejak saat itu Di mana air mataku menetes Membasahi semua harapan ku Hingga rusak dan tak terbaca lagi... Tak sanggup ku tuk mengerti Di kala itu, aku harus belajar ikhlas Ikhlas menerima kehilangan Beratnya aku pikul derita Sangat berat bahkan tak terbayangkan Walau air mata mengiringi perjalanannya Aku terima diperlakukan seperti ini Aku ikhlas disakiti seperti ini Kau tak lihat air mataku Kau tak lihat ringisan ku Tapi kau harus tahu Betapa sakitnya Dengarlah... Aku menangis bukan berarti aku lemah Air mataku akan jadi kekuatanku Air mata ini akan terganti dengan kebahagiaanku... Hati-hatilah.. Suatu saat nanti... Setetes air mataku akan jadi ancaman buat mu...

Pelangi

B4

WASPADA Minggu, 17 April 2011

Tipu Daya Sang Bangau KADINI adalah sebuah danau, airnya jernih, pemandangannya cukup indah membuat senang para penghuninya. Berbagai hewan jenis air merasa aman. Waspada/Dede

Tim dokter dari Departemen Ilmu Kesehatan Komunitas Fakultas Kedokteran USU bersama kepala SD BI Ir. Eriza Dahliana, MSi foto bersama dengan siswa usai melakukan gerakan cuci tangan di sekolahnya, kemarin.

Gerakan Cuci Tangan Di SD-BI Al Azhar Medan SD Bertaraf Internasional Perguruan Al Azhar Medan melakukan aksi hidup sehat melalui kegiatan ‘Ayo hidup sehat dengan mencuci tangan yang dan benar’ bekerjasama dengan Departemen Ilmu Kesehatan Komunitas Fakultas Kedokteran USU, kemarin. Kegiatan yang dilaksanakan di gedung Audiovisual dan Multimedia SD Bertaraf Internasional Al Azhar Medan dihadiri siswa kelas IV SD internasional, akselerasi, plus dan regular mendapat sambutan yang sangat baik dari para siswa. Selain mendengarkan ceramah dan presentasi mereka juga di pandu dengan bagaimana cara mencuci tangan yang baik dan benar, acara di akhiri dengan games dan foto bersama para dokter, dokter muda dari Departemen Ilmu Kesehatan Komunitas Fakultas Kedokteran USU Medan. Kepala SD Bertaraf Internasional Ir. Eriza Dahliana, MSi didampingi para fungsionaris dan wali kelas, menyambut baik acara ini dan menyampaikan ucapan terimakasihnya kepada pimpinan rombongan. “Semoga acara seperti dapat terus berjalan dengan berbagai cara hidup sehat lainnya dan program dokter cilik. Hal ini, seiring dengan program perguruan, SD Al Azhar khususnya juga telah melakukan medical record bagi siswa secara berkala di Perguruan Al Azhar Medan melalui UKS “Klinik Ar Rahman”. Dijelaskan Eriza Dahliana materi yang diberikan meliputi pentingnya cuci tangan yakni mencuci tangan dapat mencegah terjadinya penularan penyakit seperti sakit perut, muntah mencret, batuk pilek dan cacingan. Kemudian, kapan saja perlu dilakukan cuci tangan. Meliputi, sebelum makan, sebelum dan sedang menyiapkan makan, setelah menggunakan toilet, setelah dan sebelum menjenguk orang sakit, setelah bersih, batuk, atau menggosok hidup, setelah memegang binatang atau kotoran binatang, setelah memegang sampah dan sebelum dan setelah mengobati luka. (m43)

Mereka hidup damai tanpa ada gangguan. Suatu hari datanglah seekor bangau yang terbang di atasnya. Ia amat terpesona melihat keindahan. Dengan segera ia pun mendaratkan sayapnya di sisi danau itu. Di tepi danau itu ia mengambil sikap berdiri dengan satu kaki menghadap ke arah danau, seakan-akan ia menjadi seekor bangau pertapa yang telah meninggalkanalamkeduniawian. Berhari-hari ia bersikap demikian tanpa bergerak-gerak sedikitpun. Lama-lama ikan-ikan di danau merasa heran dan mereka mulai berani mendekati bangau yang sedang "bertapa". Dua ekor ikan mencoba lewat dimuka bangau itu. Tapi bangau tidakmengubahsikapsedikitpun. Ia seakan-akan tak mempunyai nafsu lagi untuk menikmatinya. Akhirnya semua ikan di danau itu tak merasa takut lagi padanya, dan mereka tak merasa khawatir akan dijadikan mangsa bangauitu.Suatuhari,karenarasa ingin tahunya, raja ikan di danau itu bertanya pada bangau : "Mengapa kau sedih wahai bangau?" "Oh ikan yang baik, aku berbuat demikian ini adalah atas kehendak dewa. Aku telah sadar darisegalaperbuatankuyangtelah lalu, yang membuatku sangat berdosa besar terhadap dewadewa. Sebab itu aku hendak menebus dosa-dosaku itu dengan petunjuknya, dan mulai saat ini aku tak mau lagi memusuhi sesamamahluk,termasukengkau ikan-ikan, apa lagi memakannya. Alangkah gembiranya ikanikan mendengarnya. Tetapi beberapaharikemudianalangkah herannya ikan-ikan ketika

dilihatnya bangau menangis. Maka bertanyalah sang raja ikan: "Hai bangau! mengapa engkau menangis?" Oh ikan, alangkah sedihnya aku, jawab bangau sambil terus mengisak-isak. "Mengapakahdemikian,bangau?" tanya ikan lagi. Sebenarnya akan datang bencana yang bakal menimpa kita sekalian, penghuni danau indah ini. Aku telah mendengar kabar,bahwatiadabeberapalama lagi para nelayan akan mengadakan penangkapan ikan besarbesaran. Mereka telah membuat jala, pancing dan bubu sebanyakbanyaknya. Oh ikan, itulah yang menjadi buah pikiranku selama ini.Karenaituikan-ikan,akuhanya dapat berpesan, berhati-hatilah kalianmenghadapibencanayang bakal tiba. Aku berdosa tidak bisa melindungi agar kalian dapat menyelamatkan diri masingmasing terhadap nelayan yang serakah itu." Mendengar berita itu alangkah sedihnya hati para ikan. Merekasalingbertangisandihadapan bangau sambil meratap-ratap. Oh bangau, tiadakah engkau dapat memberi pertolongan agar kami dapat terlepas dari bencana itu? Hm, ikan-ikan, aku punya

akal. Aku bersedia memberi pertolongan, memindahkan kalian satu persatu ke danau lain tak jauh dari sini. Karena rasa takutnya terhadapbencanayangakanmenimpa ikan-ikan itu, maka satu-persatu ikan-ikan diterbangkan. Tetapi bangau itu tidak terbang menuju tempatyangdijanjikan.Melainkan dibawanya ke sarang mereka. Disana dengan lahapnya dimakannya ikan-ikan itu. Demikian seterusnya, sampai ikan-ikan di danau itu habis. Kini tinggallah seekor ketam didanauituyangbelumdipindah. Iapun dibawa terbang oleh bangau. Tapi serentak ia hendak menukik kesarangnya, ketam itu melihat banyak sekali darah dan duri-duri ikan disana. Tahulah ketam itu, bahwa iapun hendak dimangsa bangau yang serakah itu. Ketika bangau itu menukik turun, cepat-cepat ketam itu menjepit leher bangau itu. Bangau itu segera menggelepar tak berdaya. Lepaskan aku! Lepaskan! teriaknya parau. Ketam itu makin memperkeras jepitannya hingga akhirnya putuslah leher bangau itu. Darahnyamengucur.Jadibangau itu binasa. (H)

Mengisi Kotak

Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhlukAllah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Malaikat Memberitahu Uzair Berapa Lama Ia Tidur

Kupon Seri

“Bagaimanakah orang-orang yang sudahmati dan hancur itu akan dihidupkan oleh Tuhan kembali di negeri akhirat.” Begitulah pertanyaan yang dating dalam fikirannya dan tidak terjawab olehnya sehingga dia menjadi lemah lunglai dan kemudian terus tertidur. Dalam tidur itu dia seakan-akan bertemu dengan semua arwah orang-orang yang sudah meninggal itu. Tidurnya amat luar biasa sekali, bukan hanya sejam atau semalam, tetapi dia telah tertidur terus menerus tanpa bangun-bangun selama seratus tahun lamanya. Dalam masa tertidur itu, keadaan di sekitarnya sudah banyak penduduk baru, rumah serta bangunan-bangunan banyak yang telah didirikan. Dalam waktu seratus tahun itu semuanya sudah berubah, ketika Uzair tetap terus tidur bersandar di dinding buruk itu menjadi jasad (tubuh) yang tiada bernyawa lagi. Dagingnya sudah hancur dan tulang belulangnya sudah berderai. Bersambung **m31/Darul Nu’man

V Tempel DiAmplop

Sayembara Mewarnai Berhadiah Hadiah I : Rp75.000 + Hadiah II : Rp50.000 + Hadiah III : Rp25.000 + Untuk harapan I s/d mendapatkan bingkisan dan sertifikat.

sertifikat sertifikat sertifikat III akan

Syarat-syarat peserta 1. Peserta bebas menggunakan alat pewarna apa saja. 2. Peserta terbatas hingga kelas VI SD, menyantumkan nama, alamat yang jelas 3. Sudah sampai di meja redaksi selamat-lambatnya tanggal 31 Mai 2011 Nama Sekolah Alamat

Ada berapa benda di kamar si Pewe. Isilah kotak-kotak ini dik, dan adik telah dibantu dengan satu huruf.

Mencari Jalan

: .............................................................................. : .............................................................................. : ..............................................................................

Seorang pembalap sepeda melajukan kenderannya menuju Finis, jalan manakah yang harus ditempuhnya agar segera sampai.

WASPADA Minggu 17 April 2011

Potret

B5

Aktifitas masyarakat di kawasan hutan lokasi tambang.

Tambang Emas Madina Semakin Marak KEGIATAN tambang emas masyarakat di Kec. Hutabargot, Kab. Mandailing Natal (Madina) yang mulai sejak bulan Maret 2010 lalu makin marak dan merajalela. Ribuan masyarakat dari 23 kecamatan di Madina saat ini menggantungkan nasib dari hasil tambang emas.

Pemecahan batu emas oleh warga

Berbagai aktifitas masyarakat langsung terlihat disini. Ada yang membuatlubanglangsungsecara kelompok, melangsir batu dengan harga Rp 2000 per-kg dan memecah batu dengan harga Rp 1000per-kg. Karena karena itu dalam waktu singkat kawasan hutan lindung Taman Nasional Batang Gadis (TNBG) yang menjadi lokasi tambang rakyat telah di obrak –abrik. Seribuan lobang tambang yang di gali manual dengan kedalaman 25-70 meter banyak ditemukan disini. Sejalan dengan itu, ratusan alat pemisah emas dari batu dinamakan galundung makin banyak beroperasi tanpa aturan. Harga mesin galundung dapat di beli dari Pulau Jawa dengn harga mencapai Rp.22 juta per mesin.

Walaupun tergolong mahal, mesin galundung di Madina bertambah terus kini mencapai seribuan. Galundung banyak beoperasi di kawasan hutan TNBG Desa Hutajulu, Kec. Hutabargot. Kemudian menjalar ke kawasan Panyabungan Kota dan Panyabungan Utara. Pengoperasian mesin galundunginilahkemudianmenjadi masalah dan di khawatirkan memicu konflik di tengah masyarakat. Selain karena penggunaan air raksa tidak beraturan, juga karena limbah mesin galundung bercampur air raksa di buang langsung ke aliran sungai yang di pakai warga untuk mandi,cuci, kakus (MCK) setiap waktu. UntukwilayahPanyabungan, limbah air raksa (mercury) mengalir di aliran Sungai Batang Gadis dan Aek Pohon. Sedangkan di Kec. Hutabargot mengalir di Sungai Aek Simalagi dan Aek Siarahan, yang menurut Bappedalda Madina setelah di teliti sudah positif tercemar. Masyarakat juga berharap usai Pilkada putaran 2 nanti, tambang emas ilegal ini bisa ditertibkan dan menjadi PAD terbesar di Sumatera Utara yang otomatis dapat Madina maju dalam segala pembangunan. Madina memang kaya akan sumber daya alam, tidak hanya emas. ďż˝ Sarmin Harahap

Emas setelah di pisah dari batu

Lubang Tambang

Proses penggalundungan

Fotofoto Sarmin Harahap

Peroses pemisahan emas dari batu setelah di galundung

Curhat

B6

Konsultasi Teknologi Informasi Diasuh oleh Network And Open System Community

From : 0857608xxxxx Hai NOS..semoga makin jaya..aku mau nanya bagaimana cara membuat 3 lagu menjadi satu lagu dan apa softwarenya? Terima kasih atas jawabannya… Jawab : Hai, untuk menggabungkan beberapa lagu menjadi satu dapat dilakukan dengan menggunakan software pengolah suara seperti cool edit pro, adobe audition, dll. Cara untuk menggabungkan 3 lagu menjadi 1 lagu sangat mudah, buat layer-layer pada software pengolah suara yang kamu miliki dan masukkan satu persatu lagu yang ingin kamu gabungkan kedalam layer-layer tersebut, buat transisi antar lagu sehingga perubahan dari satu lagu terasa smooth, dan simpan dalam format mp3 atau format file suara lainnya. Semoga dapat membantu, terima kasih. From : 0878671xxxxx Hai NOS, saya heran laptop saya koq baru saja saya install drivernya koq tiba-tiba jadi uninstall ya Jawab : Hai, sebelumnya kami harus mengetahui jenis driver apa yang sedang kamu install? Apakah kamu

Minggu 17 April 2011

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

From : 0813705xxxxx Hai NOS..saya mau nanya, gimana caranya untuk menghilangkan file autorun pada memori hp, padahal sudah menscannya di PC tapi tidak juga terhapus. Mohon bantuannya. Jawab : Hai, sebelumnya kami ingin mengetahui, apakah kamu melakukan scanning menggunakan anti virus? Kemungkinan besar autorun tidak bisa terhapus karena anti virus yang kamu gunakan tidak mampu untuk mendeteksi induk virus yang memunculkan autorun di memori hp kamu. Coba gunakan antivirus lain yang lebih berkompeten sehingga induk virus dapat dideteksi dan dihapus. Apabila induk virus sudah dihapus, maka menghapus autorun dapat dilakukan secara manual seperti menghapus file biasa. Sedangkan untuk antivirus yang kami sarankan adalah PCMAV dengan tambahan CLAMAV atau dengan menggunakan antivirus MSE yang sudah diupdate, keduanya dapat anda dapatkan gratis di internet. Semoga dapat membantu, terima kasih.

WASPADA

No 082161353595, Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu. Tanya: Ady – Hp 081379654xxx Pagi Mbak… kenalin aku Ady.. pengen curhat. Gimana ya mbak biar bisa terbuka ngomong ke orang tua buat ngungkapkan perasaan atau minta sesuatu ke ortu? Jadi aku suka bingung buat nyelesaikan sendiri terutama bila harus ngelibatkan ortu. Makasih sebelumnya mbak Fifi.

baru install ulang? Apa jenis OS yang kamu gunakan? Bagaimana spesifikasi hardware laptop kamu? Kemungkinan yang dapat kami tangkap dari pertanyaan kamu adalah driver kamu tidak kompatibel dengan OS atau driver kamu tidak terinstall dengan sempurna sehingga driver kamu langsung rollback. Pastikan driver yang kamu gunakan memang dibutuhkan oleh laptop kamu dan sesuai dengan jenis sistem operasi yang kamu gunakan, semoga dapat membantu, terima kasih. From : 0819906xxxxx Aslm NOS..bagaimana caranya mendapatkan software deepfreeze..terus bagaimana cara menggunakannya? Jawab : Wslm, software deepfreeze edisi trial 30 hari evaluation bisa kamu dapatkan pada situs resmi mereka yaitu di http:// www.faronics.com/en/ DownloadEvaluationEditions.aspx. selain disitus resmi mereka, kamu juga bisa mencarinya di situs-situs sharing seperti brothersoft, dl4all dan lainlain. Atau kamu bisa juga mencarinya pada toko-toko software yang ada didaerah kamu. Cara pakainya cukup sederhana, install software deepfreeze, buka aplikasinya, pilih partisi

PEMBERITAHUAN : Website NOS Community sudah dapat diakses dari internet pada alamat http://www.noscommunity.org, saat ini fasilitas yang disediakan hanya forum untuk sharing ilmu pengetahuan dan tanya jawab.Website dan repository artikel segera menyusul. Segera daftarkan diri anda sekarang pada website noscommunity dan mari bersama-sama majukan IT Indonesia. Kirimkan permasalahan komputer dan jaringan yang anda kelola ke noscommunity@gmail.com atau SMS ke nomor 081370311355. SMS dan email yang anda kirim akan kami jawab sesuai giliran masuk hanya pada SKH Minggu Waspada.

yang akan dibekukan, klik accept terus restart komputer kamu, setelah restart, maka pc kamu sudah dibekukan dan tidak bisa ditambahi atau dikurangi apapun. Semoga dapat membantu, terima kasih.

membantu, selamat mencoba dan terima kasih.

From : 0819774xxxxx Aslm NOS, saya Syahar dari Kisaran..saya mau tanya bagaimana caranya menambahkan sistem linux dikomputer saya? Terima kasih sebelumnya ya NOS.

Jawab : Wslm Jodhy, cara burning cd sangat mudah, pastikan drive CD/DVD kamu adalah tipe yang writeable sehingga kamu bisa melakukan burning. Install aplikasi burner seperti NERO pada komputer kamu, dan sediakan file serta CD/DVD kosong untuk media penyimpanan data. Masukkan cd ke dalam CD/ DVD drive, buka aplikasi NERO, pilih jenis pembakaran (Audio, Video, VCD, dll), masukkan data, kemudian klik start burning, sangat mudah. Yang perlu kamu perhatikan, jangan melakukan burning dengan kecepatan maksimal, karena bisa saja hasil burning yang dilakukan akan rusak. Gunakanlah kecepatan menengah dari kapasitas CD/DVD drive kamu sehingga hasil yang didapatkan bagus, selamat mencoba dan terima kasih.

Jawab : Wslm Syahar, kamu dapat menambahkan sistem linux kamu dengan dua cara, menginstall baru atau menambah OS dikomputer kamu (Dual Boot). Kalau kamu ingin menginstall baru, caranya sangat mudah, sama seperti menginstall windows, pastikan first boot berasal dari cd/dvd drive, kemudian biarkan saja instalasi linux berjalan, linux saat ini sudah sangat user friendly dan proses instalasinya sudah berbasiskan GUI. Sedangkan bila kamu ingin dual boot, caranya juga sangat gampang, kamu cukup menyediakan dua partisi kosong pada komputer kamu, sediakan satu untuk partisi SWAP (rekomendasi besar partisi 2 kali RAM yang kamu gunakan) dan satu untuk partisi linux. Apabila sudah diset, lakukan instalasi seperti pada install baru, akan tetapi pada saat menu peletakan sistem operasi pastikan kamu memilih partisi kosong sebagai tempat peletakan sistem operasi baru kamu. Apabila sudah selesai, restart komputer kamu, Linux akan mengoverride dengan GRUB yang dimiliki sehingga saat booting komputer kamu akan diberi pilihan, apakah kamu ingin menggunakan linux atau sistem operasi kamu yang lama, sangat mudah. Semoga dapat

From : 085662xxxxx Aslm NOS, saya Jodhy ingin bertanya cara burning CD. Mohon bantuannya..Trims NOS.

