Issuu on Google+

Harga Eceran Rp2.500,-

Korban Meninggal Jadi 16 Orang BERASTAGI (Waspada) : Doni Sembiring, 70, salah seorang korban awan panas erupsi Gunung Sinabung Kab. Karo yang mengalami luka bakar dan dirawat di RS Efarina Ethaham meninggal dunia Rabu (5/2) pukul 02:50. Dirut RS. Efarina Etaham, Dr Ana kepada Waspada mengatakan, korban mengalami luka bakar 46 persen disertai komplikasi penyakit sebelumnya, seperti paru-paru, gula, dan ginjal yang sudah rusak. Sehingga daya tahannya menurun. “Korban mninggal dunia pukul 02:50. Sementara Sehat Sembiring, 48, mengalami luka bakar 65 persen, masih Lanjut ke hal A2 kol. 7

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Legi, 6 Februari 2014/5 Rabiul Akhir 1435 H

No: 24483 Tahun Ke-68

Terbit 24 Halaman

Abu Sinabung Sampai Malaysia KUALALUMPUR, Malaysia (Antara/Xinhua-OANA): Lapisan tipis abu dari Gunung Sinabung, sampai di bagian baratdaya semenanjung Malaysia Rabu (5/2) pagi. Media setempat mengutip Direktur Prakiraan Cuaca Pusat Muhammad Helmi Abdullah, daerah yang terkena dampak itu mencakup pesisir Negeri Sembilan, Malaka, Muar, Batu Pahat, Pontian dan Kulaijaya di Johor. Dia mengatakan, tidak terlalu banyak abu dan menyebabkan sedikit kabut. ‘’Seorang penasehat tentang abu vulkanik telah dikirim ke industri penerbangan, ‘’ kata Helmi. Lanjut ke hal A2 kol. 6

Antara Antara

DAMPAK ERUPSI: Sebuah sepeda milik warga tertutup abu vulkanik di Desa Sigarang-Garang, Karo, Rabu (5/2).

ZONA BERBAHAYA: Warga menaiki truk usai mengecek rumah mereka di Desa Sigarang-Garang berjarak sekitar tiga kilometer dari Gunung Sinabung, Karo, Rabu (5/2), meskipun telah ada larangan bagi warga untuk memasuki zona bahaya.

Tiga Oknum TNI Diperiksa POM Presiden: Allah Sedang Menguji Umat Manusia JAKARTA (Antara): Presiden Susilo BambangYudhoyono (SBY) beserta Ibu Negara Hj. Ani Bambang Yudhoyono dan para menteri Kabinet Indonesia Bersatu (KIB) II menghadiri peringatan Maulid Nabi Muhammad SAW 1435 H dengan Tema “Dengan Maulid Nabi Kita Perkokoh Persatuan, Kesatuan dan Keutuhan NKRI” di Gedung “Kanzus Sholawat” Pekalongan,

Jawa Tengah, Rabu (5/2) siang. Dalam sambutannya, Presiden menyinggung mengenai terjadinya bencana di sejumlah daerah di tanah air. Presiden mengatakan, sebenarnya di seluruh dunia sedang terjadi bencana alam. Ia menyebutkan, banjir juga terjadi di Eropa, di Asia, di Amerika Latin, dan banyak lagi negara yang lain. Selain itu, kebakaran hutan

terjadi di Australia, badai salju terjadi di Amerika dan di Eropa. “Allah sedang menguji umat manusia, apakah kita pandai merawat alam kita, menjaga kelestarian alam kita. Karena kalau kita pandai dan arif menjaga alam kita tentu kita bisa mengurangi bencana yang ada,” tutur Presiden SBY. Lanjut ke hal A2 kol. 3

MEDAN ( Waspada): Pomdam 1/5 Medan memeriksa tiga oknum TNI diduga membeking judi dadu putar di pekuburan Jepang, Delitua, Kab.Deliserdang. Demikian disampaikan Pangdam I/BB Mayjen TNI Istu Hari S, usai mengahadiri apel konsolidasi gelar pasukan Ops Mantap Braja di Mapoldasu, Rabu (5/2). “Tiga anggota TNI diperiksa pasca penggerebekan kemarin, kalau memang terbukti membeking judi, mereka pasti diberi sanksi tegas,” kata Pangdam kepada wartawan. Ditegaskan Pangdam, pihaknya tidak akan mentolerir anggota yang membeking perjudian. “Oknum yang nakal, atau yang melanggar hukum pasti ditindak,” katanya lagi. Ke depan POM akan melakukan patroli. “Saya juga sudah berkoordinasi dengan Kapolda terkait masalah ini,” sebutnya. Lanjut ke hal A2 kol. 3

Istana Negara Kebanjiran, Ahok Akui Kecolongan JAKARTA (Waspada): Wakil Gubernur DKI Jakarta Basuki Tjahaja Purnama (Ahok) menuturkan pihaknya merasa kecolongan terkait banjir di Jl. Medan Merdeka Utara, tepatnya di depan Istana Negara, Rabu (5/2) pagi. Menurut Ahok, selama ini pembenahan yang dilakukan untuk mengatasi banjir hanya terfokus pada penanganan di

kali yang besar saja. Tetapi untuk saluran penghubung yang menyebabkan aliran air tersumbat di sekitar Istana Negara itu tidak dipikirkan. “Iya itu tadi makanya kita kecolongan. Karena hujan dan banjir itu selama ini yang kita pikirkan kalau habis hujan pasti lancar kan. Tetapi orang itu kan buang sampah juga. Nah kita tidak menghitung buang

sampahnya orang,” kata Ahok di Balai Kota Jakarta, Rabu. Disampaikan Ahok, salah satu solusi yang akan dilakukan, membentuk satuan tugas (satgas) yang mengawasi seluruh jalan di Jakarta supaya apabila ada genangan langsung ditangani. Kemudian dicari apa yang menjadi penyebabnya. Lanjut ke hal A2 kol. 3

KPK Selidiki Dugaan Korupsi Pengelolaan Dana Haji JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) membuka penyelidikan baru terkait adanya dugaan penyimpangan dalam pengelolaan dana haji di Kementerian Agama tahun anggaran 2012-2013. “Sudah penyelidikan,” kata Juru Bicara KPK, Johan Budi SP saat dikonfirmasi, Rabu (5/2). Terkait penyelidikan tersebut, KPK diketahui sudah memanggil saksi untuk diminta keterangan pada Senin lalu, yakni anggota DPR Komisi VIII DPR Hasrul Azwar yang membidangi agama. Johan mengatakan, KPK masih mengumpulkan bukti dan keterangan dengan memanggil sejumlah pihak sebagai saksi. Sebelumnya, Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK) mengaku mendapat laporan transaksi mencurigakan milik penyelenggara negara. Beberapa di antaranya masuk sektor pelayanan publik, termasuk dana pengelolaan ibadah haji. Lanjut ke hal A2 kol. 5 Waspada/Micky Maliki

IBUNDA Alm. Thomas S Milala memperlihatkan foto putranya saat menggandeng anak pengungsi bencana Sinabung jelang penaburan bunga di Desa Tiga Pancur, Kec. Simpang Empat, Kab. Karo, Rabu (5/2).