Jawab: Selamat pagi Ady.. Mbak maklum koq, karena engga semua orang tua terbiasa ngobrol dekat dengan anaknya, sehingga sebagai anak juga ikut merasa sungkan ngobrol dekat dengan beliau. Mungkin pola asuhan sebelumnya juga ikut melatar belakangi. Tapi jangan khawatir.. dengan pendekatan bisa koq jarak itu menjadi lebih baik. Biar bisa lebih dekat dan terbuka buat ngomongin sesuatu.. kamu mulai PDKT dengan ortu, Di saat santai temani beliau.. missal saat papa baca koran atau mama nonton TV.. kamu mulai ngobrol dari hal yang umum, seputar pekerjaan beliau, teman-temanmu atau film yang lagi ditonton yang penting bisa menciptakan suasana menjadi dekat. Kalau bisa ngobrol begini, artinya kamu mulai nyaman dan bisa lebih terbuka pada beliau. Selanjutnya tentu akan mengalir dengan sendirinyai.. Jadi tenang aja, proses itu akan berjalan secara alami koq. Mudah-mudahan papa mama bisa menjadi sahabat terbaikmu. Tanya: Melati – Hp 085746536xxx Assalamualaikum, Mbak Fifi.. bantuin donk. Aku punya teman yang suka minjam barang-barangku, waktu minjam.. mintanya baik-baik , tapi giliran balikkin susah banget. Kalau engga dikasi pinjam dia suka bilang aku bukan teman yang baik. Gimana ya mbak menghadapi teman yang seperti ini.. sampai saat ini ada beberapa barang kesayanganku yang belum dikembalikannya. Makasih Jawab: Waalaikumsalam , Dear Melati Dalam pertemanan selalu ada take n give, artinya gak melulu take ataupun give, harusnya sih.. gantian agar salah satunya tidak merasa dimanfaatkan. Kalau salah seorang maunya take terus.. maka pertemanan akan menjadi timpang. Nah menghadapi temanmu, adik harus bersikap tegas. Saatnya kamu belajar bilang tidak atas tindakannya yang tidak kamu sukai. Teman seperti ini suka memanfaatkan kebaikan orang lain. Kalau ia kembali datang untuk meminjam barang-barangmu, sebaiknya adik mencontoh aturan di perpustakaan. Barang baru boleh dipinjam setelah mengembalikan barang yang sebelumnya. Bila perlu mampir ke rumahnya sambil meminta kembali barangmu. Teman yang suka nodong (memaksa) dan mengancam dengan kata-kata, kamu bukan teman yang baik.. sebaiknya jangan selalu dituruti apa maunya, nanti akan menjadi kebiasaan mengatur dirimu. Melati yang baik.. saatnya kamu mulai mencari teman yang sesuai dan seimbang dengan dirimu. Perbanyak link pertemanan, akan membuat posisimu

Konsultasi Remaja

semakin kuat karena ada banyak pilihan teman yang klop dengan dirimu, semoga sukses! Tanya: Fida – Hp 6287892360xxx Mbak Fifi,,aku punya kenalan dari Fb (Face Book),,kita cuma sms-an itu pun cuma malam doang mbak, gak pernah telfon-telfonan apa lagi ketemuan,, itu berlangsung udah 4 bulan...apa aku senang banget ama dia n mungkin aku juga suka? ..Gimana nih..aku salah gak mbak sama perasaan ini ,,? Makasih mbak… Jawab: Dear Fida Senang ya punya banyak teman, kita jadi mengenal bebarapa karakter orang. Dari mengenal kemudian kita bisa merasa cocok, karena banyaknya kesamaan, missal dari hobby sehingga nyambung dalam obrolan. Nah sama seperti yang saat ini kamu rasakan.. kamu merasa klop ngobrol dengan temanmu itu. Jadi tidak ada yang salah dengan perasaanmu. Kalau kemudian perasaan ini diteruskan menjadi rasa suka.. wajar aja, tapi harus juga melihat apakah temanmu itu juga memiliki perasaan yang sama? Kalau ternyata dia hanya menganggap sebagai teman curhat.. adik harus bisa menerimanya. Masalahnya komunikasi kalian hanya ber smsan belum pernah ketemuan dan ngomong langsung. Bahasa sms tidak sepenuhnya mencerminkan karakter asli seseorang. Jadi Fida.. sebaiknya temenan aja…suka boleh-boleh aja, tapi jangan dilanjutkan kemana-mana.. sekedar sahabatan di udara. Kalau suatu saat kalian ketemu dan akhirnya bisa dekat, why not? Pesan mbak.. kenali dulu sifat dan karakter seseorang, apabila memberi pengaruh positip dan kemajuan bagi dirimu.. engga papa deh difikirin buat jadi teman dekat. Salam. Tanya: Nurul – Hp 6285658558xxx Assalamualaikum,mbak Fifi.,.kenalin aku Nurul.,. pengen nanya.,! mbak nurul uda punya cowo sementara temen satu kelas juga suka sama nurul.,.dia bingung dengan perasaannya yang suka kangen sama nurul. tapi gimana mbak, nurul kan uda punya cowo .,makasih., Jawab: Waalaikumsalam, Dear Nurul Kamu gadis yang menyenangkan.. karena banyak orang pengen dekat dan jadi pacarmu. Jadi gadis yang asyik tentu didukung dari good personality alias kepribadian yang oke. Jadi ngapai musti bingung bila kamu ditaksir cowo sementara adik udah memiliki pacar.. Kamu cukup menanggapi dengan senyum dan mengatakan senang atas perhatiannya.. namun tidak bisa menerimanya karena kamu sudah memiliki pilihan. Menolak seseorang jangan setengah-setengah, maksudnya jangan seperti memberi harapan. Karena ada sebahagian orang takut menolak karena tak ingin kehilangan fans-nya.. ntar akan membingungkan orang itu. Gadis yang asyik.. memiliki banyak teman tapi bukan banyak koleksi pacar.. salam

From : 0852777xxxxx Aslm NOS! nama saya Aswadi, tinggal di Kocan. Saya mau nanya gimana caranya menghilangkan/ menghapuskan virus yang bernama RECYCLER? Terima kasih.. Jawab : Wslm Aswadi, virus RECYCLER dapat dibasmi dengan mudah dengan menggunakan antivirus MSE dengan update terbaru. Anda dapat mendownloadnya dari internet, pasang dikomputer anda, lakukan full scan, dan bersihkan komputer anda. Selamat mencoba, dan terima kasih.

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Gaji Pensiun Di PTPN Selamat pagi, Pak Thoga. Saya karyawan di salah satu PTPN di Sumatera Utara dan telah bekerja lebih 26 tahun. Yang mau saya tanyakan: 1. benarkah perusahaan tempat saya bekerja itu yang mengatur gaji pensiun PTPN dibayar 70% dari gaji saya terakhir tahun 2002. 2. adakah Undang-Undang yang mengatur gaji pensiun di PTPN dibayar 70% dari gaji terakhir dan golongan terakhir. Terima kasih atas jawaban Bapak. Jawab: Selamat pagi. Tentang pembayaran gaji pensiun di PTPN, sudah ada diatur secara jelas di dalam Perjanjian Kerja Bersama (PKB), yang seharusnya PKB ini dibagikan kepada setiap karyawan agar mengetahui apa yang menjadi hak dan

kewajiban masing-masing pihak yaitu pimpinan perusahaan dan karyawan. Pemilikan PKB oleh karyawan diatur dalam Undang-Undang No. 13 Tahun 2003 Pasal 126 ayat (1) Pengusaha, serikat pekerja/serikat buruh dan pekerja/buruh wajib melaksanakan ketentuan yang ada dalam PKB; (2) Pengusaha dan SP/SB wajib memberitahukan isi PKB atau perubahannya kepada seluruh pekerja/buruh; (3) Pengusaha harus mencetak dan membagikan naskah PKB kepada setiap pekerja/ buruh atas biaya perusahaan. Dalam PKB ada diatur secara jelas ketentuan tentang pembayaran gaji pensiun karyawan, yang diatur sesuai dengan lamanya masa kerja dan presentasenya ditentukan dengan lamanya masa kerja. Untuk itu agar Sdr membaca

atau meminta kepada pengusaha PKB tersebut sesuai dengan hak Sdr yang diatur dalam UU atau kalau pengusaha tidak mau memberikan, Sdr memintanya melalui SP PTPN dan kalau juga tidak diindahkan oleh SP atau pimpinan PTPN maka kewajiban Sdr untuk mengadukannya ke kantor Dinas Tenaga Kerja setempat untuk ditangani. Jadi tidak dibenarkan PTPN, apalagi sebagai perusahaan Negara merahasiakan isi PKB kepada karyawan, dan seharusnya PTPN harus memberikan contoh yang baik sebagai perusahaan Negara kepada perusahaan-perusahaan swasta lainnya. Pembayara pensiun kepada karyawan yang diatur dalam PKB PTPN tidak boleh bertentangan dengan UU yang berlaku dan apabila bertentangan

akan dikenakan sanksi hukum berupa sanksi pidana. Sebagai contoh bila mengacu kepada UU No. 13 Tahun 2003 Pasal 167 ayat (5), melanggar ketentuan pembayaran pensiun akan dikenakan sanksi pidana sesuai Pasal 184 yaitu penjara paling singkat 1 tahun dan paling lama 5 tahun dan/atau denda paling sedikit Rp 100.000.000 dan paling banyak Rp 500.000.000 dan pelanggaran ini merupakan tindak pidana kejahatan.

Pesangon Pekerja Borongan Selamat pagi, Pak Thoga. Nama saya Jonson, bekerja di sebuah perusahaan perabotan di Medan, mau menanyakan kepada Bapak tentang penetapan pesangon bagi pekerja borongan apabila diberhentikan/di

PHK oleh pengusaha dengan masa kerja 5 tahun. Bagaimana penetapan upahnya, karena upah saya tiap bulannya tidak tetap Karena tergantung kepada banyaknya pekerjaan borongan dan dibayar setiap minggu. Mohon penjelasannya Pak, sesuai dengan peraturan yang ada dan terima kasih. Jawab: Selamat pagi, Sdr Jonson. Tentang pertanyaan Sdr bagaimana menetapkan upah borongan yang tidak tetap besarnya setiap bulan dikaitkan dengan pembayaran pesangon bila perusahaan memPHK pekerja/buruh. Pertamatama alasan PHK yang dilakukan oleh perusahaan. Kalau Sdr. di PHK tanpa kesalahan maka Sdr mendapat pesangon 2x peraturan Undang-undang No.13 tahun 2003 tentang Ketenagakerjaan (UUK) Pasal 156 ayat (2e), yaitu 2 x

5 bulan upah ditambah 2 bulan uang penghargaan (Pasal 156 ayat 3a) ditambah 15% dari jumlah uang pesangon dan uang penghargaan (Pasal 156 ayat 4c). Apabila Sdr melakukan kesalahan kecil/ringan misalnya mangkir, membantah perintah atasan atau malas bekerja, pokoknya bukan kesalahan berat sebagaimana dimaksud dalam Pasal 158 seperti mencuri, menganiaya, perbuatan asusila, mabuk, dll. sejenis, mendapat pesangon 1 x 5 bulan upah ditambah 2 bulan uang penghargaan ditambah 15% dari uang pesangon ditambah uang penghargaan. Mengenai penetapan upah borongan yang besarnya tiap bulan tidak

tetap maka perhitungannya adalah berdasarkan Pasal 157 ayat (3) yaitu, dalam hal upah pekerja/buruh dibayarkan atas dasar perhitungan satuan hasil, potongan/borongan atau komisi, maka penghasilan sehari adalah sama dengan pendapatan rata-rata per hari selama 12 (dua belas) bulan terakhir, dengan ketentuan tidak boleh kurang dari ketentuan upah minimum provinsi atau kabupaten/kota (dalam hal ini kota Medan). Untuk itu Sdr menghitung berapa rata-rata upah Sdr dalam 12 bulan terakhir dijumlahkan dan dibagi 12 dan dapatlah upah Sdr per bulan. Upah minimum kota Medan tahun 2010 Rp 1.1 juta artinya upah rata–rata tidak boleh dibawah upah minimum

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui Email:thogasitorus@yahoo.co.id, HP:0811632554

tersebut. Sekarang tergantung apa kesalahan yang dituduhkan oleh pengusaha kepada Sdr PHK tanpa kesalahan atau dengan kesalahan kecil/ ringan, tinggal menghitung sesuai ketentuan di atas atau boleh juga diselesaikan dengan musyawarah dan mufakat dengan pengusaha dengan kesepakatan kedua belah pihak dengan pengertian karena perusahaan tempat Sdr bekerja adalah perusahaan kecil. Kalau tidak ada kesepakatan atau penyelesaian maka permasalahannya dibawa ke kantor Dinas Tenaga Kerja setempat untuk di mediasi/ di perantarai sesuai dengan UU no.2 tahun 2004 tentang Penyelesaian Perselisihan Hubungan Industrial (PPHI).

Kupon Konsultasi

Kesehatan

WASPADA Minggu 17 April 2011

Gatal-gatal Akibat Ulat Bulu SERANGAN ulat bulu yang mewabah di beberapa daerah akhir-akhir ini kabarnya diakibatkan karena iklim yang ekstrim dan tak menentu. Keresahan yang ditimbulkannya bukan saja pada para petani yang tanamannya diserang, namun bagi kesehatan, ulat bulu ini juga punya pengaruh terutama terhadap rasa gatal akibat iritasi yang bisa ditimbulkannya. Selain menyerang kulit, ulat bulu juga bisa mengakibatkan gangguan pada mata dan beberapa organ lain dalam kasuskasus berbeda yang pernah dilaporkan. Sebenarnya, hal ini bukan penyakit aneh namun karena selama ini dianggap sederhana maka tak menyita banyak perhatian hingga wabah tersebut muncul. Di saat kita berjalan-jalan di daerah yang dipenuhi pepohonan terutama anak-anak yang senang bermain-main di daerah rerumputan dan di sekitar pohon rindang, gatal-gatal kerap mengganggu mereka. Salah satu penyebabnya adalah bulu hewan, termasuk ulat bulu ini. Sekilas Tentang Gatal Akibat Ulat Bulu Ada banyak penyebab yang bisa menimbulkan gatal-gatal akibat adanya reaksi iritasi atau alergi pada kulit yang muncul setelah bermainmain di daerah penuh tanaman. Selain serbuk sari tanaman, bulu hewan-hewan kecil juga kerap menjadi penyebabnya. Ulat bulu adalah salah satunya, dimana gangguannya bisa berupa hanya kemerahan sampai pembengkakan hingga sensasi terbakar pada sebagian orang. Bulu hewan yang menempel pada pakaian hingga bahan-bahan lain termasuk kursi, sofa atau kasur juga bisa berpindah selanjutnya ke individu lain sehingga menimbulkan gejala yang sama. Wabah serangan ulat bulu yang sekarang terjadi sudah menunjukkan banyaknya warga sekitar yang datang berobat karena serangan tersebut. Ulat bulu atau hairy caterpillar adalah sejenis ulat kepompong dalam metamorfosisnya menjadi kupu-kupu yang berasal dari keluarga serangga Lepidoptera. Ada banyak jenis ulat bulu yang dalam ilmu biologi mungkin dibahas secara lebih mendetil, namun pada dasarnya bukan semuanya dapat menyebab-

kan iritasi pada kulit. Gatal yang terjadi setelah adanya reaksi alergi pada kulit terpapar disebabkan oleh sejenis racun pada bulunya yang dihasilkan secara fisiologis untuk menghadapi ancaman dari lingkungan sekitarnya, sementara bulu (chaeta/seta)nya yang menempel dan mungkin tak terlihat oleh mata saja sudah bisa menimbulkan iritasi bila menempel di beberapa organ halus seperti mata. Jadi tanpa adanya jenis ulat bulu yang memiliki zat berbahaya itu, seperti beberapa berita yang menyebutkan bahwa spesies yang ditemukan di beberapa daerah bukanlah yang beresiko, tetap bisa ada gangguan yang terjadi. Racun dalam beberapa jenis ulat bulu itu sendiri beragam, termasuk yang dikenal dengan sebutan zat asam semut, yang termasuk asam keras yang dapat mengiritasi kulit manusia. Gatal yang terjadi selanjutnya adalah reaksi alergi yang dijalankan tubuh untuk melawan reaksi masuknya zat tersebut ke dalam tubuh. Karena itu pula beberapa segi pengobatan tradisional yang selama ini lebih banyak membahas gangguan gatalgatal akibat ulat bulu ketimbang penelusuran medis, mengenal beberapa tanaman seperti kunyit dan banyak lagi untuk mengatasi reaksi itu. Dari segi medis sendiri, beberapa zat dalam tanaman pengobat itu rata-rata bersifat basa untuk menetralisir asam yang masuk dari yang dihasilkan oleh bulu ulat tadi. Wa-lau belum sepenuhnya bisa dipastikan tak akan mengakibatkan iritasi lain terutama pada individu tertentu yang memiliki hipersensitifitas terhadap beberapa bahan tanaman tradisional, namun cara-cara tradisional tadi selama ini banyak digunakan oleh masyarakat yang tinggal di daerah yang banyak pepohonan rindang dalam lingkungannya.