Penghormatan Terakhir Keluarga Thomas Milala Tabur Bunga 7 Km Dari Lokasi Evakuasi SIMPANG EMPAT, Tanah Karo (Waspada): Isak tangis ibu kandung Alm. Thomas S Milala bersama keluarga, Rabu (5/2) sekira pukul 09:00 WIB, mendatangi lokasi yang dianggap aman dari terjangan awan panas Desa Tiga Pancur berjarak 7km dari puncak Sina-

bung untuk tebar bunga sekaligus memberikan penghormatan terkahir kepada putranya. Ibunda Mulungi br Ginting, 60, didampingi Ester br Ginting (bibi almarhum) dan beberapa sanak keluarga serta rekannya yang mendatangi lokasi tersebut, mengaku kepergian anak mereka yang ketika itu sedang

Al Bayan

anggung Ja Tang gung J awa b

mendokumentasikan kondisi terkini Sinabung, sempat merasa ada yang ‘lain’. “Mak, aku minta uang kuliah terakhir ini saja. Aku janji tak lagi meminta uang kuliah lagi,” ucap Thomas kepada ibunda sebelum Lanjut ke hal A2 kol. 7

Tabrak Lembu, 2 Warga Komat Tewas PEMATANGSIANTAR (Waspada): Dua orang tewas setelah becak bermotor yang mereka tumpangi ditabrak mobil di jalan umum Km 14,5 Pematangsiantar- Medan, Desa Batu Silangit, Kec. Tapian Dolok, Kab. Simalungung, Selasa (4/2) malam. Peristiwa itu terjadi ketika betor tersebut menabrak seekor lembu betina hingga mati sehingga betor yang kemudikan korban oleng dan bertabrakan dengan mobil tersebut. Informasi Waspada himpun dari saksi mata, pengemudi betor Yamaha Vega R BK 5819 LC bernama Hendri, 45, membonceng korban Liza, 40. Keduanya pedagang roti, warga Jl. Rahmadsyah, Kel. Kota Matsum, Kec. Medan Area, Kota Medan. Betor tersebut membawa steling roti melaju dari arah Pematangsiantar menuju Medan. Namun, tiba di tempat kejadian, melintas seekor lembu dari kebun karet hendak menyeberang jalan. Hendri yang mengemudikan betor terkejut dan langsung menabrak lembu hingga lembu terlempar dan mati di tempat kejadian. Lanjut ke hal A2 kol. 3


TERSANGKA kasus penerimaan hadiah atau janji proyek Hambalang Anas Urbaningrum duduk di dalam mobil tahanan seusai menjalani pemeriksaan oleh penyidik KPK, Jakarta, Rabu (5/2).

Anas Paparkan Pelaksanaan Kongres Demokrat Ke KPK JAKARTA (Antara): Mantan Ketua Umum Partai Demokrat Anas Urbaningrum memaparkan pelaksanaan Kongres Partai Demokrat pada 2010 di Bandung kepada penyidik Komisi Pemberantasan Korupsi. “Anas baru cerita tentang kongres, bagaimana dia bisa menang. Tapi tidak lupa dia katakan SBY (Susilo Bambang Yudhoyono) bisa menang karena Anas juga, bukan Anas jadi

ketua umum saja. Anas juga membantu SBY menjadi ketua dewan pembina,” kata kuasa hukum Anas, Adnan Buyung Nasution di gedung KPK Jakarta, Rabu (5/2). Anas Rabu diperiksa sebagai tersangka dalam kasus dugaan penerimaan hadiah terkait pembangunan Pusat Pendidikan, Pelatihan dan Sekolah (P3SON) di Hambalang dan proyek-proyek lain. Proyek-

Perampok Ditawari Kopi SAAT melakukan aksi perampokan, pria ini malah disuguhi kopi oleh pegawai bank. Pasalnya, ia bukan merampok untuk mendapat uang, tapi agar ia bisa ditangkap dan masuk penjara. Insiden unik terjadi saat seorang pecandu narkoba mencoba merampok sebuah bank

Orang tua bertanggung jawab mewariskan agama kepada anaknya agar agama ini kuat dan jaya sampai akhir zaman. Bila agama sudah memudar, akidah juga menyimpang. Pada gilirannya nanti, generasi muda akan menjadi generasi yang lemah.(Hamka)

Lanjut ke hal A2 kol. 6 Waspada Daily


Lanjut ke hal A2 kol. 3

Ada-ada Saja

Aksi Demi Sinabung

Oleh Tgk H Ameer Hamzah

ALLAH Subhanahu Wa Ta’ala telah mewajibkan kepada setiap orang tua untuk mendidik anak-anak mereka supaya tetap dalam aqidah yang benar, tidak mensyarikatkan Allah dengan makhluk-Nya. Allah mengirim rasul-rasul-Nya untuk umat manusia sebagai pemurni akidah Tauhid dari zaman ke zaman sehingga berakhir dengan Nabi Muhammad SAW. Syeikh An-Najjar berkata: semua para Nabi beragama Islam dan semua mereka menunaikan ibadah haji.(Kitab: Tarikhun Nubuwwah) Seluruh rasul mengajak kepada akidah yang satu, yakni Aqidah Ketauhidan yang dapat menyelamatkan manusia

proyek lain yang dimaksud KPK menurut Adnan adalah mengenai kongres Demokrat. “Anas tahu banyak (mengenai kongres), biar dia bongkar semua yang terjadi dalam kongres itu, jadi kalau bicara soal kongres harus terbuka semua,” tambah Adnan. Ia pun mengaku bahwa kliennya sudah membuka


PLT Wali Kota Medan Dzulmi Eldin meninjau dapur umum posko pengungsian Sinabung, beberapa waktu lalu.