Pencanangan Bulan Bakti IBI KBKesehatan Asahan Implant Paling Banyak Diminati

Pelayanan KB gratis bagi keluarga miskin yang digelar di Kabupaten Asahan meraih akseptor KB IUD dan implant terbanyak. Sekitar 71 pasangan usia subut (PUS) dan 60 PUS memilih KBIUD dan implant. “Dengan IUD lebih mudah dan bisa tahan hingga 10 tahun. Setelah pemasangan IUD, kita boleh kontrol sama bidan desa dan tidak perlu harus setiap bulan ke Puskesmas untuk suntik ataupun ambil pil,”kata Pipiet, warga Asahan yang diijinkan suami untuk berKB IUD karena resikonya lebih kecil. Sementara Suriati, ibu dengan dua anak lebih memilih implant. “Saya tidak takut dipasang implant dan tidak sakit kok waktu dipasangnya. Implant juga bisa tahan lama yakni 5 hingga 10 tahun dan lagipula saat ini gratis,”kata Suriati yang pernah menanyakan pemasangan implant di Rumah Sakit Umum Daerah dengan program KB mandiri bisa mencapai Rp 800 ribu dan Rp 1,5 juta jika di Klinik dan Rumah Sakit Swasta . Implant adalah alat kontrasepsi KB yang dipasang di lengan di bawah jaringan kulit. Sedangkan IUD (spiral) adalah alat kontrasepsi yang dipasang di dalam rahim (AKDR). Kedua alat kontrasepsi ini bisa tahan 5-10 tahun. Pemasangannya mudah dan bisa dilakukan oleh bidan Puskesmas maupun bidan desa serta cukup mendatangi Puskesmas untuk kontrol pemakaiannya, kata Pelaksana Tugas Badan PP dan KB Kabupaten Asahan Drs Suhairy saat ditemui seusai kegiatan pencanangan Bulan Bakti Ikatan Bidan Indonesia (IBI) KBKesehatan tingkat Kabupaten Asahan tahun 2011 yang dilaksanakan di Lapangan Puskesmas Pembantu (Pustu) Kelurahan Sentang Kecamatan Kota Kisaran Timur Kabupaten Asahan. Pencanangan Bukan Bakti IBI KB-Kesehatan yang digelar di Asahan dibuka oleh Bupati Asahan yang diwakili Kepala Dinas Kabupaten Asahan Drg H Habinasaran Nasution. Menurut ketua panitia Hj Anna Asnaini Matondang yang membacakan laporannya menyebutkan kegiatan pencanangan bulan bakti IBI KB-Kesehatan dilaksanakan bersamaan dengan kegiatan pelayanan KB dan pemeriksaan kesehatan secara gratis. Untuk pelayanan KB gratis yang dilaksanakan yakni medis operasi pria (vasektomi) sebanyak 11 akseptor, IUD (spiral) 71 akseptor, Implant atau yang lebih dikenal dengan istilah susuk KB sebanyak 60 akseptor, suntik sebanyak 33 akseptor, pil sebanyak 44 akseptor dan kondom sebanyak 12 akseptor. Pencanangan bulan bakti IBI KB-Kesehatan Kabupaten Asahan tahun 2011 ini kata Suhairy dihadiri juga Sekretaris Dinas Kesehatan H Jamaluddin, Camat Kecamatan Kota Kisaran Timur Rahmad Hidayat Siregar S.Sos, M.Si, dan Camat Kecamatan Kota Kisaran Barat Hj Sri Humiatsih SE beserta Sekretaris Camat Kecamatan Kisaran Timur Adi Putra Pasaribu SAP MAP. *Ayu Kesumanintyas

Pengaruhnya Terhadap Organ Lain Selain pada kulit sebagai organ yang paling sering terserang, bulu ulat ini juga dapat menyebabkan iritasi pada saluran pencernaan bila masuk ke makanan, atau beberapa laporan juga menyebabkan sifat penyebarannya juga

B7 Gangguan Pada Otot Dan Sendi Setelah Melakukan Aktivitas

bisa terjadi secara inhalasi (terhirup) sehingga menyebabkan gangguan pada saluran nafas mulai dari iritasi ringan sampai reaksi alergi yang lebih berat tergantung pada banyak sedikitnya paparan tersebut. Pada mata sendiri, awalnya bulu bisa menempel di selaput mata dan bisa bermigrasi lebih dalam menimbulkan gangguan yang lebih berat, terlebih bila zat asam yang dihasilkan oleh sebagian jenis ulat bulu tadi sudah terlebih dahulu mengiritasi bagian luarnya. Sekilas, gangguan yang diakibatkan ulat bulu ini memang kelihatan sangat simpel, namun beberapa kasus yang lebih berat juga pernah dilaporkan, termasuk tindakan yang lebih kompleks dari sekedar pem-

berian obat tetes pada organorgan seperti mata. Cara Mengatasi Gangguannya Sebagian literatur medis memang menghimbau untuk menghindari penggunaan beberapa terapi tradisional karena dikhawatirkan akan menambah proses iritasi lebih lanjut, termasuk pada organorgan seperti mata. Sementara untuk masalah kulit, pencucian secara dini dengan sabun-sabun ringan sudah bisa direkomendasikan untuk orang-orang yang beraktifitas atau dalam hal yang terjadi sekarang, tinggal di daerah yang terkena serangannya. Penggunaan beberapa bedak tabur asalkan tidak yang bersifat iritatif dalam mengatasi gangguan ringan juga bisa

menjadi pilihan, sedangkan bila keluhan berlanjut mungkin diperlukan obat-obat anti inflamasi secara topikal (dioleskan) atau antibiotik bi-a sudah terjadi infeksi secara sekunder. Untuk paparan lainnya termasuk lewat inhalasi atau dari makanan yang terpapar, cara preventif adalah juga merupakan cara yang paling baik, seperti yang disarankan oleh petugas di sekitar tempat serangan, mulai dari menjaga kebersihan lingkungan dan selalu menutup makanan dan minumannya. Jadi pada dasarnya, meski gangguannya tak kelewat serius, namun dalam taraf tertentu kita juga memerlukan penjagaan yang lebih terutama pada waktu-waktu sekarang ini. (dr. Daniel Irawan)

Segala Sesuatu Tentang Antibiotik Antibiotik termasuk jenis obat yang cukup sering diresepkan dalam pengobatan modern. Antibiotik adalah zat yang membunuh atau menghambat pertumbuhan Sebelum penemuan antibiotik yang pertama, penisilin, pada tahun 1928, jutaan orang di seluruh dunia tak ter-selamatkan jiwanya karena infeksi-infeksi yang saat ini mudah diobati. Ketika influenza mewabah pada tahun 1918, diperkirakan 30 juta orang meninggal, lebih banyak daripada yang terbunuh pada Perang Dunia I. Pencarian antibiotik telah dimulai sejak penghujung abad ke 18 seiring dengan meningkatnya pemahaman teori kuman penyakit, suatu teori yang berhubungan dengan bakteri dan mikroba yang menyebabkan penyakit. Saat itu para ilmuwan mulai mencari obat yang dapat membunuh bakteri penyebab sakit. Tujuan dari penelitian tersebut yaitu untuk menemukan apa yang disebut “peluru ajaib”, yaitu obat yang dapat membidik/menghancurkan mikroba tanpa menimbulkan keracunan. Penemuan Penisilin Pada permulaan tahun 1920, ilmuwan Inggris Alexander Fleming melaporkan bahwa suatu produk dalam airmata manusia dapat melisiskan (menghancurkan) sel bakteri. Zat ini disebut lysozyme, yang merupakan contoh pertama antibakteri yang ditemukan pada manusia. Seperti pyocyanase, lysozyme juga menemukan jalan buntu dalam usaha pencarian antibiotik yang efektif, karena sifatnya yang merusak sel-sel bakteri non-patogen. Namun pada tahun 1928 Fleming secara kebetulan menemukan antibakteri lain. Sekembali liburan akhir pekan, Fleming memperhatikan satu set cawan petri lama yang ia tinggalkan. Ia menemukan bahwa koloni Staphylo-coccus aureus yang ia goreskan pada cawan petri tersebut telah lisis. Lisis sel bakteri terjadi pada daerah yang berdekatan dengan cendawan pencemar yang tumbuh pada cawan petri. Ia menghipotesa bahwa suatu produk dari cendawan tersebut menyebabkan lisis sel stafilokokus. Produk tersebut kemudian dinamai penisilin karena cendawan pencemar tersebut dikenali sebagai Penicillium notatum. Walaupun secara umum Fleming menerima pujian karena menemukan penisilin, namun pada kenyataannya secara tehnik Fleming “menemukan kembali” zat tersebut. Semula Ernest Duchesne, seorang mahasiswa kedokteran Perancis, yang menemukan sifat-sifat penisilium pada tahun 1896, namun gagal dalam melaporkan hubungan antara cendawan dan zat yang memiliki sifat-sifat antibakteri, sehingga Penisilium dilupakan dalam komunitas ilmiah sampai penemuan kembali oleh Fleming. Jenis Antibiotik Meskipun ada lebih dari 100 macam antibiotik, namun umumnya mereka berasal dari beberapa jenis antibiotik saja, sehingga mudah untuk dikelompokkan. Ada banyak cara untuk menggolongkan antibiotik, salah satunya berdasarkan struktur kimianya. Berdasarkan struktur kimianya, antibiotik dikelompokkan sebagai berikut: a. Golongan Aminoglikosida Diantaranya amikasin, dibekasin, gentamisin, kanamisin, neomisin, netilmisin, paromomisin, sisomisin, streptomisin, tobramisin. b. Golongan Beta-Laktam Diantaranya golongan karbapenem (ertapenem, imipenem, meropenem), golongan sefalosporin (sefaleksin, sefazolin, sefuroksim, sefadroksil, seftazidim), golongan beta-laktam monosiklik, dan golongan penisilin (penisilin, amoksisilin). c. Golongan Glikopeptida Diantaranya vankomisin, teikoplanin, ramoplanin dan dekaplanin. d. Golongan Poliketida Diantaranya golongan makrolida (eritromisin, azitro-misin, klaritromisin, roksitromisin), golongan ketolida (teli-tromisin), golongan tetrasiklin (doksisiklin, oksitetrasiklin, klortetrasiklin). e. Golongan Polimiksin Diantaranya polimiksin dan kolistin. f. Golongan Kinolon (fluorokinolon) Diantaranya asam nalidiksat, siprofloksasin, ofloksasin, norfloksasin, levofloksasin, dan trovafloksasin. g. Golongan Streptogramin Diantaranya pristinamycin, virginiamycin, mikamycin, dan kinupristin-dalfopristin. h. Golongan Oksazolidinon Diantaranya linezolid dan AZD2563. i. Golongan Sulfonamida Diantaranya kotrimoksazol dan trimetoprim. j. Antibiotika lain yang penting, seperti kloramfenikol, klindamisin dan asam fusidat. Berdasarkan mekanisme aksinya, yaitu mekanisme bagaimana antibiotik secara selektif meracuni sel bakteri, antibiotik dikelompokkan sebagai berikut: 1.Mengganggu sintesa dinding sel, seperti penisilin, sefalosporin, imipenem, vankomisin, basitrasin. 2.Mengganggu sintesa protein bakteri, seperti klinda-misin, linkomisin, kloramfenikol, makrolida, tetrasiklin, gentamisin. 3.Menghambat sintesa folat, seperti sulfonamida dan trimetoprim. 4.Mengganggu sintesa DNA, seperti metronidasol, kinolon, novobiosin. 5.Mengganggu sintesa RNA, seperti rifampisin. 6.Mengganggu fungsi membran sel, seperti polimiksin B, gramisidin. Antibiotik dapat pula digolongkan berdasarkan orga-nisme yang dilawan dan jenis infeksi. Berdasarkan keefek-tifannya dalam melawan jenis bakteri, dapat dibedakan antibiotik yang membidik bakteri gram positif atau gram negatif saja, dan antibiotik yang berspektrum luas, yaitu yang dapat membidik bakteri gram positif dan negatif. Sebagian besar antibiotik mempunyai dua nama, nama dagang yang diciptakan oleh pabrik obat, dan nama generik yang berdasarkan struktur kimia antibiotik atau golongan

kimianya. Contoh nama dagang dari amoksilin, sefaleksin, siprofloksasin, kotrimoksazol, tetrasiklin dan doksisiklin, berturut-turut adalah Amoxan, Keflex, Cipro, Bactrim, Sumycin, dan Vibramycin. Setiap antibiotik hanya efektif untuk jenis infeksi tertentu. Misalnya untuk pasien yang didiagnosa menderita radang paru-paru, maka dipilih antibiotik yang dapat membunuh bakteri penyebab radang paru-paru ini. Keefektifan masing-masing antibiotik bervariasi tergantung pada lokasi infeksi dan kemampuan antibiotik mencapai lokasi tersebut. Antibiotik oral adalah cara yang paling mudah dan efektif, dibandingkan dengan antibiotik intravena (suntikan melalui pembuluh darah) yang biasanya diberikan untuk kasus yang lebih serius. Beberapa antibiotik juga dipakai secara topikal seperti dalam bentuk salep, krim, tetes mata, dan tetes telinga. Penentuan jenis bakteri patogen ditentukan dengan pemeriksaan laboratorium. Tehnik khusus seperti pewar-naan gram cukup membantu mempersempit jenis bakteri penyebab infeksi. Spesies bakteri tertentu akan berwarna dengan pewarnaan gram, sementara bakteri lainnya tidak. Tehnik kultur bakteri juga dapat dilakukan, dengan cara mengambil bakteri dari infeksi pasien dan kemudian dibiarkan tumbuh. Dari cara bakteri ini tumbuh dan pe-nampakannya dapat membantu mengidentifikasi spesies bakteri. Dengan kultur bakteri, sensitivitas antibiotik juga dapat diuji. Penting bagi pasien atau keluarganya untuk mempelajari pemakaian antibiotik yang benar, seperti aturan dan jangka waktu pemakaian. Aturan pakai mencakup dosis obat, jarak waktu antar pemakaian, kondisi lambung (berisi atau kosong) dan interaksi dengan makanan dan obat lain. Pemakaian yang kurang tepat akan mempengaruhi penyerapannya, yang pada akhirnya akan mengurangi atau menghilangkan keefektifannya. Bila pemakaian antibiotik dibarengi dengan obat lain, yang perlu diperhatikan adalah interaksi obat, baik dengan obat bebas maupun obat yang diresepkan dokter. Sebagai contoh, Biaxin (klaritromisin, antibiotik) seharusnya tidak dipakai bersama-sama dengan TheoDur (teofilin, obat asma). Berikan informasi kepada dokter dan apoteker tentang semua obat-obatan yang sedang dipakai sewaktu menerima pengobatan dengan antibiotik. Jangka waktu pemakaian antibiotik adalah satu periode yang ditetapkan dokter. Sekalipun sudah merasa sembuh sebelum antibiotik yang diberikan habis, pemakaian antibiotik seharusnya dituntaskan dalam satu periode pengobatan. Bila pemakaian antibiotik terhenti di tengah jalan, maka mungkin tidak seluruh bakteri mati, sehingga menyebabkan bakteri menjadi resisten terhadap antibiotik tersebut. Hal ini dapat menimbulkan masalah serius bila bakteri yang resisten berkembang sehingga menyebabkan infeksi ulang. Efek Samping Disamping banyaknya manfaat yang dapat diperoleh dalam pengobatan infeksi, antibiotik juga memiliki efek samping pemakaian, walaupun pasien tidak selalu mengalami efek samping ini. Efek samping yang umum terjadi adalah sakit kepala ringan, diare ringan, dan mual. Dokter perlu diberitahu bila terjadi efek samping seperti muntah, diare hebat dan kejang perut, reaksi alergi (seperti sesak nafas, gatal dan bilur merah pada kulit, pembengkakan pada bibir, muka atau lidah, hilang kesadaran), bercak putih pada lidah, dan gatal dan bilur merah pada vagina. Resistensi Antibiotik Salah satu perhatian terdepan dalam pengobatan modern adalah terjadinya resistensi antibiotik. Bakteri dapat mengembangkan resistensi terhadap antibiotik, misalnya bakteri yang awalnya sensitif terhadap antibiotik, kemudian menjadi resisten. Resistensi ini menghasilkan perubahan bentuk pada gen bakteri yang disebabkan oleh dua proses genetik dalam bakteri: 1.Mutasi dan seleksi (atau evolusi vertikal) Evolusi vertikal didorong oleh prinsip seleksi alam. Mutasi spontan pada kromosom bakteri memberikan resistensi terhadap satu populasi bakteri. Pada lingkungan tertentu antibiotika yang tidak termutasi (non-mutan) mati, sedangkan antibiotika yang termutasi (mutan) menjadi resisten yang kemudian tumbuh dan berkembang biak. 2.Perubahan gen antar strain dan spesies (atau evolusi horisontal) Evolusi horisontal yaitu pengambil-alihan gen resistensi dari organisme lain. Contohnya, streptomises mempunyai gen resistensi terhadap streptomisin (antibiotik yang dihasilkannya sendiri), tetapi kemudian gen ini lepas dan masuk ke dalam E. coli atau Shigella sp. Beberapa bakteri mengembangkan resistensi genetik melalui proses mutasi dan seleksi, kemudian memberikan gen ini kepada beberapa bakteri lain melalui salah satu proses untuk perubahan genetik yang ada pada bakteri. Ketika bakteri yang menyebabkan infeksi menunjukkan resistensi terhadap antibiotik yang sebelumnya sensitif, maka perlu ditemukan antibiotik lain sebagai gantinya. Sekarang penisilin alami menjadi tidak efektif melawan bakteri stafilokokus dan harus diganti dengan antibiotik lain. Tetrasiklin, yang pernah dijuluki sebagai “obat ajaib”, kini menjadi kurang bermanfaat untuk berbagai infeksi, mengingat penggunaannya yang luas dan kurang terkontrol selama beberapa dasawarsa terakhir. Keberadaan bakteri yang resisten antibiotik akan berbahaya bila antibiotik menjadi tidak efektif lagi dalam melawan infeksi-infeksi yang mengancam jiwa. Hal ini dapat menimbulkan masalah untuk segera menemukan antibiotik baru untuk melawan penyakit-penyakit lama (karena strain resisten dari bakteri telah muncul), bersamaan dengan usaha menemukan antibiotik baru untuk melawan penyakit-penyakit baru. *Dr Silvia Surini