Eldin Dukung MEDAN (Waspada): Plt Wali Kota Medan H. Dzulmi Eldin mendukung aksi solidaritas yang digelar para relawan di bawah koordinator aktivis sosial kemasyarakat Dewi Budiati Teruna Jasa Said. Hal itu dikatakan Eldin saat menghadiri rapat koordinasi Sumut Berdoa di Aula Kodim 0201, Rabu (5/2). Menurut Eldin Lanjut ke hal A2 kol. 6

Dewi Persik

Dorce Gamalama

Erna Listy

Artis Ibukota Turut Partisipasi MEDAN (Waspada): Sejumlah artis ternama Ibu Kota, Jumat besok(7/2) akan menghibur pengungsi Sinabung di posko-posko pengungsian di Kabanjahe. Para artis tersebut antara lain Dewi Persik, Dorce Gamalama,Vinnie Luvita,Erna Tarigan, Erna Listy, dan artis cilik Armel Carla. Pada Kamis(6/2) malam, para artis tersebut akan tampil di Wisma Benteng Medan dalam

acara Aksi Solidaritas Kami Peduli yang digelar Ikatan Keluarga Wartawan Indonesia (IKWI) Sumut bekerja sama dengan Cahaya Ratu Mulia Jakarta. Koordinator acara Dewi Budiati Teruna Jasa Said yang juga ketua IKWI Sumut mengatakan, acara bertema Kami Peduli ini Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 2

Serampang - I love Dewi Persik - He...he...he...

Harga Eceran Rp2.500

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Legi, 6 Februari 2014/5 Rabiul Akhir 1435 H

No: 24483 * Tahun Ke-68 Terbit 24 Halaman


Plt Wali Kota Medan Dzulmi Eldin meninjau dapur umum salah satu posko pengungsian Sinabung, didampingi aktivis sosial kemasyarakatan Dewi Budiati Teruna Jasa Said, beberapa waktu lalu.

Eldin Dukung Aksi Solidaritas Bagi Sinabung Medan (waspada) Plt Wali Kota Medan H.Dzulmi Eldin mendukung aksi solidaritas yang di gelar para relawan di bawah koordinator aktivis sosial kemasyarakat Dewi Budiati Teruna Jasa Said. Hal itu dikatakan Eldinsaat menghadiri rapat koordinasi Sumut Berdoa di Aula Kodim 0201,Rabu(5/2). Menurut Eldin bentuk dukungan itu akan direalisasikan dengan menyumbangkan sejumlah barang-barang koleksi kesayangannya untuk dilelang oleh panitia pada malam pengumpulan dana besok malam (6/2) di Wisma Benteng, yang dimeriahkan artis-artis ibukota seperti Dewi Persik, Dolce Gamalam,Erna Tarigan,Erna Listy,Vinnie Lupita dan artis cilik Amel Carla. Sementara di tempat yang sama, Dewi Budiati yang turut sebagai peserta rapat,mengatakan aksi solidaritas ini adalah kolaborasi antara Ikatan Keluarga Wartawan Indonesia (IKWI) Sumut bekerja sama dengan teman-teman sesama relawan Lanjut ke hal A2 kol 1

Waspada/Micky Maliki

Besok, Artis Ibu Kota Aksi Solidaritas Untuk Sinabung MEDAN ( Waspada): Sejumlah artis ternama Ibu Kota, Jumat besok(7/2) akan menghibur pengungsi Sinabung di posko-posko pengungsian di Kabanjahe. Para artis tersebut antara lain Dewi Persik,Dorce Gamalama,Vinnie Luvita, Erna Tarigan,Erna Lislty, dan artis cilik Cilik Armel Carla. Pada Kamis(6/2) malam, para artis tersebut akan tampil di Wisma Benteng Medan dalam acara Aksi Solidaritas Kami Peduli yang digelar Ikatan Lanjut ke hal A2 kol 6

IBUNDA Alm Thomas S Milala memperlihatkan foto putranya saat menggandeng anak pengungsi bencana Sinabung jelang penaburan bunga di Desa Tiga Pancur, Kec Simpang Empat, Kab Karo, Rabu (5/2).

Penghormatan Terakhir Keluarga Thomas Milala Tabur Bunga 7 Km Dari Lokasi Evakuasi SIMPANG EMPAT, Tanah Karo (Waspada): Isak tangis ibu kandung Alm Thomas S Milala bersama keluarga, Rabu (5/ 2) sekira pukul 09.00 WIB, mendatangi lokasi yang dianggap aman dari terjangan awan panas Desa Tiga Pancur berjarak 7km dari puncak Sinabung untuk tebar bunga sekaligus memberikan penghormatan terkahir kepada putranya. Ibunda Mulungi br Ginting, 60, didampingi Ester br Ginting (bibi almarhum) dan beberapa sanak keluarga serta rekannya yang mendatangi lokasi tersebut, mengaku kepergian anak mereka yang ketika itu sedang mendokumentasikan kondisi terkini Sinabung, sempat merasa ada yang ‘lain’. “Mak, aku minta uang kuliah terakhir ini saja. Aku janji tak lagi meminta uang kuliah lagi,” ucap Thomas kepada ibunda

Dewi Persik

Vinnie Luvita

Dorce Gamalama

Lanjut ke hal A2 kol 6

Korban Jadi 16 Orang Abu Sinabung Sampai Malaysia

Pasca Penggerebekan Judi

Tiga Oknum TNI Diperiksa POM

BERASTAGI (Waspada) : Doni Sembiring, 70, salah seorang korban awan panas erupsi Gunung Sinabung Kab. Karo Sumatera Utara (Sumut) yang mengalami luka - luka dan dirawat di RS Efarina Ethaham meninggal dunia Rabu (5/2) pukul 02.50, pagi. Dirut RS. Efarina Etaham, Dr Ana kepada Waspada mengatakan, korban mengalami luka bakar 46 persen disertai komplikasi penyakit sebelumnya, seperti paru paru, gula, dan ginjal yang sudah rusak. Sehingga daya tahannya menurun. “Korban mninggal dunia pukul 02.50. Sementara Sehat

Sembiring, 48, mengalami luka bakar 65 persen, dan sampai sekarang dirawat secara intensif serta keadaan korban masih sehat,”ungkapnya. Dengan meninggalnya Doni, korban meninggal dunia menjadi 16 jiwa. Sementara itu, Badan Penanggulangan Lanjut ke hal A2 kol 6

Hujan Tahun Ini Deras Dimulai Februari JAKARTA (Antara): Badan Meteorologi, Klimatologi dan Geofisika (BMKG) mengatakan perbedaan musim hujan 2013 dengan tahun ini, terletak pada curah, intensitas, dan penyebarannya. “Dari curah hujan lebih besar tahun lalu yakni mencapai 194—200 milimeter, sangat deras, namun intensitasnya tidak begitu sering, serta penyebarannya tidak merata,” kata Kepala Bidang Informasi Meteorologi Publik BMKG Kukuh Ribudiyanto di Jakarta, Rabu (5/2).

Kukuh mengatakan musim hujan tahun ini cenderung statis di level 50—100 milimeter (cukup deras), namun intensitasnya jauh lebih sering dan tersebar merata, khususnya di Ibukota DKI Jakarta dan sekitarnya. “Akibatnya dampak terhadap lingkungan tentu berbeda dengan tahun lalu,” ujar Kukuh. Kukuh mengatakan hujan yang terjadi terus menerus sejak akhir 2013 hingga awal tahun ini merupakan hal yang Lanjut ke hal A2 kol 6

PT KAI Pertimbangkan Buka Kembali Stasiun Perbaungan MEDAN (Waspada): Manajemen PT Kereta Api Indonesia (KAI) Divre I Sumut/ Aceh berpeluang membuka kembali stasiun Kereta Api (KA) di Perbaungan, Serdang Bedagai setelah ditutup, Selasa (4/2) malam, akibat peristiwa yang dapat mengancam keselamatan petugas KA di sana. Kesimpulan itu diputuskan setelah pertemuan rapat koordinasi Satuan Kerja Perangkat Daerah (SKPD) Sergai dengan pejabat manajemen PT KAI di kantor PT KAI Medan Jl. HM. Yamin Medan, yang membahas masalah Ikatan

MEDAN (Waspada): Pomdam 1/5 Medan memeriksa tiga oknum TNI diduga membeking judi dadu putar di pekuburan Jepang, Delitua, Kab. Deliserdang. Demikian disampaikan Pangdam I/BB Mayjen TNI Istu Hari S, usai mengahadiri apel konsolidasi gelar pasukan Ops Mantap Braja di Mapoldasu, Rabu (5/2). “Tiga anggota TNI diperiksa pasca penggerebekan kemarin, kalau memang ter-

Penjual Asongan (IPA), Rabu (5/2). Rapino Situmorang, manajer Humas PT KAI Divre I Sumut/Aceh membenarkan hal itu, setelah mengadakan pertemuan lebih kurang 3 jam di ruang Dolok Martimbang, turut dihadiri Wakil Bupati Sergei Syahriono, Wakadivre I Sumut/Aceh Sarijal,Waka Polres Sergai dan pejabat lainnya. Menurut Situmorang, stasiun KA Perbaungan ditutup terkait ancaman keselamatan Lanjut ke hal A2 kol 1

Al Bayan

Tanggung Jawab

Hasibuan.Waspada/Dede Basri Hasibuan

EVAKUASI TERNAK: Warga Desa Sibintun Kec. Simpang Empat, mengevakuasi ternaknya dengan mengunakan mobil terbuka saat menjelang erupsi Gunungapi Sinabung Kec. Namanteran Kab. Karo Sumatera Utara pada Rabu (5/2).

Waspada/Dede Basri Hasibuan

Bencana Alam Di Seluruh Dunia

SBY: Allah Sedang Menguji Umat Manusia Dalam sambutannya, Presiden menyinggung mengenai terjadinya bencana di sejumlah daerah di tanah air. Presiden mengatakan, sebenarnya di seluruh dunia sedang terjadi bencana alam. Ia menyebutkan, banjir juga terjadi di Eropa, di Asia, di Amerika Latin, dan banyak lagi negara yang lain. Selain itu, kebakaran hutan terjadi di Australia, badai salju terjadi di Amerika dan di Eropa. “Allah sedang menguji

ALLAH Subhanahu Wa Ta’ala telah mewajibkan kepada setiap orang tua untuk mendidik anak-anak mereka supaya tetap dalam aqidah yang benar, tidak mensyarikatkan Allah dengan makhluk-Nya. Allah mengirim rasul-rasul-Nya untuk umat manusia sebagai pemurni akidah Tauhid dari zaman ke zaman sehingga berakhir dengan Nabi Muhammad SAW. Syeikh An-Najjar berkata: semua para Nabi beragama Islam dan semua Lanjut ke hal A2 kol 2 Antara


umat manusia, apakah kita pandai merawat alam kita, menjaga kelestarian alam kita. Karena kalau kita pandai dan arif menjaga alam kita tentu kita bisa mengurangi bencana yang ada,” tutur Presiden SBY. Untuk itu, Presiden mengajak seluruh lapisan masyarakat untuk bergandengan tangan dalam mengatasi bencana alam yang melanda bangsa Indonesia. “Marilah kita bergandengan tangan untuk mengatasi masalah ini,

di Sumatera Utara masih ada bencana letusan Gunung Sinabung, di Jambi, Bengkulu, Jakarta, Jawa Barat, Jawa Tengah, Jawa Timur banjir, demikian juga di Sulawesi, Maluku semua sedang mengatasi masalah ini, Pemerintah Pusat tentu memberikan bantuan sepenuhnya, namun itu semua diperlukan kebersamaan di antara kita,” kata Presiden. Lanjut ke hal A2 kol 1

TERSANGKA kasus penerimaan hadiah atau janji proyek Hambalang Anas Urbaningrum duduk di dalam mobil tahanan seusai menjalani pemeriksaan oleh penyidik KPK, Jakarta, Rabu (5/2).

Bahkan sebelumnya, tersiar kabar bahwa Ruslan Abdul Gani, sempat dipukul oleh Misriadi, namun setelah dicek kebenaran kabar tersebut, ternyata informasi tentang pemukulan itu, tidak benar. Hanya kalimat makian serta ancaman yang sempat keluar dari mulut Misriadi. Paska insiden itu, Bupati Bener Meriah, melalui Kabag Hukum Pemkab Bener Meriah, langsung membuat Lanjut ke hal A2 kol 3

Tabrak Lembu, 2 Tewas P E M ATA N G S I A N TA R (Waspada): Pengemudi dan penumpang becak bermotor tewas ditubruk mobil di jalan umum km 14,5 jurusan Pematangsiantar- Medan, Desa Batu Silangit, Kec. Tapian Dolok, Kab. Simalungung, Selasa (4/2) pukul 20.30. Sebelumnya, korban menubruk seekor lembu betina hingga mati. Sedangkan betor yang kemudikan korban oleng hingga naas bertubrukan dengan mobil tersebut. Informasi yang dihimpun dari saksi mata, pengemudi betor Yamaha Vega R BK 5819 LC bernama Hendri, 45, membonceng korban Liza, 40. Keduanya pedagang roti, warga

Jalan Rahmadsyah, Kelurahan Kota Matsum, Kecamatan Medan Area, Kota Medan. Betor tersebut membawa steleng roti melaju dari arah Pematangsiantar menuju arah Medan. Ketika tiba di tempat kejadian, tiba-tiba melintas seekor lembu yang keluar dari kebun karet hendak menyeberang jalan. Hendri yang mengemudikan betor tidak menduga munculnya lembu itu, hingga tidak sempat menghentikan betor yang dikemudikannya dan langsung menabrak lembu hingga lembu terlempar dan mati di tempat kejadian. Lanjut ke hal A2 kol 1

Ada-ada Saja

Anas Paparkan Pelaksanaan Kongres Demokrat Ke KPK

Orang tua bertanggung jawab mewariskan agama kepada anaknya agar agama ini kuat dan jaya sampai akhir zaman. Bila agama sudah memudar, akidah juga menyimpang. Pada gilirannya nanti, generasi muda akan menjadi generasi yang lemah.(Hamka)

Waspada Daily

Dimaki Oknum Anggota Dewan REDELONG (Waspada): Bupati Bener Meriah Ruslan Abdul Gani melaporkan salah seorang anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) setempat, Misriadi MS alias Adijan ke pihak kepolisian. Laporan tersebut, merupakan buntut dari aksi penghinaan serta pengancaman yang dilontarkan Misriadi kepada Bupati Bener Meriah yang terjadi pada Rabu (5/2) sekira pukul 09:00 di ruang kerja bupati.