DALAM melakukan pekerjaannya, seorang pekerja khususnya para lanjut usia (lansia) dapat mengalami gangguan atau cedera pada tulang maupun otot. Gangguan ini biasanya lebih sering mengenai anggota gerak atas, punggung dan leher, yang sering terjadi akibat melakukan aktivitas yang berulang-ulang dalam waktu yang lama, karena otot yang bekerja (berkontraksi) dalam waktu yang lama untuk mempertahankan tubuh dalam sikap tertentu akan mengalami kelelahan dan mungkin saja robek yang selanjutnya diikuti dengan proses radang, dan gangguan fungsi pada bagian tubuh yang digunakan tadi. Beberapa aktivitas yang dapat menyebabkan gangguan pada otot dan sendi akibat kerja terjadi karena melakukan aktivitas yang berulang-ulang seperti mengetik, melakukan aktivitas dengan beban yang berat, posisi sendi yang tidak baik sewaktu melakukan pekerjaan, adanya tekanan langsung pada bahagian tubuh tertentu, adanya posisi bahagian tubuh yang dipertahankan untuk waktu yang lama seperti mengelas dan lain-lain. Selain daripada itu, beberapa hal cenderung me-nyebabkan gangguan pada otot dan sendi akibat kerja, misalnya usia yang semakin bertambah, wanita lebih sering mengalami gangguan ini daripada pria, demikian juga pada orang yang gemuk. Penyebab Aktivitas dan situasi tempat bekerja dapat menyebabkan gangguan pada otot dan sendi, yaitu : Ï% Cedera pada saraf akibat sikap tubuh yang salah pada berbagai situasi dan lingkungan kerja sering ditemukan. Dapat terjadi penekanan saraf pada bagian-bagian tertentu dari tubuh, seperti pada pergelangan tangan. Penderita dapat mengeluh adanya rasa kebas pada jari satu, dua dan tiga dari tangan yang sering menyebabkan penderita terbangun pada malam hari, juga dapat terjadi gangguan menggemgam, dan kekakuan pada ketiga jari tangan tersebut. Ï% Gangguan fisik akibat tempat kerja. Hal ini dapat ter-jadi pada aktivitas yang menyebabkan gerakan pinggang yang berlebihan, adanya posisi tubuh yang dipertahankan untuk waktu yang lama, yang menyebabkan kontraksi otot yang lama dan berulang-ulang sehingga menyebabkan kelelahan otot dan berkurangnya kekuatan, koordinasi dan kemampuan otot untuk mempertahankan aktivitas pada posisi tertentu. Misalnya melakukan pekerjaan dengan mengangkat lengan pada posisi yang jauh dari tubuh dalam waktu yang lama tanpa disandarkan pada penopang lengan. Keadaan ini sering ditemukan pada montir, tukang listrik yang sering mengerjakan sesuatu yang lebih tinggi daripada kepala mereka sambil memegang peralatan yang berat. Ï% Gangguan fisik karena tempat duduk atau posisi duduk yang kurang baik. Hal ini dapat menyebabkan nyeri pada bokong, pinggang dan punggung. Keluhan nyeri pinggang merupakan keluhan yang banyak didapati pada lanjut usia (lansia). Adapun yang dimaksud dengan istilah nyeri pinggang yaitu berupa keluhan nyeri, pegal, linu, ngilu, ngentek atau rasa tidak enak di daerah pinggang dan bokong. Dalam bahasa asingnya disebut sebagai low back pain. Keluhan utama nyeri pinggang akibat sikap tubuh yang salah dapat berupa pegal di pinggang yang telah dialaminya bertahun-tahun, panas, kaku dan tidak enak di pinggang, pinggang terasa seperti mau patah, terasa terus menerus capek dan lain-lain. Jika diminta penjelasan dari penderita apakah nyeri atau tidak pada daerah pinggangnya maka jawabannya adakalanya tepat atau kacau. Biasanya keluhan tambahan yang selalu mengiringi nyeri pinggang ini adalah badan letih, walaupun cukup tidur dan cukup makan. Ï% Gangguan fisik karena mengangkat, mendorong dan menarik. Hal ini dapat terjadi karena mengangkat beban yang tidak melebihi setengah dari batas kemampuannya, melakukan gerakan berputar sambil membawa beban tanpa merubah posisi panggul. Mengangkat beban tanpa terlebih dahulu mendekatkannya pada posisi tubuh, menarik beban yang seharusnya mendorongnya. Ï% Gangguan pada tulang dan sendi akibat bahanbahan kimia. Hal ini dapat menyebabkan terjadinya kropos tulang (osteoporosis), patah tulang, gangguan mineral tulang, gangguan aliran darah dan terjadinya pembekuan darah pada sendi. Penatalaksanaan Jika gangguan pada sendi dan tulang disebabkan karena cedera (trauma) perlu diatasi dengan meng-istirahatkan bagian tubuh yang terkena cedera dengan alat bantu seperti pema-sangan bidai pada malam hari, penyangga leher dan korset pada pinggang. Pada fase akut (sewaktu serangan penyakit) perlu kompres es dan pem-berian obatobatan. Oleh karena sikap tubuh yang salah yang menyebabkan nyeri pinggang maka memperbaiki sikap tubuh yang salah menjadi pengobatan yang utama atau pencegahan selanjutnya. Oleh karena itu, sikap duduk harus benar dengan cara duduk tegak yang dapat dicapai dengan menempatkan bokong sedekat-dekatnya pada sandaran kursi, menghindari duduk secara terus-menerus lebih dari 1 jam, dan jika duduk sebaiknya bersandaran dan secara bergantian mengangkat 1 kaki lebih tinggi dari yang lain. Selain daripada itu, perlu menghindari sikap membungkuk jika sedang bekerja dalam posisi berdiri. Untuk memungut sesuatu benda di lantai, sebaiknya dengan menekukkan lutut, jangan dalam posisi berdiri sambil mem-bungkuk. Juga perlu menghindari mengangkat beban yang berat dan jika hal ini terpaksa dilakukan maka angkatlah beban itu sedekat mungkin dengan sumbu badan dan jika beban berada ditempat yang rendah maka tekuklah lutut sebelum mengangkat beban tersebut seperti orang yang ber-jongkok. Selain daripada itu, perlu dilakukan perbaikan atau pe-rubahan pada situasi dan lingkungan tempat kerja untuk menghindari atau mengurangi cedera lebih lanjut, baik terhadap penderita maupun rekan sekerjanya. Pada saat ini mulai dikembangkan suatu cabang ilmu yang disebut sebagai ergonomi, yaitu ilmu yang merencanakan kenyamanan serta produktivitas yang sebesar mungkin dengan cedera yang paling minimal ditempat kerja, yang sangat berperan untuk mengurangi cedera ditempat kerja. Tugas ergonomi adalah merencanakan dan memperbaiki tempat kerja, perlengkapan dan prosedur kerja dari para pekerja guna menjamin keamanan, kesehatan dan keberhasilan perorangan maupun perusahaan secara efisien (dr.Pirma Siburian Sp PD, K Ger, spesialis penyakit dalam dan penyakit lansia, dokter pada klinik lansia Klinik Spesialis Bunda dan RS Permata Bunda Medan).

Remaja

B8

WASPADA

Minggu 17 April 2011

Hadapi Ujian Nasional

Bekali Diri Dan Har us PD Harus BESOK, Senin (18/4) menjadi babak penentu bagi seluruh pelajar Sekolah Menengah Atas (SMA) di seluruh Indonesia, khususnya Kota Medan untuk bisa lolos dalam ujian nasional (UN) 2011.

Maisyarah Kelas XII IPS SMA Harapan 3

Yustik asanah SSar ar ide wi ustikaa HHasanah aride idewi Kelas XII A YPSA TENT ANG UN tahun ini,sedikit mengejutkan karena TENTANG sistemnya berubah.Tetapi setelah mengetahui sistemnya seperti apa, menurut saya malah jauh lebih baik, karena nilai raport juga di masukkan dalam syarat kelulusan jadi usaha kita selama 3 tahun terakhir tidaklah sia-sia. Kelulusan tidaklah hanya ditentukan dari ujian yang dilakukan dalam kurun waktu seminggu tersebut (UN). Tetapi memang sistem ini terlalu tiba-tiba diubah,sehingga bagi yang tidak serius mengejar nilai pada 2 tahun sebelumnya sangat merugikan. Tapi saya sangat beruntung bersekolah di YPSA, selain lengkap dalam penyampaian tentang sistem UN yang baru, sekolah ini sangat peduli tentang persiapan siswanya menghadapi UN tersebut. Selain dengan memberi waktu pengajaran tambahan (intensive) juga diadakan try out setiap minggunya, pembahasan soalsoal UN dengan guru bidang study masing-masing, try out akbar mengundang siswa sekolah lain, sampai simulasi Ujian Nasional setiap hari pada 2 minggu terakhir sebelum UN.

Namun,padaepisodeitujugasiswa merasakan pertarungan batin yang berat jikalau gagal. Apalagi, pada pelaksanaan UN tahun ini menggunakan sistem berbeda dari tahun-tahun sebelumnya, yakni antara nilai UN dan UAS itu dipadu dan itu akan menjadi penentuan kelulusan UN kali ini Perubahan mendasar ini yang dibuat pemerintah ini menimbulkan kebingungan bagi siswa. Lantasbagaimanasiswamenyikapi perubahan dan bagaimana kesiapan siswa menghadapi ujian yang akan dilaksanakan, Senin (18/4). Berikut petikannya.

DALAMmenghadapiUN2011 ini ada juga perasaan deg-degan, seperti nggak nyangka harus menghadapi UN yang menggunakan format 5 paket.Tapi meskipun begitu, UN tetap harus dihadapi. Takut, ded-degan, gelisah pasti singgah,tapisemuaharusdihadapi dengan tenang dan menjaga kesehatan. Soal persiapan, terang Maisyarah, belajar ekstra keras di rumah dan sekolah, sampai-sampai harus mencari trik khusus bagaimana bisa lulus UN. Yang paling penting adalah bagaimana memotivasi diri sendrii agar percaya diri dan tidak mudah tergoda dengan isu kunci jawaban. Nah, selanjutnya belajar lebih giat lagi ditambah mengikuti bimbel supaya semakin paham dengan kriteria soal yang bakal keluar. Selain itu, sering-sering mengikuti try out, mengadakan les privat di rumah agar lebih mantap lagi.

Rio Prambudi Wardana Kelas XII B YPSA MENURUT saya, ada baiknya UN ditiadakan dan syarat kelulusan lebih baik diserahkan kepada sekolah. Karena tidak adil apabila siswa yang telah mati-matian belajar selama 3 tahun hanya ditentukan oleh ujian yang beberapa hari. Ditambah lagi peraturan baru, yaitu 5 kode (A, B. C, D dan E). Sebaiknya diserahkan sepenuhnya kepada sekolah karena siswa selama 3 tahun belajarnya dan mengabdi disekolahyanglebihmengertikaraktersiswanya.Karena lulus dengan nilai baik tapi tidak memiliki attitude. Itu sama saja. Sikap juga sangat diperlukan. “Kepada rekan-rekan kelas XII yang akan menempuh UN di manapun berada, semoga kita semua dapat menempuh ujian ini dengan baik dan lancar. Semoga kita semua lulus dan dapat melanjutkan ke universitas yang diinginkan,” cetus Rio.

Mujahid Widian Saragih Kelas XII IPS SMA Harapan 3 PERASAAN menjelang ujian nasional tentunya bermacam ragam, mulai dari perasaan khawatir, grogi sampai kurang percaya diri muncul menghantui setiap langkah kita setiap harinya. Apalagi tahun ini format UN berbeda. Namun hal ini harus dihadapi dengan kepala dingin, saya pribadi menganggap kalau kita telah belajar sungguh-sungguh selama 3 tahun. Mengenai persiapan, terang Muhajid, hampir sama. Cuma frekuensi belajar dan latihan soalsoalnya lebih diperbanyak dan dibarengi ibadah dan memotivasi diri sendiri agar tidak ‘down”. Naskah dan foto Dede Juliadi

Peserta UN Dapat Dukungan Dari Adik Kelas BESOK 18 April saatnya siswa kelas tiga di jenjang pendidikan menengah atas mengikuti Ujian Nasional (UN) sebuah perjuangan akhir untuk menuntaskan masa belajarnya selama tiga tahun di sekolah masing-masing. Meski tidak mudah untuk bisa menjadisiswayanglolosdimasaakhir ini, namun semangat mereka mendapat dukungan dari adik kelas menambah kekuatan baru bagi kakak kelas. Seperti yang diutarakan, Fira Riza Aulia, siswa SMAN 1 Medan yang sangat bangga dengan adik kelasnya turut serta memberikan dukungan padanya. “Saya merasa senang atas dukungan mereka. Partisipasi adik kelas sangat terasa menjadi satu semangat bagi siswa kelas akhir, utamanya saat mengikuti berbagai kegiatan try out dan ulangan. Dengan dukungan itu pula, saya merasa nyaman ketika terdaftar sebagai siswa yang ikut SNMPTN jalur undangan, pilihan

saya pada studi elektro, industri dan Mipa,” katanya. Lantas, apakah program UN besok ia telah punyapersiapanyang cukup? “Kalauditanya persiapan, sudah sejak lama. Tapi menjelang pelaksanaanUN,persiapan lebih ditingAhmad Novri katkan lagi. Utamanyapenguatan mental agar tidak terpengaruh dengan issu bocoran jawaban. Hal ini selalu disampaikan para guru di sekolah. Selamabeberapabulantelahmengikuti bimbingan belajar dan kegiatan try out yang proses pelaksanaannya sama dengan kegiatan UN, sehingga saat ujian nanti tidak ada rasa grogi lagi,” ucap Fira yang tinggal di Jalan Karya Wisata Komplek Griya Wisata Indah Medan Johor ini. Di tempat terpisah, pelajar SMAN 7Medan,jugamengakuihalyangsama. Lewat berbagai kegiatan yang mereka

Waspada/Dedi Riono

Sejumlah siswa tampak berserah diri memanjatkan doa kepada Allah SWT dalam acara zikir dan doa bersama di SMKN 1 Percut, Jumat (15/4).

SMKN 1 Percut Doa Bersama Jelang UN SUASANA seketika menjadi hening, beberapa siswa tampak tak kuasa menahan air mata. Mereka bukan sedang dirundung duka, tapi diingatkan kembali akan hakikat diri, hakikat kehidupan, dan tujuan hidup di dunia ini melalui sebuah muhasabah (introspeksi diri). Ya, muhasaba menjadi bagian dari kegiatan zikir dan doa bersama sekira 1200 siswa dan guru SMK Negeri 1 Percut Sei Tuan, Kabupaten Deli Serdang, Jumat (15/4) lalu. Kegiatan itu sebagai bentuk pengharapan kepada Allah SWT agar siswa yang akan mengikuti UN diberi kekuatan, keyakinan, ketegaran hati dan kemudahan dalam menjawab soal-soal UN. Moment itu pun tak disia-siakan para siswa, mereka segera merapatkan shaf (barisan) sesaat akan dimulainya shalat duha di Masjid Al-Ikhwan milik SMKN 1 Percut. Jumlah siswa yang begitu banyak, membuat sebagian besar mereka harus rela shalat di luar masjid. Setelah shalat duha, acara dilanjutkan dengan zikir dan doa bersama sekaligus muhasaba. Di sinilah permohonan kepada Sang Maha Pemberi mereka ungkapkan. Seketika kepala mereka tertunduk dengan wajah penuh pengharapan kepada zat Yang Maha Agung Allah SWT. Untaian doa yang begitu menyentuh diutarakan pemimpin doa, tak ayal membuat para siswa terenyuh dan beberapa di antaranya tak kuasa menahan air mata. Suana kembali normal ketika Drs H Syafril Syarifuddin Basrah MA memberikan tausiya yang intinya membangkitkan semangat para siswa untuk siap menghadapi UN. Sementara itu, di ruang aula sekolah tersebut juga digelar doa bersama yang diikuti para siswa beragama Kristiani. Tidak kurang dari 200 siswa terlibat di dalamnya dengan dipandu guru agama Kristen, Wagelman Purba. “Kegiatan ini sebagai puncak persiapan siswa dalam menghadapi UN, di mana sebelumnya mereka telah mempersiapkan diri dengan mengikuti les, try out, simulasi UN dan sebagainya,” ucap Kepala SMKN 1 Percut, Drs Jaswar MPd. Dikatakan, melalui kegiatan zikir dan doa bersama, diharapkan para siswa semakin siap berjuang menghadapi UN. “Perjuangan yang diawali dengan doa, Insya Allah, akan berbuah manis sesuai harapan kita, anak-anak bisa lulus 100 persen dalam UN,” pungkasnya. **m42

Gaya Rajutan Fira Riza Aulia ikuti menjelang UN, adik kelas mereka selalu memberikan dukungan. “Ya, seperti hari ini, kami sedang mengikutikegiatantry out akbar, adik kelas tidak mengganggu jalannya ujian. Semua berjalan dengan lancar, kamipun yakin mereka mendoakan kami agar lulus 100 persen,”katasiswaSMAN7AndiZoraya Tirzani usai mengikuti kegiatan try out Selasa lalu. Andi Zoraya mengaku sudah mempersiapkan diri secara khusus guna mengikuti UN ini, utamanya kesehatan fisik dan istirahat yang cukup agar stamina dalam mengikuti ujian terjaga.“Insyaallahsudahmempersiapkankesehatan,apalagiadamasatenang

ATASAN dari rajutan ini terlihat cantik Siswa SMKN 5 melihat nomor ujian yang diterakan di pintu kelas masing-masing, mereka juga memcocokkan nomor ujian dengan tempat duduk saat UN besok. sebelum ujian, saya memilih istrirahat di rumah sembari banyak berdoa agar Allah memberikan kemudahan. Jangan ada yang tidak lulus dari SMAN 7 Medan,” papar puteri wartawan koran ini kemarin. Pujian yang diberikan siswa ini terhadapkakakkelasinidiakuiolehseorang adik kelas.Yakni siswa SMAN 9, Ahmad Novri. Pelajar yang menjabat sebagai Ketua OSIS ini mengaku sangat memberikandukunganpadakakakkelasnya dalam menyongsong kegiatan UN. “Ya,sebagaiadikkelaskamimerasa perlu memberikan dukungan pada mereka. Pernah juga membantu menyiapkan soalan try out yang didapatkan dari internet, berada di

sekolah saat mereka mengikuti try out ketika kami libur. Begitu yang kami lakukan sambil berharap semua peserta UN tahun ini bisa lulus 100 persen karena sudah berusaha dan berdoa,”kata putera MulkanyangtinggaldiJalanSyahbuddin Yatim Medan Labuhan. Sedangkan siswa SMKN 5 di jalan Timor Medan, Sabtu kemarin melihat nomor ujian di masingmasing kelas yang akan mereka tempatiuntukujianbesok.Beberapa siswa yang diminta pendapatnya, diataranya Bagus Riadi dan Rendi Aria Wijaya mengaku sudah siap menghadapi ujian.

karena diberi ornament rajutan berwarna-warni serta aksen payet yang berkilau. Selain memberi kehangatan, rajutan ini bikin kita tampil gaya. **Neneng K.Zen/AP

Naskah dan foto Anum Saskia

Hadapi UN, Siswa YPSA Doa Bersama MENGHADAPI ujian nasional, siswa kelasVI, SMP kelas IX dan SMA kelas XII YP. Shafiyyatul Amaliyyah melaksanakan doa bersama di gedung serba guna kampus hijau sekolah itu, Jumat lalu. DoaBersamaitudibawakanSyaiful Anshor dihadiri Pembina YPSA Drs. H. Sofyan Raz, Ak. MM, Ketua Umum Hj Rahmawaty Sofyan Raz, Pembina Muda YPSA H Arisi Fariza Raz, dan seluruh kepala sekolah beserta guru dan orangtua. PembinaYPSA Buya Drs H Sofyan Raz Ak MM berharap kepada para siswa agar sungguh-sungguh dalam belajar, sehingga bisa lolos pada pelaksanaan ujian nasional tahun pelajaran

2010-2011 ini. Apalagi, setiap tahunYPSA selalu berhasil lulus para siswa 100 persen. Nah harapan kita prestasi ini dapat dipertahankan. Seperti halnya,YPSA yang keluar sebagai ranking 1 UN seSumut,” katanya. Menurutnya, pada UN tahun 2011 ini banyak perubahan sistem sangat drastis. Sehingga, membuat para peserta UN harus sungguh-sungguh mempelajari setiap mata pelajaran yang akan diujikan dalam UN. Karena itu, lanjutnya, melalui doa bersama ini kita berharap pertolongan Allah SWT agar seluruh siswa diberi kemudahan dalam menjawab setiap pertanyaan yang ada.

Karena itu, Sofyan Raz berharap agar pertemuan ini sebagai titik awal agar para siswa belajar secara sungguhsungguh. Sehingga, mendapatkan kelulusan dalam UN tahun ini. Sebab, seluruh guru diYPSA sudah berusaha semaksimalmungkindalammemberikan ilmunya kepada para peserta didik. “Yang jelas, di YPSA ini tidak ada membeda-bedakan antara sesorang siswa dengan siswa lain, karena status sosial orangtuanya,” tegasnya. ** m43 PENGARAHAN: Pembina YPSA H Sofyan Raz ketika memberikan pengarahan di hadapan siswa dalam doa bersama menghadapi UN 2011 di Gedung Serbaguna sekolah itu, Jumat lalu.

Waspada/dede

Zodiak Kamu Minggu Ini ARIES (21 Mar – 19 Apr) KEHADIRAN planet Jupiter di rasi kita member banyak kebebasan. Ini A : Acara nge-date saatnya keinginan hati kita mengambil alih. CINT CINTA kita sukses berat nih. Kita jadi semakin mengenal sifat dia. Nah kalau kita dan dia memang nyambung, enggak ada salahnya menunjukkan sikap. KESEHATTAN : Kebanyakan Kesempatan enggak datang dua kali, lho. KESEHA tidur larut bikin mata jadi berkantung tuh. TAURUS (20 AApr pr – 20 M ei) Mei) KIT A lagi mencari apa yang kita inginkan. Makanya atur waktu dan fokus KITA A: Yihaaa, akhirnya pada impian, semua pasti bakal jadi kenyataan.CINT CINTA: ada kesempatan untuk lebih dekat sama seseorang. KESEHA KESEHATTAN : Serangan perut menganggu.