Oleh: H. Ameer Hamzah

Lanjut ke hal A2 kol 2

Bupati Bener Meriah Melapor Ke Polisi

EVAKUASI GAGAL: Tim SAR gabungan tidak jadi melakukan evakuasi, disebabkan erupsi masih terjadi di gunung Sinabung dan larangan dari PVMBG. Seperti terekam kamera saat di simpang Desa Guru Kinayan, Kec. Payung Kab. Karo Sumaterfa Utara, Rabu (5/2).

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY) beserta Ibu Negara Hj. Ani Bambang Yudhoyono dan para menteri Kabinet Indonesia Bersatu (KIB) II menghadiri peringatan Maulid Nabi Muhammad SAW 1435 H dengan Tema “ Dengan Maulid Nabi Kita Perkokoh Persatuan, Kesatuan dan Keutuhan NKRI” di Gedung “Kanzus Sholawat” Pekalongan, Jawa Tengah, Rabu (5/2) siang.

bukti membeking judi, mereka pasti diberi sanksi tegas,” kata Pangdam kepada wartawan. Ditegaskan Pangdam, pihaknya tidak akan mentolerir anggota yang membeking perjudian. “Oknum yang nakal, atau yang melanggar hukum pasti ditindak,” katanya lagi. Ke depan POM akan melakukan patroli. “Saya juga sudah berkoordinasi dengan

Perampok Ditawari Kopi

J A K A RTA ( A n t a ra ) : Ma n t a n Ke t u a Um u m Partai Demokrat Anas Urbaningrum memaparkan pelaksanaan Kongres Partai Demokrat pada 2010 di Bandung kepada penyidik Komisi Pemberantasan Korupsi. “Anas baru cerita tentang kongres, bagaimana dia bisa menang. tapi tidak lupa dia katakan SBY (Susilo Bambang Yudhoyono) bisa menang karena Anas juga, bukan Anas jadi ketua umum saja. Anas juga membantu SBY menjadi ketua dewan pembina,” kata kuasa hukum Anas, Adnan Buyung Nasution di

KABANJAHE (Waspada): Satu mobil Fortuner BK 411 II terjun bebas ke dalam jurang di Jl. Letjen Djamin Ginting’s Km 56 Medan- Berastagi, tepatnya di kawasan

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 6

Waspada/Basita Bukit

MOBIL Fortuner terjun ke jurang di Km 56 MedanBerastagi mengakibatkan sopir dan dua penumpangnya mengalami luka-luka.

Fortuner Terjun Ke Jurang, 3 Luka-luka

SAAT melakukan aksi perampokan, pria ini malah disuguhi kopi oleh pegawai bank. Pasalnya, ia bukan merampok untuk mendapat uang, tapi agar ia bisa ditangkap dan masuk penjara. Insiden unik terjadi saat Lanjut ke hal A2 kol 5

Serampang - Tarek Mang .... - He.... he....he....

Berita Utama

A2 SBY: Allah .... Presiden berharap kita bisa mengatasi bencana ini, dan kemudian kita melanjutkan pembangunan di berbagai bidang untuk hari esok yang lebih baik. Sumpah Habib Muhammad Lutfi Pada kesempatan peringatan Maulid Nabi Muhammad SAW itu, ulama kenamaan Habib Muhammad Lutfi bin Yahya mengajak para santri dan warga Pekolangan yang hadir untuk menegakkan Negara Kesatuan Republik Indonesia (NKRI), dan bersatu membangun bangsa. Habib mengajak para hadirin bersumpah untuk sepakat mempertahankan NKRI. “Demi Allah, saya bangsa Indonesia bersumpah akan mempertahankan Negara

PT KAI .... petugas KA di sana. “Kalau kondisi keamanan menjamin, tidak tertutup kemungkinan stasiun dibuka kembali,” kata dia. Sementara pejabat Sergai dalam pertemuan tersebut segera mengirim surat resmi, memohon ke manajemen PT KAI Divre I KA Sumut/Aceh, agar stasiun Perbaungan dibuka kembali dan dapat menjual tiket kepada penumpang. Wabup dan SKPD yang hadir juga meminta agar

Eldin Dukung .... dari Cahaya Ratu Media, yang mendatangkan sejumlah artis Ibu Kota tanpa dipungut bayaran. Kedatangan para artis difasilitasi oleh Cahaya Ratu Media untuk menggalang sikap kepedulian mereka terhadap saudara-saudara kita yang tengah dilanda bencana.

Tabrak Lembu .... Akibat menabrak lembu, betor yang dikemudikan Hendri menjadi tidak terkendali dan oleng serta meluncur ke sebelah kanan jurusannya. Pada saat bersamaan, meluncur dengan kecepatan tinggi dari arah berlawanan satu unit mobil Toyota Rush BK 1347 QH yang dikemudikan Abu Bakar, 61, pensiunan PNS, warga Jalan Padangsidempuan, komplek PU, Kelurahan Sarudik, Kota Sibolga dengan membawa penumpang S. Simbolon, 65, warga sama dengan Abu Bakar. Mobil dikemudikan Abu Bakar langsung menabrak betor hingga pengemudi dan penumpang betor terlempar ke kanan dan kiri jalan, sedang betor bersama steleng sempat terseret mobil yang melaju ke arah kanan jurusannya dan akhirnya masuk ke dalam parit di pinggir jalan. Hendri dan Liza tewas di tempat kejadian akibat ditabrak mobil dan terhempas ke badan jalan, sedang Abu Bakar tidak mengalami luka dan hanya penumpangnya S. Simbolon mengalami luka ringan. Warga sekitar yang mendengar suara tebrakan itu

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mxh5 (target Mh8+), Md4+. 2. GxM, Kg6. 3. MxKg6+, Gg7. 4. MxG+mat. (Jika 1. ...., BxGc3. 2. Gxf7+, Rg7. 3. f6+mat). Jawaban TTS: TTS