GEMINI (21 Mei – 21 Jun) ALA WAL AUPUN kesempatan udah lewat, jangan patah semangat dulu, A : Mungkin dong. Yuk, lebih percaya sama kemampuan sendiri. CINT CINTA ini waktu yang tepat untuk mengenalkan dia kepada keluarga. KESEHA KESEHATTAN: Tidur cukup jadi obat ampuh supaya semangat kembali naik.

LIBRA (24 Sep – 22 Okt) CANCER (22 Jun – 23 Jul) KIT A memang paling suka menyibukkan diri dengan berbagai aktivitas. KITA A: Tapi tetap aja,jangan lupakan waktu untuk diri sendiri, ya. CINT CINTA: Tenang, kita bakal bertemu seseorang yang lebih oke. KESEHA KESEHATTAN : Kurangi porsi makan. Program diet gagal terus, nih.

ORANG-ORANG di sekeliling benar-benar mengubah diri kita. Mereka membuat kita jadi lebih senang bertualang. Bagus sih, asal jangan A : Walaupun ini bukan waktu yang tepat kehilangan jati diri aja, ya. CINT CINTA untuk jatuh cinta, enggak masalah kok kalau kita ingin mengenal seseorang.. KESEHA KESEHATTAN : Duh, masuk angin lagi. SCORPIO (23 Okt – 22 Nov)

LEO (24 Jul – 23 Ags) LAGI fokus banget sama rencana travelling. Enggak apa sih, soalnya A: perjalanan kali ini bisa membantu kita menemukan sisi lain diri. CINT CINTA: Bakal bertemu seseorang yang sangat berbeda. Anehnya, kita dan dia justru memiliki chemistry kuat. KESEHA KESEHATTAN : Jangan sepelekan penyakit flu. VIRGO (24 Ags – 23 Sep) JANGAN terlalu mengikuti emosi. Coba cari peralihan deh, siapa tahu A : Semakin dekat, kita dan dia makin mood bisa jadi lebih baik. CINT CINTA enggak bisa lepas. Mungkin dia yang kita cari selama ini. KESEHA KESEHATTAN: Gejala maag datang lagi.

KIT A lagi merasa capek banget. Semua hal yang dikerjakan jadi selalu KITA salah. Hmm, mungkin kita harus hangout bareng teman dulu. CINT A : Tenang, putus hubungan bukan akhir segalanya. CINTA KESEHA KESEHATTAN : Badan mulai pegal-pegal.

SA GIT ARIUS (23 NNoov – 21 DDes) es) SAGIT GITARIUS BENAR KAN KAN, kalau kita bersungguh-sungguh, semua halangan sekecil apa pun bisa dilewati. Enggak ada lagi kata takut, kan? CINT A : Lagi bahagia banget. Dia memang paling bisa membuat kita CINTA merasa nyaman. KESEHA KESEHATTAN : Sakit kepala makin lama main menganggu.

CAPRICORN (22 Des – 20 Jan) MESKI kemauan kita sekeras baja, kadang hasilnya memang enggak selalu sesuai keinginan. Makanya santai aja, jangan terlalu merisaukan A : Kayaknya cara PDKT kita terlalu biasa, nih, permasalahan kecil.CINT CINTA makanya dia jadi susah banget didapatkan.KESEHA KESEHATTAN : Salah makan pasti bisa bikin sakit perut. AQUARIUS (21 Jan – 19 Feb) HHMM, sepertinya kita harus membiarkan otak dan pikiran beristirahat, nih. Belakangan kita terlalu sering memaksa mereka A : Sabar gals! Dia lagi mencari berpikir keras . Kasihan, ah… CINT CINTA waktu yang tepat untuk mengatakan apa yang dia rasakan. KESEHA KESEHATTAN : Jangan jajan sembarangan.

PISCES (20 Feb – 20 Mar) FOKUS pada apa yang sedang kita kerjakan. Percaya deh, semua pasti bisa kita wujudkan. Apalagi semangat juga lagi tinggi banget. CINT A : Chemistry antara kita dan dia memang kenceng banget. CINTA Enggak ada salahnya nih mengenal dia lebih dekat. KESEHA KESEHATTAN : Duh, kondisi badan drop. Segera minum vitamin, ya. **m31/KW

Remaja

WASPADA Minggu 17 April 2010

Tumbuhkan Kecintaan Remaja Terhadap Sastra KOMUNITAS Membaca, Menulis, dan Sastra Rumput Hijau SMA Negeri 2 Binjai sukses menggelar acara ‘Gebyar Muda Bersastra’ pada Sabtu (9/4) lalu. Kegiatan yang berlangsung di lapangan hijau sekolah itu diisi dengan berbagai perlombaan seperti Berbalas Pantun, Musikalisasi Puisi, Majalah Dinding, dan Yel-yel. Acara yang diikuti siswa tingkat SMA sederajat di Sumut tersebut diawali dengan pertunjukan musikalisasi puisi oleh anak-anak Rumput Hijau. Puisi yang dimusikalisasi adalah karya Timbas Tarigan, Wakil Walikota Binjai. Puisi‘Cinta Untuk Anakku’ yang merupakan ungkapan tulus Timbas kepada anak-anaknya, mampu dikemas dengan sangat apik. Anak-anak musikalisasi yang terdiri dari Sepli, Corry, Dwi, Aulia, Arfan, dan Yudha, sebelumnya pernah memenangi Festival Musikalisasi se Sumatera yang diadakan oleh Balai Bahasa

Waspada/Dedi Riono

Peserta lomba berbalas pantun pada gelaran Gebyar Muda Bersastra Rumput Hijau sedang beraksi di atas panggung. Provinsi Riau. Kegiatan yang diikuti 350 peserta itu, berlangsung sejak pagi hingga waktu senja. Dewan juri yang terdiri para sastrawan dan musisi Sumut seperti Hasan Al Banna, M. Raudah Jambak, Andi, Mastar Muham, Ibnu Hajar, Djamal, dan Roben Sipayung, langsung mengumumka

para pemenang lomba. Untuk lomba Berbalas Pantun, tampil sebagai juara anakanak Bengkel Sastra Bianglala SMA Negeri 1 Binjai diikuti SMA Harapan 2 Medan (juara II), SMK Putra Anda Binjai (juara III), dan juara favorit SMA Harapan 2 Medan. Untuk lomba Musikalisasi

Puisi, gelar juara diraih SMA Harapan 2 Medan diikuti SMK Putra Anda Binjai (juara II), Bengkel Sastra Bianglala SMA 1 Binjai (juara III), dan Komunitas Rumput Hijau SMA 2 Binjai (favorit). PadalombaMajalahDinding, Bengkel Sastra Bianglala tampil sebagai juara I, II dan Favorit.

Sedangkan juara III oleh MAN Negeri Binjai. Untuk lomba yelyel dimenangi SMKN 2 Binjai, Bengkel Sastra Bianglala SMA 1 Binjai (juara II), MAN 2 Model Medan (juara III), dan SMA Ahmad Yani Binjai (favorit). “Kegiatan ini diharapkan mampumenumbuhkankembali rasa cinta remaja terhadap kegiatan sastra.Terlebih, sastra diyakini selain menambah kecerdasan intelektual, juga dapat meningkatkankecerdasanemosionaldan spiritual siswa. Remaja akan semakin tinggi budi perkertinya dan halus budi bahasanya,” ucap Kepala SMAN 2 Binjai, Saniah, S.Sos dan pembina Rumput Hijau, Novianti, S.Pd. “Kita rencanakan ‘Gebyar Muda Bersastra’ ini menjadi agenda tahunan Komunitas Rumput Hijau. Hal ini diyakini akan dapat dilakukan sebab para alumni SMAN 2 Binjai sangat mendukung acara ini. Sebagian besarpendanaanacarainibahkan didapatkan dari korps para alumni,” sebut Ketua Panpel, Corry didampingipanitia inti lainnya Nastiti, Rina Ginting, dan Putri Nahrisa. *m42

B9 Profil Guru

Dra Ngatmini

Pelayanan Adalah Utama

MENJADI guru bidang studi keahlian Tata boga sekaligus Wakil Kepala Sekolah di SMKN 8 Medan, membuatnya selalu menghadirkan konsep kerja yang mengutamakan pelayanan prima. Pelayanan terhadap berbagai kepentingan dunia pendidikan, baik siswa maupun guru dan orang tua siswa serta dunia industri tempat para siswa melakukan praktik kerja adalah bagian dari tugas rutinnya. “Tugas sebagaiWakepsek Hubungan Masyarakat dan Industri memang cukup banyak, tetapi

yang utama adalah bagaimana saya bisa memberikan pelayanan yang prima baik kepada pihak sekolah, para siswa, orang tua maupun dunia industri tempat para siswa melaksanakan praktiknya sesuai tuntutan kurikulum sekolah. Untuk ini diperlukan keuletan dan kesabaran khusus agar semua mendapatkan pelayanan,”ujar Ngatmini kemarin. Dalam kesehariannya, kata Ngatmini, ia selalu berupayamenyahutisetiapkeluhanyangdisampaikanparasiswaterhadapberbagaihalyangberkaitan dengan tugas pokok mereka tatkala berada di dunia industri. Terhadap persoalan ini, sebut dia, biasanyasebelummengirimsiswakeduniaindustri, para siswa sudah mendapatkan beragam pengetahuan tambahan di samping pengetahuan yang dimiliki sesuai program keahliannya. “Sebelum proses kerja industri berlangsung, sudah ada sosialisasi terhadap siswa,orang tua maupun dunia industri yang akan menerima siswa untuk praktik di sana. Demikian juga terhadap orang tua siswa yang selalu mendapatkan keterangan dari pihak sekolah terkait program kegiatan yangakandiikutisiswadisekolahmaupunprogram lainnya,”katanya yang menerima komplain siswa maupun orang tuanya melalui kotak surat dan nanti membahasnya dengan pihak sekolah. Jika komplain itu bisa segera dilaksanakan, tentu disegerakan, tetapi seringkali masalah pembiayaanmenjadihambatanorangtuamaupun siswa. **Anum Saskia

Kenalkan Khas Budaya Luar

Psikolog USU Hadirkan ‘Kampung Dunia’ ADA yang berbeda ketika

Waspada/Sugiarto

Mahasiswa Politeknik LP3I Kampus Gajah Mada foto bersama usai mengikuti company visit ke PT Indofood, di Tanjungmorawa.

memasuki pekarangan Fakultas Psikologi Universitas

Mahasiswa Politeknik LP3I Ikuti Company Visit Dan Table Manner

Sumatera Utara (USU) Sabtu (9/4) lalu. Para mahasiswa tidak hanya mengenakan pakaian jeans, kaos, ataupun kemeja melainkan beberapadarinyamemakaipakaian adat lokal maupun luar. Pekan lalu benar-benar membuat para mahasiswa benar-benar sibuk ada menjaga bazar yang menyajikan makanan dan minuman, pernak-pernik aksesoris dari berbagai negara bahkan menampilkan berbagai hiburan di areal pekarangan Fakultas Psikologi USU. Ya hari itu merupakan acara puncak Dies Natalis Fakultas PsikologiUSUyangke-12dimana mengambil tema ‘Kampung Dunia’halitulahyangmembuatpara mahasiswa memakai busana beraneka ragam baik pakaian adat lokal, maupun luar negeri. “Tema itu dimaksudkan untuk mengenalkan kekhasan budaya dari berbagai negara di dunia sehingga tidak hanya mahasiswa bahkan dosen juga mengenakan kostum dari beberapa belahan dunia,” ujar koordinator Pelaksana Acara, Meutia Nauly. Selain itu, lanjutnya, hal ini untuk meningkatkan kesadaran akan pentingnya tanggungjawab komunitas psikologis untuk meningkatkan kesejahteraan masyarakat. “Hal itu mengapa selain pertunjukan hiburan yang disajikan, dan stand bazaar yang menjual makan-minum serta

Foto bersama dosen, dan mahasiswa didalam Dies Natalis ke-12 Fakultas Psikologi USU. pernak pernik dari berbagai negara,” ujarnya kembali. Kegiatan yang dimulai sejak 28 Februari lalu itu menunjukkan bahwa ini gambaran dari sebuah perguruan tinggi untuk mendukung pendidikan di Indonesia. “Sebagaimana perguruan tinggi, maka kegiatan kami mancakuptigahalyaitupenelitian, pengabdian kepada masyarakat, danpendidikan.Inisemuasebagai bentuk Akuntabilitas Komunitas Psikologi untuk Meningkatkan Kesejahteraan Masyarakat,” ungkapnya. Sejumlah kegiatan yang turut mewarnai Dies Natalis Fakultas Psikologi adalah Pekan Ilmiah, PekanPengabdian,Porseni,Rapat Kerja dan Hiburan. Jika tahun lalu hanya hasil penelitian dosen yang ditampilkan, tahun ini hasil penelitian mahasiswa juga turut dijadikan sebagai bahan semi-

nar menunjukkan tanggungjawabnya terhadap permasalahan masyarakat. Hadir pada acara puncak Pembantu RektorV,Yusuf Husni, Dekan Fakultas Psikologi, Prof ChairulYoel, dosen dan mantan dosen, mahasiswa dan pegawai Fakultas Psikologi. “Peringatan Acara Dies Natalis dimeriahkan dengan berbagai performance dari tiap angkatan (2007, 2008, 2009, dan 2010) berupa tarian kreasi, tarian tradisional (Tari Bali danTariTor-Tor), tarik suara, drama musical, dan creative dance, dan lainnya. Berbagai kekhasan dari negara sangat terlihat dari dress code acara, seperti halnya kostum pakaian Jepang (Yukata), Indian, Cowboy, Korea, China, India (Saree), dan Belanda yang dikenakan dari dosen hingga mahasiswa yang hadir,” ujar sekretaris

panitia Ridhoi Meilona Purba. Selain dari persembahan pertunjukan, juga banyak pemberian award kepada dosen dan mahasiswa. Beberapa diantaranyayaituawardpenghargaan kepada Prof. Dr. Irmawati, psikolog (Most-Wibawa), Rika Eliana, M.Psi (Most-Favorit & Most-Tegas), Lili Garliah, M.Si (Most-Fashionable), Filia Dina Anggaraeni MPd. (MostInspirasional & Most-Ramah), Etty Rahmawati, M.Si (MostRapi), Tarmidi, M.Psi, (MostLucu), Juliana Saragih, M.Psi (Most-Komunikatif), dan Arliza J. Lubis M.Psi, Psikolog (MostGaul). Dies Natalis ke – 12 juga mengumumkan prestasi yang berhasil diraih para mahasiswa pada beberapa waktu lalu (Lab.Psi.Sos dan Danone &Trust) oleh Filia Dina Anggaraeni, M.Pd

Waspada/Hamzah

sebagai Pembantu Dekan III. “Mulai dari tahun 2011 ini disetiap Peringatan Dies Natalis Fak. Psikologi USU akan memberikan Tanda Apresiasi kepadamahasiswadansivitasyang berprestasi, untuk meningkatkan motivasi dan kinerja sivitas dalam mengasah potensi dan meraih restasi dalam rangka mengusung identitas Fakultas Psikologi USU menjadi lebih baik” tutur dari Filia Dina Anggaraeni. Acara yang dibuka ketua panitia AriWidiyanta diikuti katakata sambutan Dekan Psikolog, Prof. Irmawati, Pembantu Rektor V, Yusuf Husni kemudian dilanjutkandengantiuplilindanpemotongan kue yang dilakukan oleh DekanFakultasPsikologiUSUdan pelepasan balon ke udara yang dilakukan oleh panitia dan undangan. � Hamzah

MAHASISWA Politeknik LP3I Medan Kampus Gajah Mada mengikuti praktek-praktek lapangan seperti CompanyVisit dan kegiatan table manner tahap keduatahunakademik2010-2011, untuk menambah pengetahuan danwawasanmahasiswasebelum terjun ke dunia kerja. Kepala Kampus Politeknik LP3I Gajah Mada Medan Syahril St. Saidi, SE, MSi mengatakan, kegiatan tersebut merupakan salah satu pembelajaran di LP3I yang wajib diikuti mahasiswa di luar kampus, seperti praktek lapangan untuk mengembangkan wawasan dan pengalaman mahasiswa dengan melihat secara langsung proses kerja di sebuah perusahaan. “Kegiatan ini untuk memberikanpengetahuandanwawasan kepada mahasiswa, bagai-

mana proses berjalannya dunia kerja atau dunia industri secara langsungpadasuatuperusahaan,” jelas Syahril St. Saidi didampingi Kepala Bidang Pendidikan Laelisneni, SE, kemarin. Syahril menyebutkan, kegiatan company visit bagi mahasiswa tingkat II tersebut dilaksanakan denganmengunjungiperusahaan PT Indofood di Tanjung Morawa Medan pada 8 April 2011 lalu. Kegiatan tersebut diikuti 52 mahasiswa ditambah dosen pendampingdanditerimahumas PT Indofood, Lidya. Selain itu, untuk mahasiswa tingkat III diberikan kegiatan table manneryangtujuannyaagarpara mahasiswa memahami dan mengerti bagaimana ketika nantinya mereka terjun di dunia kerja dan mendapat undangan jamuan makan di perusahaan-

perusahaan, mereka akan lebih siap dan mengetahui sikap sopan santun dan tata krama ketika makan bersama pejabat-pejabat perusahaan.Dalamtablemanner yang diselenggarakanpada 7 April 2011 tersebut, diikuti sebanyak 108 mahasiswa di Garuda Plaza Hotel yang dipandu oleh trainer Bakti Gunawan dari Garuda Plaza Hotel. Kepala Bidang Pendidikan Laelisneni, SE menambahkan, kegiatan ini merupakan gelombang yang kedua dengan harapanmahasiswanantinyamemiliki skill yang lebih dari yang didapat di dunia kampus. “Jadi setelah tamat, kemampuan tersebut bisa dipergunakanuntukmendukung alumni dalam bekerja sebagai tenaga yang profesional maupun sebagai wirausahawan,” harapnya. **m41