Kesatuan Republik Indonesia dan akan menepis segala sesuatu yang akan menggoyahkan kekuatan NKRI,” kata Habib Muhammad Lutfi yang diikuti. Dia juga mengajak seluruh santri dan warga Pekalongan untuk menghantarkan Presiden sampai akhir masa tugasnya. Ajakan ini langsung disambut dengan teriakan para hadirin, “ Setujuuu”. Menanggapi hal itu, Presiden mengatakan, bangsa Indonesia adalah bangsa yang besar, tanah airnya luas, sejarah dan peradabannya tinggi. Bangsa Indonesia juga memiliki potensi yang juga besar, tahun-tahun terakhir dunia mengakui kemajuan kita. Oleh karena itu, Presiden mengajak semua pihak untuk mewujudkan cita-cita para pendiri

Republik Indonesia, suatu saat di abad 21 ini benar-benar bisa menjadi bangsa yang maju, adil, dan makmur. “Kalau bangsa lain bisa, bangsa Indonesia harus bisa. Kalau bangsa lain bisa maju, Indonesia bisa maju. Kalau bangsa lain bersatu membangun negerinya dan sukses, Indonesia juga bisa bersatu membangun negeri kita dan insya Allah sukses,” kata Presiden pada acara yang juga dihadir i Menter i Agama Suryadharma Ali, Mensesneg Sudi Silalahi, Sekretar is Kabinet Dipo Alam, Menteri Sosial Salim Sagaf Al Jufri, Menteri Pembangunan Daerah Tertinggal Hilmi Faishal, Panglima TNI Jenderal Moeldoko, Kapolri Jenderal Sutarman, dan Gubernur Jawa Tengah Ganjar Pranowo.

Aquino Samakan China Dengan Hitler

membantu koperasi Ikatan Pedagang Asongan agar bisa mengelola restorasi di dalam k e re t a a p i . Me re k a j u g a meminta lahan-lahan KA di luar stasiun Perbaungan dapat dimanfaatkan untuk membuka kuliner atau dagangan lainnya dengan cara menyewa, sehingga mereka tidak menjadi pekerja asongan lagi. Namun, dalam pertemuan tersebut suasana sempat memanas saat Kolonel Marwan M, selaku manajer senior keamanan PT KAI Divre I Sumut/Aceh

kepada jajaran SKPD Sergai dan utusan IPA menyatakan, tidak bakal menjual tiket di stasiun Perbaungan dan KA tidak akan berhenti di sana. Salah satu alasan, di samping manajemen KA terus merugi, penumpang cukup minim, dan perjalanan KA ke stasiun lain terlambat. Menurut Rapino Dirjen Kereta Api telah menyarankan agar menutup sejumlah stasiun yang merugi, seperti Perbaungan, stasiun arah Belawan, stasiun Pusat Pasar Jl. Thamrin dan stasiun arah ke Binjai. Namun, Wakil Bupati Sergai minta pejabat PT KAI mempertimbangkan hal itu

dengan memberdayakan kembali IPA Sergai sesuai perjanjian awal 2012.Setidaknya setahun ini para asongan harus bekerja sambil mempersiapkan usaha lainnya. Bahkan Kadis Perdagangan/Pasar Sergei menyatakan, para asongan sudah bertahun-tahun menjajakan makanan di kereta api untuk menghidupi keluarga mereka, SDM mereka juga terbatas sehingga perlu dukungan. Sementara itu Sarbaini, utusan IPA menyatakan, masalah yang timbul kemarin akibat kurang koordinasi antara manajemen PT KAI dengan jajaran IPA. (m32)

Dimaki Oknum .... pengaduan kepada pihak kepolisian setempat. Kapolres Bener Meriah, AKBP Cahyo Hutomo yang dihubungi wartawan, Rabu (5/2) melalui telepon membenarkan bahwa pihaknya telah menerima laporan dari Bupati Bener Meriah, soal penghinaan serta ancaman yang dilontarkan oleh salah seorang anggota DPRK kepada Bupati Ruslan Abdul Gani. “Untuk sementara laporan yang dibuat oleh korban terkait dengan penghinaan serta pengancaman. Namun untuk pembuktiannya kita lihat hasil pemeriksaan nanti,” kata Cahyo Hutomo. Disampaikan Kapolres, berdasarkan laporan yang ia terima, kronologis kejadian penghinaan serta pengancaman itu, terjadi ketika Bupati Bener Meriah Ruslan Abdul Gani beserta sejumlah pejabat di lingkungan pemkab setempat, sedang melakukan rapat rutin di ruang bupati. Namun tiba-tiba muncul Misriadi ke dalam ruang bupati sembari mengeluarkan makian bernada ancaman terhadap bupati. “Setelah diketahui ada kejadian itu, kami langsung mengerahkan sejumlah anggota untuk mengamankan serta mengendalikan situasi agar tidak me-

luas dan melebar,” paparnya. Menurut Kapolres, insiden penghinaan serta pengancaman yang dilakukan oleh anggota dewan terhadap bupati, diduga didasari oleh persoalan sengketa tanah milik Misriadi di kawasan Pante Raya, Kecamatan Wih Pesam. “Motif dari aksi penghinaan dan pengancaman ini, didasari dari persoalan tanah. Namun untuk mengetahui lebih lanjut, sedang dilakukan penyelidikan oleh pihak kepolisian,” tutur Cahyo. Berdasarkan keterangan sejumlah saksi mata, sesaat sebelum kejadian itu berlangsung, Misriadi, yang mendatangi ruang bupati sempat diminta bersabar oleh ajudan maupun petugas yang berada di depan ruang bupati, dengan alasan Ruslan Abdul Gani sedang rapat. Namun, Misriadi tetap menerobos masuk ke ruang bupati sembari melemparkan sejumlah kalimat makian. Sontak sejumlah petugas maupun para pejabat yang sedang rapat berusaha mengamankan Misriadi. Berdasarkan informasi, pada masa kepemimpinan Bupati Tagore Abubakar/Sirwandi Lut Tawar, mengeluarkan SK bahwa tanah seluas tiga hektare diserahkan kegunaannya untuk Legion Veteran Bener Meriah. Namun

dituntaskan. Begitu juga kalau ada anggota saya yang menjadi beking judi, akan ditindak tegas,” kata Kapolda. Intinya, sebut dia, bagaimana personel TNI-Polri membantu masyarakat menghapus perjudian. Kapolda berharap agar peristiwa tersebut jangan sampai menjadi preseden buruk, sebab akan berdampak pada kegiatan masyarakat. “Apalagi kita juga sedang menghadapi tugas tahap pengamanan Pemilu,” sebutnya. Sebelumnya, Selasa (4/2) sore, puluhan petugas Poldasu bersama Brimob menggerebek judi dadu putar beromset puluhan juta di pekuburan Jepang Jl. Ardagusema, Delitua. Dalam penyergapan yang berlangsug ricuh tersebut , petugas sempat meletuskan tembakan beberapa kali dan mengamankan puluhan orang dari lokasi. Namun hanya tiga orang yang dibawa ke Mapoldasu, sedangka lainnya terdata sebagai oknum aparat sehingga

dikembalikan ke kesatuan. “Semula ada sekitar 30 orang diamankan dari lokasi, tetapi ada beberapa oknum yang tertangkap, Provos yang bersangkutan datang. Setelah negosiasi, oknum yang diamankan diserahkan ke Provos,” ujar Kasubdit II Dit Reskrimum Poldasu AKBP Yusup Saprudin yang memimpin penggerebekan. Setelah penggerebekan itu, situasi di Mapoldasu juga mencekam. Lampu-lampu dimatikan, dan puluhan anggota Brimob siaga karena menerima informasi sejumlah oknum akan melakukan penyerangan. Ini disebabkan terjadinya bentrok susulan antara personil Brimob dan oknum di persimpangan jalan tol Amplas, usai penangkapan. Sementara dalam peristiwa itu, seorang anggota Brimob mengalami luka di kepala karena lemparan batu dan masih dirawat di RSU Bhayangkara.(m27)

kian pula cucunya Ya’kub: Wahai anak-anakku, sungguh Allah telah memilih agama ini ( Is l a m ) u n t u k m u , m a k a janganlah kamu mati kecuali dalam Islam (QS:2:131). Semua anak Ibrahim menjawab: Kami menyembah Allah SWT dan tidak akan mensyarikatkannya dengan makhluk papun. Nabi Ibrahim mengucapkan “Alhamdulillah”. Allah juga mengabadikan tanggung jawab Nabi Ya’kub kepada anak-anaknya sebagaimana ayat berikut: Adakah kamu hadir ketika Ya’kub kedatangan (tanda-tanda) maut, ketika ia berkata kepada anak-anaknya: “Apa yang kamu sembah sepeninggalku?” Mereka menjawab: “Kami akan menyembah Tuhanmu dan Tuhan nenek moyangmu, Ibrahim, Ismail dan Ishak, (yaitu) Tuhan Yang Maha Esa dan kami hanya tunduk patuh kepadaNya.”(QS.2:133).

Nabi Zakaria As juga berkata kepada anaknya:”Wahai Yahya ambil kitab ini dengan sungguhsungguh.(QS.19:12). Maksudnya mengamalkan segala perintah Allah dalam kitab suci, dan menjauhi segala larangannya. Waliyullah Lu k m a n u l h a k i m s e l a l u menasihati anaknya supaya tidak syirik. Maryam mendidik Isa sehingga menjadi anak yang mulia di sisi Allah, menjadi rasul yang ulul azmi. Nabi Muhammad SAW sebagai pembawa Agama islam dengan syariat yang universal dan kaffah, berkalikali menasihatkan umatnya untuk memurnikan aqidah Islam agar tidak bercampur dengan aqidah agama lain. Tanggung jawab Rasulullah sangat tinggi sehingga sampai hari ini pesan-pesan beliau tetap dipegang teguh oleh umatnya yang mendapat hidyah dari Allah SWT.

Kata Dewi,bantuan akan disalurkan ke esok harinya (7 /2) di posko-posko pengungsian, yang disertai kehadiran para artis. Acara ini mendapat dukungan dari berbagai pihak termasuk Kepala Badan Lingkungan Provinsi Sumatera Utara, PDAM Tirtanadi dan BPBD Sumut. (m11) segera berdatangan dan menginformasikannya ke personil kepolisian yang bertugas di Pos Sat Lantas Dolok Merangir. Pihak kepolisian segera membawa dua korban tewas ke RSUD Dr. Djasamen Saragih, Kota Pematangsiantar untuk divisum, sedang S. Simbolon dibawa ke RSU Vita Insani, Pematangsiantar untuk perawatan. Sesudah melakukan olah tempat kejadian, personil Sat Lantas mengamankan Abu Bakar bersama mobil yang dikemudikannya, betor korban dan lembu sebagai barang bukti ke markas Sat Lantas Polres Simalungun. Kapolres Simalungun AKBP Andi Syahriful Taufik, SIK, M.Si saat dikonfirmasi melalui Kasubbag Humas AKP M. Syafi’i, Kasat lantas AKP Rudy Silaen, SH, SIK dan Kanit Laka Iptu Alsem Sinaga, Rabu (5/2) menyebutkan kecelakaan lalu lintas yang mengakibatkan korban jiwa, lukaluka dan kerugian material mencapai puluhan juta rupiah i t u m a s i h d a l a m p ro s e s penyelidikan. (a30)

Tiga Oknum TNI .... Kapolda terkait masalah ini,” sebutnya. Sementara Kapolda Sumut Irjen Pol. Syarief Gunawan memastikan akan saling dukung dengan Pangdam untuk kebaikan dan kenyamanan masyarakat. Terkait isu bentrok antar personel di lapangan dalam kasus penggerebekan lokasi perjudian di pekuburan Jepang, Selasa (4/2) sore, Kapolda membantah. “Saat itu atas perintah saya, tim Satgas Pekat melakukan penggerebekan, jangan sampai isu bentrok itu dimanfaatkan pihak lain, karena penggerebekan itu merupakan keinginan masyarakat karena banyak praktik perjudian. Kita ingin menyelesaikan sebaik-baiknya,” kata Kapolda dan menambahkan, pihaknya sudah berkoordinasi dengan Pangdam supaya bisa saling mendukung. “Kalaupun ada permasalahan di lapangan akan segera

Al Bayan ....

Jawaban Sudoku:

5 6 7 3 8 4 9 2 1

3 9 1 5 2 7 4 6 8

4 2 8 1 6 9 7 3 5

9 3 4 6 5 2 8 1 7

1 8 6 9 7 3 2 5 4

2 7 5 4 1 8 6 9 3

7 5 9 2 4 1 3 8 6

6 4 2 8 3 5 1 7 9

8 1 3 7 9 6 5 4 2

mereka menunaikan ibadah haji.(Kitab: Tarikhun Nubuwwah). Seluruh rasul mengajak kepada akidah yang satu, yakni Aqidah Ketauhidan yang dapat menyelamatkan manusia sejak di dunia sampai di akhirat. Nabi Adam As mewariskan Aqidah itu pada putranya Syis, lalu Idris dan cucu Idris, Nuh, terus kepada Saleh, Hud, dan generesi sesudahnya. Kemudian dari keluarga Ibrahim As, lahir Ismail yang melahirkan bangsa Arab, Ishak yang melahirkan bangsa Israel, Ya’kub, Yusuf, Musa, Harun, Syu’ib, Luth, Daud, Sulaiman, Ilyas, Ilyasa’, Ayub, Zulkifli, Zakaria, Yahya, Isa. Dari jalur Nabi Ismail lahir Muhammad SAW. Para rasul Allah tersebut hanya mendakwahkan aqidah yang benar dan akhlak yang mulia. Nabi Ibrahim As berkata kepada anak-anaknya, demi-