Jurusan Favorit

GIRLS, ujian akhir semakin dekat… bagi kita yang mau menyelesaikan SMA, pasti udah mereka-reka…kira-kira mau memilih jurusan apa nanti saat kuliah. Seberapa dibutuhkan sih lulusan dari jurusan yang kita mau? Soalnya semakin dibutuhkan, semakin besar pula gajinya. Teknik Perminyakan Indonesia enggak bisa disangkal adalah salah satu produsen minyak terbesar di dunia.Banyakperusahaanasing berbondong-bondongkenegeri kita tercinta karena tertarik dengan minyak buminya. Enggak heran, perusahaan-perusahaan itu pun banyak melirik tenaga perminyakan di Indonesia yang enggak terlalu banyak. Karena itulah, gaji yang ditawarkan pun enggak main-main. Bisa men-

capai7digit,lho.Salaryyangtinggi memang pantas diterima mengingat sulitnya kondisi di lapangan. Jurusan ini pun enggak termasuk jurusan yang gampang. Materi yang diajarkan termasuk kelas berat. Harus belajar giat kalau masuk jurusan ini. Yang perlu dipelajari : mengenaienergi bumi. Bagaimana mencari, mengolah, dan memproduksi minyak yang nantinya bisa dijual ke pasaran. Pelajaran yang menunjang di SMA : Fisika, Kimia, Matematika Teknik Pertambangan Enggak jauh beda dengan minyak bumi, Indonesia juga kaya dengan bahan tambang, seperti batubara, emas, perak, timah, dan tembaga. Makanya, tenaga ahli untuk mengurus tambang di Indonesia enggak bakal pernah kekurangan pekerjaan. Pakar yang mengerti soal

bahan mineral berbentuk padat danbagaimanacaramengolahnya menjadi sesuatu yang berguna jelas sangat dicari. Memang enggak sembarang orang bisa memahami kerumitan persoalan di bidang pertambangan. Saking luasnya jurusan ini, nanti bakal ada beberapa penjurusan lagi seperti tambang eksplorasi, tambang umum, dan tambang metalurgi (mengkaji proses pengoalahan dan perekayasaan mineral serta logam. Yang perlu dipelajari:Penelitianadatidaknya bahan galian, kelayakan untuk penambangan, perencanaan penambangan, teknologi penambangan dan teknik pengolahan hasil tambang. Pelajaran yang menunjang di SMA : Fisika, Kimia, Matematika dan Menggambar. Teknik Kimia Reaksi spontan begitu mendengar kata kimia bisa jadi adalah…kabur!! Ternyata teknik kimia enggak seseram yang dibayangkan, kok. Pekerjaan yang dilakukan oleh anak-anak jurusan ini adalah mengolah bahan baku menjadi barnag setengah jadi atau barang jadi. Misal, mereka menggabungkan bahan-bahana seperti fluoride, gliserin, aluminium fosfat dan

beberapa zat lain untuk membuatnya menjadi pasta gigi yang kita pakai. Bahkan bahan-bahan dari pakaian yang kita kenakan juga dibuat oleh mereka. Karena pekerjaannya sangat bersinggungandengankehidupanmanusia sehari-hari, makanya lulusan jurusan inienggakpernahenggak dibutuhkan.Yang perlu dipelajari : Mekanika fluida, perpindahan panas, perpindahan kalor, termodinamika, neraca massa, kinetikareaksi,prosespemisahan, evaluasi ekonomi, pengolahan limbah. Pelajaran yang menunjang di SMA : Fisika, Kimia, Matematika. Desain Produksi Siapa yang suka beli air kemasan berdasarkan bentuk botolnya. Tahu enggak, otak di balik semua kemasan itu enggak lain adalah anak-anak desain produk. Sesuai namanya, pekerjaan anak-anak jurusan ini adalah membuat packaging untuk produk-produk yang ada di pasaran. Merekalah yang memikirkan ide, material, dan bentuk serta hasil akhir dari packaging produk. Kekreativitasan inilah yang dihargai mahal oleh perusahaanperusahaan yang memang ingin membuat produk mereka tampil

cantik dan menarik.Yang perlu dipelajari : Bikin konsep produk. Membuat barang menggunakan berbagai macam materialsepertikayu,plastic,atau resin (fiber). Pelajaran yang menunjang di SMA : Fisika, dan Menggambar. Advertising Kalau jurusan satu ini pasti berhubungan dengan iklan yang ada di media massa. Entah itu Koran, majalah TV, sampai ke billboard yang sering kita lihat di jalan.Tapi selain itu anak-anak advertising juga bisa bekerja sebagai account executive yang berurusan dengan penjualan iklan. Mengingatbanyaknyaperusahaan yang pengin menjual produknya di media massa, enggakheranbetapapentingnya peran lulusan advertising sekarang ini? Tapi harus siap tahan banting, karena enggak ada yang namanya masuk jam 8 pulang jam 5 , soalnya deadlinepekerjaannyamepet-mepet. Yang harus dipelajari : Mencari ide, membuat story board, membuat jingle dan tagline, mengeksekusi ide jadi iklan , manajemeniklan,promosiiklan. Pelajaran yang menunjang di SMA : Bahasa. **m31

Waspada/Anum Saskia Kepala SMAN 9 Drs Sofyan Purba menerima jabat tangan perpisahan dari siswa kelas tiga yang akan meninggalkan SMAN 9.

Siswa SMAN 9 Gelar Perpisahan Kelas Akhir Sukses Adik Kelas Berjaya P E R H E L ATA N a k b a r melepaskan siswa kelas akhir di SMAN 9 Medan, berlangsung di Taman Budaya Sumaera Utara ,awalpekanlalumembawasejuta harapan bagi semua pelajar di sekolah ini. Bagi siswa kelas tiga, tentu saja diharapkan sukses lulus, kemudian adik kelasnya berjaya dengan segenap kreatifitas dan kecerdasannya guna mempersiapkan diri untuk menggantikan posisi kakak kelasnya di masa kenaikan kelas mendatang. Kepala SMAN 9, Drs Sofyan Purba bersama isteri yang menghadiri kegiatan ini mengatakan sangat terharu atas antusiasnya

para siswa dalam kegiatan ini. Siswa kelas akhir yang akan meninggalkan sekolah kesayangan mereka, diminta untuk tetap menjaga nama baik almamater. Di samping itu, tidak hanya berpuas diri pada jenjang pendidikan SMA, tetapi harus punya semangat untuk melanjutkan pendidikannya. “Saya ingatkan bahwa kegiatan ini bentuk dukungan pada siswa kelas akhir untuk lulus 100 persen saat mengikuti Ujian Nasional. Semuanya sudah memberikan dukungan agar sukses, demikian pula pada adik kelasnya, agar tetap berjaya

dalam mengukir prestasi serta mempersiapkan diri menggantikan posisi kakak kelasnya. Perjuangan masih panjang, karena itu jangan berhenti demi masa depan yang cemerlang,” kata Sofyan Purba. Kegiatan perpisahan ini diwarnaipuladenganajangpentas seni yang menampilkan kegiatan tari, band dan musikalisasi puisi yang dibawakan seluruh siswa kelas 2 dan kelas 1. Ditampilkan pula foto berbagai kegiatan siswa melalui monitor yang diwarnai tepuk sorak siswa yang melihat beragam tingkah mereka dalam album foto milik SMAN 9. Anum Saskia

Budaya

B10

WASPADA

Minggu 17 April 2011

Sanggar Getar Sumut Sambut Ramadhan

Siapkan Pagelaran Drama Syair “Maulidun Nabi”

Waspada/Dedi Riono Anak-anak Sanggar Getar meluapkan kegembiraan usai latihan drama syair “Maulidun Nabi” gubahan seniman/budayawan Sugeng Satya Dharma yang disutradarai Adi Mujabir.

Ide Cerpen, Imajinasi Tanpa Realitas Oleh: Yulhasni PERNAHKAH kita bertanya kepada para pembuat cerita pendek, darimana mereka mendapat ide untuk sebuah kisah yang menarik? Dalam buku kumpulan cerpen Parmin karya Jujur Prananto, penulis menyebutkan bahwa ide cerpennya banyak berasal dari fakta yang dilihat. Dalam buku itu misalnya, Jujur Prananto menceritakan soal lahirnya cerpen berjudul Dua Pemerkosa. Disebutkan, cerpen itu lahir dari bacaannya tentang ketidakadilan yang dialami oleh korban perkosaan. Pelaku pemerkosaan sering bebas hanya karena hukum tak mampu menyentuhnya. Makanya, menurut Jujur dalam cerpen itu, hukuman yang paling pantas bagi pemerkosa adalah diperkosa! Putu Wijaya bahkan sama sekali hanya mengandalkan insting saat membuat cerita pendek. Ia sama sekali tidak memiliki bahan apapun. Ide itu mengalir saat ia berada di depan komputer atau mesin tik. Itulah yang terekam dalam cerpennya berjudul Bom. Gola Gong yang membuat kelompok Rumah Dunia mengatakan kesulitan seorang pengarang adalah menemukan ide dan menuliskannya. Kata Gola Gong, janganlah duduk di tempat komputer dengankepalakosong, karena itu hanya akan membuang-buang waktu saja. Ketika hendak menulis, persiapkanlah dulu semuanya. Bahan-bahannya; sinopsisnya. Syukur-syukur jika sanggup secara detail; alur cerita, konflik, latar tempat, dan karakter para tokoh. Mungkin berbagai bentuk teknik dari pengarang, tentu saja menjadikan seorang pemula dalam menulis cerita pendek tinggal memilih kiat yang mana palingmemungkinkandijalankan. Dalam dua aspek pemilihan ide, saya cenderung mengatakan

bahwa ide dari fakta (baca : realitas) memungkinkan kekuatan cerita akan lebih mendalam. Mengapa? Sejak lama memang sastra Indonesiaterlibatdalamdikotomi antara realitas dan imajinasi. Realitas selalu dipandang sebagai gambaran atas apa yang selalu dipahami Aristoteles dan Plato sebagai dunia tiruan (mimesis). Pengarang menerjemahkan pengamatan untuk kemudian menuangkan dalam bentuk gagasan. Tiruan seperti ini tidak hanya sebatas gambaran simbolisasi dalam puisi, melainkan dimaknai dalam arti luas sebagai realitas masuk ke ranah sastra (baca : cerpen). Itulah sebabnya mengapa kemudian karya Seno Gumirad Adjidarma tentang Saksi Mata dipahami sebagai realitas politik Timur-Timor dalam cerita pendek. Hal serupa juga berlaku, misalnya, pada puisi-puisi Wiji Thukul yang menuangkan keprihatinan buruh dalam sajak-sajak pemberontakannya. Penyair yang nasibnya sampai sekarang tidak diketahui keberadaannya akibat gerakan pembersihan ala Orde Baru itu menerjemahkan realitas tanpa simbolisasi berlebihan. Realitas bukan pula hanya dibatasi sebagai varian politik keberpihakan. Jika kemudian ini muncul dalam khazanah sastra, tentusajakonsepLekra(Lembaga Kebudayaan Rakyat) tentang sastra bisa kita pahami sebagai sesuatu yang sah. Lembaga yang berafiliasi ke PKI pada masa

demokrasi terpimpin ini dalam literatur sejarah sastra dinilai telah menciderai makna kebebasan berkarya, meskipun kemudian mereka membantahnya. Realitas harusdipahamidengankacamata keinginan menuangkan pengamatan di sekitar ke bentuk karya seperti halnya cerita pendek. Cerita pendek memang hanyalahgagasansingkatpengarang tentang berbagai hal yang ia tulis. Akan tetapi, cerita pendek yang menekankan dan menjunjung tinggi imajinasi tanpa realitas dikuatirkan melahirkan kesombongan dan kecongkakan pengarang. Konsep bahwa arti sebenarnya dalam puisi hanyalah diketahui oleh pengarangnya, tentu saja telah mendudukkan karya sastra

san singkat dalam hitungan 50007000 kata yang kemudian untuk itu dibenarkan realitas dihilangkan. Struktur yang membangun cerpen tetaplah tidak mengabaikanamanatsebagaikekuatan besar yang dipandang pembaca. Amanat itu semestinya tetap dalam kerangka menuangkan ide dari realitas. Pengarang dengan sendirinya akan ke luar dari kungkungan yang selalu menghantui, yakni tidak mampunya cerpen jadi genre sastra yang diperbincangkan. Barangkali lahirnya novel teenlit, novel bernuansa Islami serta novel bertema ajaran pendidikan seperti Laskar Pelangi nya Andrea Hirata dan lain-lain tersebut merupakan bentuk lain dari pengarang untuk mampu

Cerpen bukan sebatas gagasan singkat dalam hitungan 5000-7000 kata yang kemudian untuk itu dibenarkan realitas dihilangkan. ke jurang keterpinggiran. Cerpen yang bermaksud untuk menekankan nilai-nilai estetika dan mengabaikan realitas akhirnya akan membuat karya sastra jauh dari nilai-nilai kebenaran. Cerpen justruakanmenjadiruanghampa tanpa makna! Bukankah sastra telah begitu lama menjauh dari realitas? Pendeknya cerita, pada cerpen bukan semata-mata hanya untuk memenuhi kebutuhan para penggemar fiksi di era modern, yang cenderung memiliki waktu membaca terbatas (5-10 menit). Meski singkat, cerpen tentu saja harus melahirkan dan memberikan pesan moral kepada pembaca. Realitas tentu saja adalah ide besar yang memberi pesan itu. Keterbatasan cerpen tidak serta merta membuatnya abai atas terpinggirnya nasib orang banyak. Cerpen bukan sebatas gaga-

menjadikan sastra sebagai ajaran moral. Rata-rata keunggulan cerpen-cerpenternamadiIndonesia karena mampu menerjemahkan realitasitukeranahsastra.Wacana yangdibangunpengarangcerpen kita adalah bangunan realitas dalam keseharian. Cerpen bertema sosial selalu mendapat tempat di hati pembaca karena mampu memberikan nilai-nilai kemanusiaan. Ketika media massa tak mampu menerjemahkan realitas secara transparan, cerita pendek akhirnya berposisi sebagai peran pengganti. Sindirandanceletukandialog dalam cerpen akan mampu membuat pembaca memahami bahwa telah terjadi ketimpangan yangluarbiasadalamkesehariannya. Cerpen Telinga karya Seno Gumira Adjidarma, tidak lain sebagai pengganti peran media yang tak jujur dan nyaris tidak

transparan dalam memberitakan Timor-Timur pada masa Orde Baru. Seno tentu saja tidak sedang bermain-main dengan fiksi, cerpen ciptaannya adalah realitas itu sendiri. Membangun realitas tentu saja tidak mudah. Pengarang cerpen seringkali membangun realitas dengan pembahasaan yang imajiner. Simbolisasi yang berlebihan membuat cerpen ke luar dari realitas itu sendiri. Saat membaca cerpen Jujur Prananto berjudulBahasaInggris,misalnya, kita menemukan fakta-fakta di keseharian yang jauh dari simbolisasi. Di sini secara diam-diam pembaca akan mengakui bahwa posisi dan jabatan yang diraih dengan cara-cara yang tidak fair dan jujur hanya menenggelamkannya kepada ketakutan. Si tokoh yang menjabat posisi penting di sebuah instansi pemerintah harus ketakutan untuk menghadiri konperensi internasional karena tidak bisa berbahasa Inggris. Meskicerpenlahirdariproses pengendapan si pengarang, pada sisi lain sebenarnya cerpen adalah hasil dari luapan imajinasi tentang realitas. Secara diamdiam pengarang merekam apa yang dia lihat lantas menulisnya. Hasil rekaman itu semestinya tidak membuat pengarang kemudian mencari bahasa-bahasa imajiner yang justru menjauhkan sastradarirealitas.Bahasaimajiner meski ia bagian dari aspek pendukung kekuatan cerpen, akan tetapibukansebagaiintikekuatan. Bahasa imajiner tetaplah sebagai pengindah cerita. Begitujauhnyarealitasitudari dunia kesusasteraan telah menyebabkan sastra semakin terpinggirkan. Pembaca tidak mendapatkan apa-apa dari cerpen yang menuhankan imajinasi dan mengabaikan realitas. Sekali lagi, ide cerpen sebaiknya bercermin pada realitas! *Penulis adalah Dosen Bahasa dan Sastra Indonesia FKIP UMSU

Soeryadarma, Penyair Cilik Aceh Go Nasional HUJAN Kota ini kabut sering menutupi wajah gunung merapi, singgalang dan tandikek yang indah bukit tui penghasil kapur. Kota ini hujan sering turun tanpa diduga, membasahi jalan bahkan hati para pejalan. ITU salah satu puisi Soeryadarma Isman, Putra pertama penyair Sulaiman Juned dan Iswanti. Dia lahir di Beureunuen, Pidie, Aceh, 17 Maret 2002 silam. Selain menjuarai sejumlah lomba puisi tingkat lokal dan nasional, puisi-puisinya juga sering dimuat di koran Jakarta, terutama di ruang anak koran Kompas. Siswa Sekolah Dasar Negeri 1 Guguk Malintang, Padangpanjang Timur, yang baru berusia sembilan tahun ini memang suka mengikuti berbagai lomba baca puisi, baik ketika masih Taman Kanak-kanak maupun saat dia menduduki bangku sekolah dasar. MeskipunkelahiranAceh,dia menghabiskan masa balitanya di Solo, Jawa Tengah, kemudian mengikuti ayahnya ke Padangpanjang yang menjadi dosen seni

di sana. “Saya selalu rindu pada Aceh.Mungkintahuninisayaakan menjenguk nenek di Beureunuen,” ungkapnya kepada penulis. Darah Aceh yang mengalir di tubuhnya tak dapat memisahkan dirinya dari pengalamanpengalaman pahit perang, karenanya pula secara polos dia menuliskan baris-baris puisi yang sangat menyentuh, yang menggabarkan kepada anak-anak lain bagaimana sesungguhnya bumi Aceh itu. Puisi-puisiSoeryayangtampil bernas dan memukau ini merupakan hasil belajar di Komunitas Seni Kuflet Padangpanjang, Sumatera Barat. Pada hari-hari sepulang sekolah, bila tidak mengaji ke surau, dia menulis dalam buku catatannya, untuk kemudian dia koreksi pada malamhari,selepasdiamembuat PR sekolah. Tidak sepenuhnya puisi yang dia tulis itu langsung jadi. Butuh pendapat, pemeriksaan, dan koreksi berulang-ulang sebelum kemudian buah karyanya dikirim ke penerbitan yang memuat secara khusus puisi anak-anak. Oleh karena itu namanya tidak hanya dikenal di kalangan anak sebayanya, tetapi juga orang

dewasa, dan sering mendapat undangan untuk tampil pada setiap acara kesenian di tempatnya tinggal. Soeryajugaseringtampilbaca puisi di BiTv Bukit Tinggi dalam acara Kaji Sastra, juga jadi pemusik dalam tajuk Menyama Beraya Komposer. Dia juga tampil pada acara Teaterikal Puisi “Matahari” karya Sulaiman Juned yang disutradarai Mumuik Kuflet dalam pembukaan LK II HMI di Gedung M.Syafei Padangpanjang. Menampilkan teaterikal puisi berjudul Ziarah Gempa setahun lalu pada saat lounching novel Cinta di Kota Serambi dan Ziarah Bencana di Gedung MTC Sawahlunto. Selain itu, Puisi-puisinya pernah dimuat di Korandigital.com, Postmetro, di Ruang Kita koran Kompas, dan Media Indonesia. Dalam Lomba Baca Puisi di Acara Pedati Nusantara X 2010 di Bukit Tinggi mendapat juara Favoerit. Akan terbit pula antologi puisi perdananya berjudul Negeri di atas Langit yang diterbitkan KufletPubhlising,KomunitasSeni KufletbekerjasamadenganDiknas Padangpanjang, Sumatera Barat. *Arafat Nur

Waspada/Arafat Nur Soeryadarma Isman saat menerima penghargaan di salah satu lomba baca puisi yang diikutinya di Padangpanjang, barubaru ini.

SANGGAR Getar Sumatera Utara pimpinan Adi Mujabir kini sedang mempersiapkan pagelaran kolosal drama syair “Mualidun Nabi”. Persiapan pagelaran ini merupakan rencana pementasan pertama Sanggar Seni dan Teater yang bermarkas di Perbaungan, Kabupaten Sergai, setelah selama inisanggarGetarhanyamementaskannaskah-naskah drama konvensional. Dramasyair“MaulidunNabi”merupakannaskah karya seniman Sugeng Satya Dharma yang ditulis dalam bentuk syair dan berkisah tentang riwayat kelahiran hingga wafatnya Nabi Muhammad SAW. Menurut penulisnya, drama ini sengaja ia gubah sebagaiupayamembangunpemahamanmasyarakat untuklebihmengapresiasiperjuangandakwahIslam, khususnya di masa-masa awal pengembangan agama Islam. Sugeng menyebutkan, pilihannya terhadap bentuksyairdalamnaskahtersebutsengajadilakukan untuk memudahkan pemahaman oranng yang akan menyaksikannya. “Dengan syair, Insya Allah pengertian dan pemahaman bisa lebih mudah disampaikan,” katanya. Adi Mujabir yang bertindak sebagai sutradara, mengakupenggarapandramasyair“MaullidunNabi” mengambil konsep opera dengan mengutamakan gerak tari (koreografi) dan lagu. “Tidak ada dialog dalam drama ini kecuali narasi dan lagu,” katanya. Dijelaskan, persiapan pagelaran drama syair yang sedang digarapnya ini mudah-mudahan

menjadi bentuk baru dalam khazanah pagelaran teater di Sumatera Utara, setelah bertahun-tahun aktivitas teater di daerah ini disuguhi pagelaran drama konvensional. Pagelaranitusendirinantinyaakandimainkan oleh anak-anak sanggar Getar dibantu muridmurid pengajian Maktab Al-Huda, Gang BO Tanjung Morawa. Selain itu, dalam mempersiapkan pagelaran ini, Jabir juga akan menghadirkan sejumlah ulama sebagai penasehat ahli. “Kehadiran ulama sebagai penasehat ahli dalam pagelaran ini kami anggap penting agar pagelaran kami tidak menimbulkan kontroversi,” tambah Jabir. Sugengsendiri,yangselamainidikenalsebagai penyair, sastrawan dan essays yang produktif, mengaku “Maulidun Nabi” merupakan naskah drama pertamanya yang digarap secara serius setelah sebelumnya ia hanya menulis naskahnaskah drama konvensional. “Naskah ini merupakan wujud apresiasi dan kecintaan saya pada Kanjeng Nabi Muhammad SAW.Semogarasacintayangkumilikiinibisamenular dan menjalar ke semua ummat yang nnantinya akan menyaksikan pagelaran ini,” katanya. Rencananya, drama syair “Maulidun Nabi” akan dipentaskan pada peringatan Isra’ Mikraj padaJunimendatang,danakandibawaberkeliling daerah di Sumatera Utara sebagai program safari seni dakwah Sanggar Getar selama bulan Ramadhan. **m42

Kuda Kepang, Kesenian Lokal Kian Terpinggirkan KUDA kepang merupakan satu seni tradisional yang semakin ditelan zaman. Kuda kepang dikenali dengan berbagai nama seperti jaran kepang, kuda lumping, jathilan dan ebeg. Orang Jawa memberikan makna bagi ‘jaran’ ialah kuda sedangkan ‘kepang’ merujuk kepada anyaman. Bagi masyarakat Jawa panggilan bagi kuda kepang yang popular ialah jaran kepang karena pertunjukan yang dipersembahkan ialah menggunakan anyaman kuda. Awalnya menurut sejarah, seni kuda kepang lahir sebagai simbolisasi bahwa rakyat juga memiliki kemampuan dalam menghadapi musuh ataupun melawan kekuatan elite kerajaan yang memiliki bala tentara.Disampingjugasebagaimediamenghadirkan hiburan yang murah meriah namun fenomenal kepada rakyat banyak. Kesenian ini menggunakan kuda bohongbohongan terbuat dari anyaman bambu yang diiringi oleh musik gamelan seperti gong, kenong, kendang danslompret.Penarikudakepangyangasliumumnya diperankan oleh anak putri yang berpakain lelaki bak prajurit kerajaan. Bunyi pecutan (cambuk) besar yang sengaja dikenakan para pemain, menjadi awal permainan dan masuknya kekuatan mistis yang bisa menghilangkan kesadaran si pemain. Dengan menaiki kuda dari anyaman bambu tersebut, penunggang kuda yang pergelangan kakinya diberi kerincingan berjingkrak–jingkrak, melompat–lompat hingga berguling-guling di tanah. Tak hanya itu, penari kuda kepang yang sudah kesetanan itu pun melakukan atraksi yang cukup berbahaya, seperti memakan beling (kaca) dan mengupas sabut kelapa dengan gigi taringnya. Biasanya,belingyangdigunakanadalahbolamlampu layaknya orang kelaparan, tidak meringis kesakitan dan tidak ada darah pada saat ia menyantapnya. Bunyi pecutan yang tiada henti mendominasi rangkaian atraksi yang ditampilkan. Setiap pecutan yang dilakukan oleh pawang dalam permainan mengenai kaki dan tubuh si penari dan akan

memberikan efek magis. Ada yang cukup kalem, tapi kebanyakan jadi liar. Mereka meminum banyak air, menelan daun pisang, kembang, dan gabah, layaknya kuda sungguhan.JaranKepangbiasadiiringiparapemain gamelan. Selain itu, ada pula gambuh, semacam sosok yang memiliki daya mistis yang mengambil peran sebagai dalang pertunjukkan dan bertanggung jawab terhadap kesurupan. Sebelum pertunjukkan mulai, gambuh dan pengiringnya khusyuk dalam doa serta menggelar sederet upacara. Lengkap dengan dupa (kemenyan yang dicampur minyak wangi tertentu kemudian dibakar), buceng (berisi ayam panggang jantan dan beberapa jajan pasar, satu buah kelapa dan satu sisir pisang raja), kembang boreh (berisi kembangkantil dan kembang kenanga) ulungulung (berupa seekor ayam jantan yang sehat), serta kinangan (berupa satu unit gambir, suruh, tembakau, dan kapur yang dilumatkan menjadi satu lalu diaduk dengan tembakau). Begitu gambuh memberikan isyarat tertentu, dalam sekejap semua penari kesurupan. Dialah yang akanmemberikaninstruksipadakelompokpenari dan juga penonton. Sebagai sebuah atraksi penuh mistis dan berbahaya tarian kuda kepang dilakukan di bawah pengawasan seorang pimpinan supranatural atau biasa disebut pawang. Biasanya, sang pawang adalah seorang yang memiliki ilmu gaib yang dapat mengembalikan kesadaran penari yang kesurupan dan mengusir roh halus yang merasuki sang penari. Namun, seiring perkembangan zaman, kesenian tradisional kuda kepang memang sudah mulai terpinggirkan karena kalah bersaing dengan kesenian yang lebih modern. Hanya kecintaan para senimannya yang membuat mereka bertahan dengan kesenian yang hidup dan berlangsung secara turun-temurun tersebut. * Arianda Tanjung

Catatan Budaya

Fasilitas Oleh S. Satya Dharma SUDAH banyak hasil penelitian, survey dan bahkan pernyataan yang dilontarkan tentang besarnyakesulitanyangdihadapibangsainidalam merecovery kehidupan berbangsa dan bernegara pasca reformasi 1998. Baik itu kesulitan secara sosial, kultural dan lebih-lebih ekonomi. Di atas kertas, semua memang terkesan baikbaik saja. Bahkan dari mulut presiden dan para menteri acap meluncur pernyataan bahwa secara makro perekonomian membaik, kamtibmas stabil, kehdupan berjalan demokratis, ect, ect. Tapi di lapangan, fakta menunjukkan jumlah orang miskin justru tak semakin berkurang, pengangguran bertambah, ketegangan sosial hampir terjadi setiap hari, dan ini yang utama, harga-harga kebutuhan hidup terus melonjak. Dalam kondisi yang tak bagus itu, muncullah paradoks. DPR akan membangun gedung baru serba “wah” dengan biaya mencapai satu triliun rupiah lebih. Di samping itu mereka juga sedang berjuang mengeruk uang rakyat lewat apa yang mereka sebut dana aspirasi. Sedang di lingkungan birokrasi, gaji para menteri dan pejabat eselon terus ditambah atas nama program renumerasi. Pokoknya negara ini sungguh-sungguh sedang memanjakan aparatur pemerintahannya baik di eksekutif, legislatif dan yudikatif. Lalu di manakah tempat rakyat dalam situasi ini? Tetap saja di selokan, comberan dan kolongkolong jembatan. Apa yang sedang berlangsung di negeri ini memang bukan lagi sekadar tragedi. Tapi sudah sampai pada “kiamat kecil” hati nurani. Para pemimpin, tak di eksekutif tak di legislatif, hidup bermewah-mewahan dengan bermacam fasilitas atas nama tugas-tugas mengurus rakyat. Ironisnya, rakyat yang seharusnya diurus, justru dibiarkan keleleran dan mengurus dirinya sendiri. Itupun kalau sanggup. Kalau tidak, biarkan saja mereka bunuh diri. Itulah memang fenomena yang terjadi sejak beberapa tahun belakangan ini. Media massa bahkan tak hentihentinya mengabarkan orang-orang yang naik ke menara atau gedung tinggi, lalu lompat ke bawah dan mati. Pertanyaannya kemudian adalah; apa sesungguhnya yang sedang terjadi di Republik ini? Mengapaparapemimpinnegeriiniterusmenerus kehilangan nurani dan empati kemanusiaannya? Mengapa para elit di republik ini semakin kehilangan sense of crisisnya? Pertanyaan berikutnya adalah, persekongkolan macam apa sesungguhnya yang sedang digalang pihak eksekutifdanlegislatifdinegeriiniuntukmembuat rakyat semakin menderita? Di atas permukaan memang ada kesan pemerintah ingin meningkatkan kesejahteraan hidup rakyatnya. Tapi itu rupanya cuma sebatas

pidato-pidatopejabatpemerintahyangdilansir mediamassa.Padakenyataannya,hasrathidup berbangsa dan bernegara yang sejahtera itu justru semakin jauh dan semakin sulit diraih. Berbagai kebijakan yang dikeluarkan oleh pemerintah, baik di pusat maupun di daerah, jelas-jelas tidak berpihak pada upaya peningkatan kesejahteraan. Pemerintah pusat menaikkan harga-harga kebutuhan hidup seenaknya sendiri. Sedangkan pemerintah daerah dengan sewenangwenang melakukan penggusuran terhadap lahan penghidupan orang-orang kecil, rakyatnya. Adalahbenarbahwamembuatperubahan membutuhkan proses. Roma memang tidak dibangun dalam satu malam.Tapi tujuh tahun usia suatu rezim yang memerintah bukanlah waktu yang pendek. Jika bersekolah, untaian waktu itu sudah harus membawa kita naik kelas. Tapi setelah tujuh tahun, apa prestasi rezim pemerintahan sekarang ini dalam menyejahterakanrakyatnya?Yangterjadi,justru secara ekonomi kehidupan rakyat semakin sulit. Semakin terpuruk. Ironisnya, dalam kondisi berbangsa yang tak juga membaik ini, para pejabat negara terus menuntut fasilitas yang tinggi sedang retorika tentang kehidupan di alam demokrasi terus dikumandangkan dengan penuh bungabunga. Berbagai skenario keberhasilan pun dikampanyekan. Bahkan, agar terkesan ilmiah, seringkali pemerintah meminjam mulut para akademisi dan meminta pers jadi corongnya. Semua itu menunjukkan betapa tidak sederhananya problem yang sedang dihadapi bangsa ini. Maka, jika presiden SBY memang bersungguh-sungguh ingin menciptakan keadilan sosial bagi seluruh rakyat Indonesia, sudah saatnya ia meniru gaya kepemimpinan Walikota Solo yang rendah hati itu. Yakni kepemimpinan yang menjadikan rakyatnya yangmanusiasebagaiseutuh-utuhnyamanusia. Itu berarti segala tuntutan akan fasilitas yang berlebihan sesungguhnya tidak penting kalau memang niatnya demi mengabdi pada bangsa dan negara. Selama tuntutan akan fasilitas itu terus dikumandangkan, maka pidato-pidatopemerintahtentangpeningkatan kesejahteraan rakyat hanyalah cek kosong tak berarti. Dan selama situasi yang seperti ini terus berlangsung, selama itu pula pemerintahan di negeri ini akan kehilangan kepercayaan dari rakyatnya. Percayalah! (*) *Penulis adalah Sekretaris Jenderal Multiculture Society Dan Koordinator Gerakan Relawan Medan Hijau (Gerilya-Mu)

Pariwisata

WASPADA Minggu 17 April 2011

Sunrise Peak adalah salah tempat yang tidak dilewatkan pengunjung ketika berada di Pulau Jeju.

A6

Patung-patung yang juga menjadi daya tarik di Pulau Jeju.

Pulau Jeju: Tempat Untuk Manjakan Diri LETAKNYA tepat di lepas pantai Korea Selatan, maka tak heran jika Pulau Jeju berhasil menarik ribuan wisatawan dan orang-orang yang ingin berbulan madu. Penerbangan langsung ke dan dari kota-kota internasional seperti Tokyo, Osaka, Beijing dan Shanghai (serta bandara domestik Korea Selatan) dan persyaratan visa liberal membuat perjalanan menuju tempat ini hanya membutuhkan waktu sekejap. Jeju juga merupakan tempat di mana terdapat taman hutan nasional semi tropis seluas 224 kilometer bujursangkar dan sepanjang garis pantainya dihiasi beberapa air terjun. Dengan setengah juta orang tersebar di area yang tiga kali

seukuran Seoul, tempat ini sangat cocok untuk memanjakan diri. Gua Manjang Lava Tube ini merupakan taman Geologi lain UNESCO, dan lebih dikenal sebagai Gua Manjang yang panjangnya lebih dari delapan kilometer, namun Anda hanya bisa menjelajahi satu kilo-meter kawasan ini yang cukup menakutkan. Terbentuk oleh lava yang mendingin kemudian membeku, gua ini gelap, dingin, sempit dan licin karena curahan air, dan Anda sudah pasti akan menemukan kelelawar di sudut gelap nya. Tempat ini tidak dianjurkan untuk mereka yang menderita sesak napas. Dari Terminal Sibuk Antar-kota Jeju, Anda bisa naik bus menuju Jocheon (jalan lokal 1132) dan turun di Manjanggul Entrance; dari sana naik shuttle bus atau berjalan kaki selama 20 menit,

Anda sudah sampai di tujuan. Meski kedengarannya ironis, Jeju bangga dengan “tiga kelebihan” yang ada di sana angin, batu dan wanita. Bebatuan yang ditemukan di sana terbentuk akibat curahan lava. Sembilan puluh persen permukaan tanahnya bersifat basal. Dinding batu yang terdapat di sana melindungi datarannya dari badai. Sekitar tahun 1750, untuk menakut-nakuti dan menghadang kaum penjajah, tukang batu mengukir batu menjadi bentuk “batu kakek” hitam larangan (dolharubang) – patung-patung besar yang ada di sana mungkin dikira sepupu jauh dari patungpatung yang ditemukan di Pulau Paskah. Masih ada empat puluh lima patung di sana - tetapi jangan sampai terkecoh dengan replika-nya. Batu-batu itu tetap menjadi simbol dari budaya kuno

yang berbeda dilengkapi dengan kisah-kisah para dewa dan juga cerita legenda. Lihatlah batu-batu di seluruh pulau, dan jika ingin melihat lebih banyak lagi Anda bisa berkunjung ke Jeju Stone Park (Taman Batu Jeju). Pantai Indah Pantai Jungmun merupakan salah satu pantai terindah di Pulau Jeju. Bayangkan keindahan hamparan pasir putih, laut biru yang perlahan menghijau ketika mendekati bibir pantai. Pantai indah ini tidak banyak didatangi pengunjung di luar musim panas. Pantai atas lain yang biasa menjadi tempat berenang dan berselancar adalah Emerald Bay, Gwakji, Hamdoek dan Shinyang. Pantai Jungmun, Seogwipo, terletak di pesisir selatan, sekitar satu jam dari Kota Jeju. Jalan Setapak Olle Olle dalam dialek lokal berarti

jalan berliku menuju pintu depan rumah Anda, dan jalan setapak Olle berada di jalur pesisir yang mengelilingi hampir seluruh pulau itu. Drama sejarah yang sangat populer “Jewel in the Palace” difilmkan di sini. Jadi Anda bisa berpura-pura berperan sebagai salah seorang bintangnya, jika Anda ingin. Matahari Muncul Dari Kawah Gunung Pergilah ke Sunrise Peak (Seongsan Ilchulbong), kerucut setinggi 182 meter menjulang dari laut dengan kawah luas berwarna hijau di ujung timur pulau itu. Sekarang tempat itu bisa dicapai lewat jembatan, di mana sisi kiri dan kanannya penuh dengan tempat-tempat jualan asesoris

dan taman latihan. Banyak orang berdesak-desakan untuk mengabadikan tempat indah ini. Syafri/cnn

Pantai Jungmun dengan hamparan pasir putihnya.

Keindahan Pulo Batee (batu) di tengah Samudra Indonesia Pulo Batee berarti Pulau Batu. yang merupakan sebuah atol yang terletak di ujung Pulau Sumatera. Tepatnya di Kecamatan Meuraxa, Kabupaten Aceh Besar propinsi Aceh. Pulo yang luasanya sekiatar 100 hektar ini tidak didiamin penduduk, tetapi banyak satwa liar di pulau seperti elang, babi hutan dan hewan unggas lainnya, Nelayan yang menangkap ikan di sekitar pulau ini sering singgah utk mengambil air tawar . Pulo Batee dapat dicapai dengan terlebih dahulu tiba di Kota Banda Aceh, yang merupakan ibukota dari Propinsi Aceh. Jika melalui Jakarta dapat melalui penerbangan Garuda Indonesia. Juga dapat melalui Kota Medan dengan menggunakan penerbangan. atau menggunakan Bis Mewah seperti Kurnia, Pelangi dengan ongkos sebesar Rp 150.000/ orang dengan memakan waktu sekitar 8 jam perjalanan malam hari. Perjalananan ke Banda Aceh juga dapat langsung melalui Kuala Lumpur dengan menggunakan Pesawat Air Asia.

Setelah sampai di Banda Aceh, maka pengunjung harus menuju ke Pelabuhan Ulee Lheue untuk menyewa perahu bermotor milik nelayan untuk selanjutnya membawa pengunjung ke Pulo Batee. Karena tidak ada pelayaran khusus ke Pulo Batee, maka pengunjung harus menyewa perahu. Untuk setiap perahu berpenumpang sebanyak 5 orang. Jarak perjalanan Banda Aceh ke Pulo Batee hanya memakan waktu 15 menit ! Di pulau Batee Kata Andi Muzani yang mengolah web site Pulo Batee dan travel trif ke sana walaupun rasanya seperti terisolir, jangan khawatir anda mendapat sinyal full GSM disini.

Jadi bisa tetap online dan Fesbuk-an.dan kita dapat menikmati beragam aktifitas wisata pantai seperti snorkling, diving dan fishing. Taman karang di sekitar Pulo Batee cukup indah untuk dijelajahi. Serta anda juga dapat melakukan perburuan babi liar dengan disertai anjing-anjing peliharaan yang terlatih. Juga hiking, mini jungle tracking serta yang berpengalaman dapat menyelusuri gua-gua dibawah lautnya. Pulo batee ini adalah pulau yang belum terjamah oleh pembangunan & pengembangan proyek pariwisata di aceh. pulau ini masih tertidur dalam geliat pariwisata acehsecara geografis pulo batee terletak di kabupaten aceh besar, kecamatan peukan bada berdekatan dengan 3 pulau lainnya yaitu pulau sumatera sebagai mindland, pulau bunta serta pulau deudap. keberadaan pulo batee sebagai salah satu tempat tujuan wisata di aceh ini masih terisolir, karena fasilitas transportasi umum sebagai penunjang kegiatan pariwisata masih sebatas dikelola oleh pengelola (pemilik) pulau. jika wisatawan ingin mengunjungi pulo ba-

Waspada/ Muhammad Faisal

tee , wisatawan hanya bisa menyebrang menggunakan perahu mesin tepteep (istilah masyarakat setempat), namun dibalik segala keterbatasan fasilitas umum yang ada, Pulo Batee tetap menguji pelancongnya suatu atraksi yang berbeda dengan distinasi lain yang ada di planet biru kita ini. sehingga memperkuat keinginan untuk mengunjungi pulau ini. “emty aura” dari pulo batee tersebut menguatkan brand-image-nya yang positif dimata para petualang, yang telah sampai ke pulau tersebut. Sebagai Salah Satu Daerah Tujuan Wisata di kabupaten aceh besar adalah keindahan taman lautnya, pesona gugusan pulau-pulau, eksotik turtle, dalam kontek inim kita coba memaparkan panorama kepulauan, salah satunya adalah pulo batee yang memiliki potensi wisata yang menarik dan mempesona. Tak heran bila wisatawan mancanegara maupun nusantara berkunjung ke sana dan menikmati keindahan alam tak terjamah di pulo batee. potensi dan keindahan alam semacam ini memang membanggakan masyarakat aceh itu sendiri. pariwisata menjadi brand-image di mana orang bisa mengenal aceh. Bicara tentang aceh, tentu tidak terlepas dari bicara tentang pariwisatanya. pengembangan pariwisata di aceh bisa memadukan dua paket, yaitu wisata alam dan wisata budaya, Menurut Andi Muzani bersama patner Bisnisnya Lian Nasution yang mengatakan kekayaan budaya lokal semestinya diangkat ke permukaan untuk dihidupkan lagi. di aceh kita kenal begitu banyak tarian daerah, atraksi budaya, simbol-simbol budaya, perlengkapan budaya di antaranya pakaian adat dan tenunan tradisional. Paket-paket ini bisa menjadi daya tarik tersendiri bagi para wisatawan karena salah satu motivasi yang mendorong perjalanan seorang wisatawan. Dan kini Bagi yang berdomisili di kota medan, dan ingin mengetahui lebih jauh tentang Pulo Batee bisa mengunjungi stan acara Travel Fair di Palladium Plaza tanggal 15 Mei - 17 April 2011. (Muhammad Faisal)

Photo Andi Muzani

Photo Andi Muzani

Infotainmen

B12

WASPADA Minggu 17 April 2011

Pemerintah Indonesia Gagal Lindungi Rakyat SEJUMLAH produser film di Indonesia keranjingan mengimpor bintang porno. Setelah Maria Ozawa (Miyabi), Rin Sakuragi, Tera Patrick dan Sora Aoi, kini giliran Sasha Grey yang akan didatangkan ke tanah air. Maraknya film Indonesia yang dibintangi artis porno asal luar negeri membuat sejumlah kalangan mempertanyakan sikap pemerintah. Undang-undang Anti Pornografi dan Pornoaksi (UU APP) tidak dijalankan. Bahkan Lembaga Sensor Film (LSF) seakan tidak berfungsi. Pada akhirnya, Pemerintah Indonesia dinilai gagal melindungi rakyatnya. Majelis Ulama Indonesia (MUI) mendesak para produser film yang berbumbu adegan vulgar agar meng-

hentikan impor bintang porno luar negeri. Bahkan MUI meminta Pemerintah Indonesia mencontoh Malaysia. “Kita harus contoh Malaysia yang sangat bagus memproteksi umatnya. Di Malaysia, bintang porno itu tidak boleh masuk karena akan menghancurkan moral,” ungkap Ketua Bidang Seni dan Budaya MUI Pusat, KH. Cholil Ridwan saat di Jakarta Selatan, Rabu (13/4). Cholil mempertanyakan Lembaga Sensor Film (LSF) yang mengizinkan film-film berbau seks tersebut bisa lolos tayang. “Sebetulnya, kita punya LSF yang berhak mengatakan film ini boleh beredar apa tidak. Kalau LSF menyatakan lolos sensor, maka kita tidak bisa apa-apa,” ujarnya.

Selain itu, Cholil juga mengkritik para produser film yang mengimpor bintang porno tersebut. “Anda jangan menumpuk kekayaan dengan merusak moral bangsa karena mengundang bintang porno. Moral bangsa yang dihancurkan itu lebih mahal,” ujarnya Tidak bisa dipungkiri, film horor seks laris manis di bioskop Indonesia. Namun, pemerintah terkesan membiarkan proses pengrusakan moral yang terus berlangsung melalui film-film tersebut. Selain tidak mendidik, film horor seks tersebut merusak moral penonton yang kebanyakan remaja. “Harusnya ada aturan artis porno tidak boleh masuk ke Indonesia,” demikian Cholil.(inc/k)

word/solo

japress

Aksi unjukrasa ormas Islam di sejumlah daerah memprotes kedatangan bintang porno asal luar negeri yang meramaikan industri perfilman di Indonesia, belum lama ini. Kendati menuai protes dari kalangan ormas Islam, namun sejumlah produser film terus mengimpor bintang porno dari Jepang dan Amerika Serikat untuk membintangi film Indonesia. Anehnya, pemerintah terkesan tidak peduli terhadap masalah yang merusak moral bangsa ini.

Bubarkan LSF !

SETELAH Majelis Ulama Indonesia (MUI) menyatakan keluar dari Lembaga Sensor Film (LSF), kini giliran Front Pembela Islam (FPI) mengecam lemahnya kinerja lembaga tersebut. Organisasi massa itu menggelar unjukrasa di Gedung Film, karena menilai LSF ceroboh meloloskan dua film yakni ‘?’ (Tanda Tanya) dan 13 Cara Memanggil Setan sehingga bisa tayang di bioskop-bioskop tanah air. FPI sempat bertemu dengan pihak LSF guna menyampaikan protes terhadap penayangan film tersebut. “Mereka menanggapinya dan mulai bulan depan akan lebih memperbaiki diri, tidak akan membolehkan film yang berbau porno. Kalau hantu, ya hantu saja,” ujar Ketua FPI DKI Jakarta, Habib Salim Selon, di Ge-

dung Film, Pancoran, Jakarta, Jumat (15/4). FPI dengan tegas menyatakan LSF telah lalai dan dinilai tidak bisa menyensor film yang merusak akidah dan moral umat. “Kalau LSF tidak bisa lagi menyensor film yang merusak akidah dan moral umat, ya bubarkan saja LSF,” tegas Habib Selon. Menurut Habib Selon, FPI tidak hanya mengecam film Tanda Tanya dan 13 Cara Memanggil Setan saja, tapi semua film-film yang berakibat kepada rusaknya moral anak bangsa. Menindaklanjuti dua film yang baru saja tayang selama sepekan ini, FPI mengancam akan melakukan sweeping ke

bioskop-bioskop. Hal itu dilakukan jika dalam tempo satu bulan ini, tidak ada upaya menarik film tersebut dari peredaran. “Ya pokoknya kami akan melakukan sweeping terhadap film Tanda Tanya dan 13 Cara Memanggil Setan, jika pemerintah tidak bisa menarik film tersebut dalam satu bulan ini,” tegasnya. Haram Polemik terkait film Tanda Tanya karya Hanung Bramantyo masih terus berlanjut. Dalam pernyataan sikap yang dimuat di situs FPI, Ketua Umum FPI Habib Muhammad Rizieq Syihab menegaskan, film tersebut tidak layak ditonton umat Islam. FPI menilai film itu sesat dan haram karena memuat pesan liberal dalam jalan ceritanya. Berdasarkan kajiannya, menurut Habib Rizieq, film tersebut telah melakukan kam-

panye dan propaganda dari setiap tokoh yang dibintanginya, yakni Surya, Menuk dan Rika. Dari ketiga tokoh itulah, FPI menilai bahwa ada pesan yang terselubung yang hendak disampaikan Hanung dan bertentangan dengan syariat Islam. Misalnya, seorang Muslim bekerja di restoran penjual babi bukanlah hal yang haram atau ketika seseorang murtad dari Islam merupakan hal yang biasa. Berdasarkan pertimbangan-pertimbangan itulah, FPI menilai film karya Hanung ini adalah film sesat dan menyesatkan. Dalam pernyataan sikapnya, FPI juga menyesalkan sikap teledor Lembaga Sensor Film (LSF) yang telah melakukan kesalahan fatal dengan meloloskan film tersebut. Paham Syirik Modern Sebelumnya, Majelis Ulama Indonesia (MUI) bersikeras

mengharamkan film Tanda Tanya karena dianggap keluar dari akidah Islam. Menurut MUI, film garapan Hanung Bramantyo itu haram karena menyebarkan paham syirik modern. “MUI secara tegas mengharamkan liberalisme, sekularisme dan pluralisme agama. Tapi di film ini malah mengagungagungkan pluralisme. Itu sama saja menyekutukan Allah. Kalau di zaman nabi, yang disebut syirik itu karena Tuhannya berbeda. Tapi kalau pluralisme, semua agama, semua Tuhan itu sama. Jadi, film ini sama saja dengan menyebarkan paham syirik modern,” tuding Ketua MUI Pusat Bidang Budaya KH A Cholil Ridwan di Jakarta. Kendati demikian, Cholil Ridwan tidak mau memaksakan kehendak. Sebab, Islam tidak pernah memaksakan kehendak. “Kalau dari segi Islam,

itu bertentangan dengan akidah Islam. Tapi itu sebenarnya hak mereka. Karena Islam tidak pernah memaksakan,” tegasnya. Tema pluralisme yang dikedepankan film garapan suami Zaskia Adya Mecca itu dianggap sangat bertentangan dengan fatwa haram MUI tentang pluralisme. “Yang diharamkan adalah paham pluralisme agama. Bahkan menganut paham itu haram. Bisa disebut murtad atau keluar dari agama. Dan di dalam film Tanda Tanya, paham itu yang dipropagandakan. MUI sudah menfatwakan pluralisme itu haram, maka mereka jelas mengedarkan sesuatu yang haram,” urainya. Kesimpulan haram didapatkan Cholil Ridwan setelah menyaksikan langsung film yang diperankan Revalina S Temat, Reza Rahardian dan Agus Kuncoro tersebut.(k/ok)

ruman

Aline Adita

Horor Seks Hanya Jual Adegan Vulgar PERKEMBANGAN industri perfilman di Indonesia dewasa ini semakin pesat. Sayangnya, film-film yang mendominasi bergenre horor komedi dibalut adegan vulgar. Bahkan, untuk mendongkrak jumlah penonton, sang produser mendatangkan bintang porno dari luar negeri. Melihat kenyataan itu, model dan pemain film Aline Adita menjadi miris. Dia menilai, film Indonesia yang semula bergenre horor komedi, telah berganti menjadi horor seks. Akibatnya, film yang hanya menjual adegan vulgar itu memiliki kualitas sangat buruk. Bahkan, Aline dengan tegas menyatakan ketidaksukaannya terhadap film Indonesia yang bergenre horor seks. Film-film seperti ini hanya mengandalkan adegan vulgar yang menantang, bukan mengandalkan alur cerita dan kemampuan akting para pemerannya. “Aku nggak suka aja. Apalagi di sini penggarapannya, imagenya dan eksekusinya nggak bagus. Karena eksploitasi banget dan terlalu vulgar,” ujar Aline Adita di Jakarta Selatan, Kamis (14/4). Perempuan bernama lengkap Caroline Ingrid Adita ini melihat image film-film horor Indonesia sudah sangat negatif di mata penontonnya. Hal itu membuat Aline akan menolak bermain di film bergenre horor seks. Saat ini, Aline mengaku sedang sibuk membintangi film yang mendidik. “Genre-nya film edukasi anak-anak. Karena merasa pas sama diri aku, apalagi genre-nya juga cocok, bukan yang horor,” ujar Aline.(inc)

Izin Konser Justin Bieber Dipertanyakan KONSER musik penyanyi asal Kanada Justin Bieber, yang dijadwalkan berlangsung di Sentul International Convention Center (SICC), Kecamatan Babakan Madang, Kabupaten Bogor (Jawa Barat), Sabtu (23/ 4), belum mengantungi izin penyelenggaraan dari kepolisian Bogor. Kapolres Bogor AKBP Herry Santoso mengatakan, sampai saat ini penyelenggaranya belum mengajukan permintaan izin tersebut. Jika sampai batas

waktu yang ditentukan belum juga mengajukan permintaan izin, maka pihak kepolisian bisa membatalkan konser itu. “Kami harapkan panitia penyelenggara segera mengurus dan melengkapi perizinannya serta paparan rangkaian kegiatan konser kepada aparat, agar Polri bisa mempersiapkan pengamanan lokasi dan jalur yang akan digunakan,” ujar Herry ketika dikonfirmasi oleh wartawan, Jumat (15/4). Menurut Herry, penyeleng-

Justin Bieber

gara konser Bieber harus mengajukan permintaan izin karena menyangkut jumlah personel yang akan disiapkan untuk mengamankan pertunjukan tersebut. Untuk konser artis asing, idealnya pihak penyelenggara harus sudah berkoordinasi dengan aparat keamanan tiga minggu sebelum pelaksanaannya. “Tapi, sampai seminggu sebelum kegiatan, mereka belum juga menyampaikan izin dan paparan tentang konser itu

kepada polisi,” ujarnya. Sementara itu, Camat Babakan Madang, Zaenal Safrudin mengatakan, pihak penyelenggara konser Bieber sudah berkoordinasi dengan pihak kecamatan dan Polsek Babakan Madang. Namun pihak penyelenggara belum memaparkan konsep keamanan konser tersebut. “Terutama konsep di luar gedung. Sampai saat ini, kami baru mendapat gambaran di dalam gedung. Padahal, yang urgent adalah di luar gedung,”

ucapnya. Zaenal telah memberi batas waktu kepada penyelenggara konser Bieber. “Jika sampai batas waktu yang ditentukan pihak panitia belum memaparkan konsep keamanan, kami akan mengusulkan ke Kapolri untuk membatalkan konser tersebut,” tegasnya. Sedangkan Kapolsek Babakan Madang AKP Lugito mengatakan, pihaknya belum memberi rekomendasi izin konser Justin Bieber.(k/vvn/kl)

Indri: Norman Pasti Setia

glamour

J-Lo, Wanita Tercantik PENYANYI dan aktris Jennifer Lopez (J-Lo) baru saja dinobatkan sebagai Wanita Tercantik Sejagad 2011 oleh Majalah People. JLo (foto) mengungguli Zac Efron yang berada di urutan kedua dan Reese Witherspoon di peringkat ketiga. Juri American Idol ini menduduki peringkat teratas dalam kategori tersebut di Majalah People, yang terbit spesial kali ini. Selain itu, Halle Berry, Jennifer Garner dan Beyonce Knowles, ikut meramaikan daftar wanita tercantik sejagad versi majalah tersebut. “Saya merasa senang dan bangga. Sebab, saya tidak berumur 25 tahun lagi,” ujar istri penyanyi latin Marc Anthony ini. Pada kesempatan itu, J-Lo berbagi tips kecantikan. Menurutnya, memperlihatkan penampilan yang bagus merupakan bagian dari kehidupannya di depan publik.(k/tnr/m25)

HAMPIR dua pekan wajah Briptu Norman Kamaru terus menghiasi layar kaca TV nasional. Anggota Korps Brimob Polda Gorontalo itu telah meraih popularitas dan menjadi idola baru, bahkan menambah pundi-pundi keuangannya. Kendati demikian, lelaki yang biasa disapa Oman ini tetap rendah hati, bersahaja dan setia pada sang kekasih Indriyani Hamani yang sudah dipacarinya selama tiga tahun. “Meski banyak fans gadis cantik, saya yakin Oman pasti setia,” ungkap gadis asal kotamobagu ini. Lulusan S1 Manajemen Universitas Gorontalo (UG) ini, juga menceritakan selama berpacaran dengan Oman tidak pernah terjadi pertengkaran, bahkan Indri sudah diperkenalkan kepada orangtua Oman. “Seminggu sekali atau kalau ada waktu senggang, saya sering diajak Oman ke rumahnya di Padebuolo. Orangtua dan keluarga Oman juga menyetujui hubungan kita,” tuturnya. Meski sudah hampir dua pekan tidak bertemu dengan Oman, namun Indri selalu berhubungan lewat telefon. Keyakinan Indri akan cinta Norman kepadanya, tatkala diwawancara salah satu TV swasta nasional. Saat itu, Norman mengakui bahwa Indri adalah kekasihnya dan menitip salam.”Indri jangan pikir macam-macam, I Love U,” ujarnya meniruucapan Norman di televisi beberapa waktu lalu.

VCD Norman Sementara itu, penjualan video compact disc (VCD) lagu “Chaiya-Chaiya” yang dilantunkan Briptu Norman Kamaru laris di sejumlah lapak Pasar Sentral, Kota Gorontalo. Di pusat pertokoan tersebut, sebagian besar penjual VCD sengaja menayangkan adegan kocak Briptu Norman yang melantunkan lagu India itu secara lip synchronization (lip sync). Harun, seorang pedagang VCD mengatakan, ketenaran Briptu Norman ternyata membawa berkah tersendiri bagi para pedagang VCD di daerah tersebut. Dia mengaku omzet penjualan VCDnya mengalami peningkatan signifikan selama beberapa hari terakhir. “Saya tentu senang, hitung-hitung bisa menambah penghasilan usaha sehingga turut berterima kasih juga untuk Norman,” kata Harun. Menurut Harun, banyak warga Gorontalo penasaran dan tertarik melihat adegan Norman yang meniru gaya Shak Rukh Khan itu. Ditambah lagi dengan ketenarannya dalam pemberitaan di sejumlah media massa. Dia mengungkapkan, rasa penasaran masyarakat atas aksi Norman tersebut membuatnya harus menambah stok kepingan VCD setiap harinya. Untuk satu keping VCD rekaman Norman dijual seharga Rp 10.000. Dengan demikian, lanjut Harun, dalam sehariVCD berlabel Goyang India Briptu Norman bisa terjual hingga 25 keping. “Alhamdulillah ini berkah bagi kami, sehari bisa terjual sampai 25 keping,” ujarnya.

blog

Norman dan Indri Sementara itu, di salah satu pasar malam kawasan Slipi, Jakarta Barat, VCD rekaman Norman dijual seharga Rp4.000. Di sampul depan terpampang wajah Norman tersenyum dengan pakaian dinas Brimob bersanding dengan penyanyipenyanyi India, Sharukh Khan dan Pretty Shinta. Lagu yang dinyanyikan Norman ditaruh pada urutan teratas daftar lagu sebelum Sharukh Khan. “Banyak yang suka, makanya kami jual. Harganya Rp 4.000,” ungkap pedagang di Slipi. Untuk menarik perhatian pembeli, penjual tersebut sengaja memutar video berdurasi 6 menit 30 detik milik Norman di layar televisi berukuran 16 inci dengan volume suara penuh. Beberapa orang yang melintas di jalan tersebut terlihat mampir untuk menonton aksi Norman. Mereka tak hentihentinya tertawa melihat aksi Norman. Ada pula yang sekadar melirik sepintas, sembari tersenyum melihat gaya Norman. “Lucu videonya, makanya saya beli. Enggak bosan-bosan lihatnya. Kok bisa ada polisi yang lucu kaya gitu,” ungkap Lena, seorang pembeli keping VCD itu.(top/k)


Waspada, Minggu 17 April 2011