MANILA, Filipina (Waspada): Presiden Filipina Benigno Aquino menyamakan usaha China mengklaim wilayah yang dipertikaikan dengan Nazi Jerman.Untuk itu,dia mendesak para pemimpin dunia agar tidak membuat kesalahan yang sama, demikian menurut The New York Times. Filipina menuduh China menjadi semakin agresif dalam beberapa tahun terakhir dalam memperkuat klaimnya di hampir semua kawasan Laut China Selatan. Aquino mengatakan negaranya tidak bisa berpangku tangan terhadap tetangganya

yang ingin menguasai kawasan itu sendirian. Aquino menurut laporan mengacu pada kegagalan Barat untuk mendukung Cekoslowakia ketika Adolf Hitler-yang memimpin Nazi Jerman menduduki beberapa bagian negara Eropa tahun 1938 sebelum Perang Dunia II. Jurubicara Presiden itu tidak bersedia mengomentari wawancara Aquino dengan The New York Times. Perbandingan yang dilontarkan oleh Aquino itu terkait sengketa wilayah Laut China Selatan antara Filipina dengan China. “Apa artinya ‘cukup sudah’? Pada kenyataannya, dunia harus bertindak. Kalian ingat bahwa Sudentland (wilayah barat Cekosvolakia) diserahkan kepada Hilter untuk mencegah Perang Dunia II,” ujar Aquino, seperti dikutip Times, Rabu (5/2). Filipina tahun lalu membawa sengketa wilayah ini ke Pengadilan Internasional PBB. Me re k a b e r u p a y a m e m buktikan bahwa klaim China terhadap Laut China Selatan adalah invalid. Namun, China tidak bersedia mengikuti proses tersebut. Aquino bersikeras Filipina -yang kekuatan militernya dianggap yang terlemah di Asiatidak akan menyerahkan wilayahnya kepada China. (m10) Misriadi berkeras bahwa tanah yang diserahkan kepada veteran tersebut, merupakan hak miliknya dibuktikan dengan sertifikat tanah. Persoalan tersebut, berlarut hingga berganti bupati. Sementara Misriadi yang dihubungi melalui telepon seluler, mengatakan, emosinya memuncak lantaran Bupati Bener Meriah Ruslan Abdul Gani, tak pernah menepati janji untuk menyelesaikan persoalan tanah miliknya di Pante Raya. Bahkan, bupati tidak memberikan izin untuk mendirikan bangunan di lokasi itu, sementara bangunan lain terus berdiri. Disampaikan Misriadi, ia menagih janji kepada Bupati Bener Meriah, untuk menyelesaikan persoalan ganti rugi tanahnya yang saat ini digunakan untuk legion veteran Bener Meriah. Terkait persoalan itu, sudah beberapa kali dilakukan pertemuan, namun hanya janji yang diterimanya dari bupati sehingga ia menjadi emosi. “Kalau harus berhadapan dengan hukum karena persoalan ini, saya siap m e n g h a d a p i n y a ,” u j a r Misriadi. (b33)

Ada-ada Saja .... seorang pecandu narkoba mencoba merampok sebuah bank di Frankfurt, Jerman. Perampok berusia 44 tahun yang tak disebutkan namanya itu dilaporkan memasuki Deutsche Bank pada Senin (3/2) pagi waktu setempat. Sang perampok awalnya antri bersama para nasabah lainnya. Ketika sampai ke teller bank, ia menyerahkan sebuah catatan berbunyi: “INI ADALAH PERAMPOKAN! SAYA BUTUH UANG”. Dalam catatan tersebut sang perampok menuntut uang 1.000 euro atau sekira Rp16 juta. Tapi karena ia tidak mengincar uang, perampok itu mengatakan kepada pegawai bank untuk menekan tombol alarm. Perampok dan pegawai bank kemudian mengobrol, dan sang perampok mengaku bahwa ia benar-benar berusaha untuk ditangkap sehingga bisa berhenti menggunakan narkoba. Pegawai bank lalu menawarinya kursi dan secangkir kopi, sementara mereka menunggu polisi tiba. Pelanggan lain bahkan tidak menyadari bahwa mereka terlibat dalam kasus perampokan, kepolisian Frankfurt mengatakan dalam sebuah pernyataan. Ketika petugas tiba di bank di pusat kota Frankfurt, m e re k a m e m b a w a s a n g perampok ke markas polisi di mana ia mengakui segalanya dan mendesak untuk bisa masuk ke penjara agar terhindar dari narkoba. Namun polisi tidak mau memasukkan sang perampok ke penjara. “Dia tidak menyakiti siapa pun, tidak merusak apa-apa, sehingga tidak ada alasan bagi kami untuk menahannya. Ia kemudian diberitahu tempat di mana ia bisa mencari sendiri bantuan untuk mengatasi kecanduannya,” kata juru bicara polisi yang dilansir dari The Local, Rabu (5/2). Polisi menambahkan bahwa pihaknya tidak mengetahui jenis narkotika apa yang telah menyebabkan pria ini kecanduan. (net/rzl)

Penghormatan .... sebelum berangkat ke lokasi di mana akhirnya dia menghadap sang khalik. Kehadiran Mulungi dan keluarga di lokasi yang dianggap aman juga tak luput dari sorotan para warga dan tim relawan “Save Sinabung”. Terlihat warga juga sempat meneteskan air mata ketika ibunda Thomas bercerita beberapa kali mengingatkan putranya agar tidak terlalu dekat saat ke lokasi erupsi Sinabung karena awan panas yang dilihat melalui televisi sudah sangat berbahaya. Namun almarhum yang memang memiliki rasa ingin

Korban Jadi 16 .... Bencana Nasional (BNPB) harus membangun MCK di 17 posko pengungsian karena para pengungsi terus bertambah. Setiap posko maksimal memiliki lima MCK plus satu kamar mandi.Pembangunan MCK ini ditangani langsung pihak TNI bidang Jitbang. Saat ini terdapat 85 MCK ditambah kamar mandi. BNPB mengharapkan penambahan itu mampu memenuhi kebutuhan para pengungsi. Pembangunan 85 MCK di 17 titik posko pengungsian dilakukan oleh Jitbang TNI dibantu Yon Zipur I Medan.Pembangunan titik MCK di posko pengungsian seperti, posko Makamahuli lapangan Samura Kabanjahe, UKA, KWK, Lods Berastagi, Lods Tongkoh, Lods Tigabinaga, Gedung Serba Guna KNPI, Jambur Sempakata dan berapa titik lainnya. Kasdam I BB Brigjend TNI Anggodo Wiradi meninjau langsung proses pembangunan MCK di 17 titik posko pengungsian. Selain itu, Bupati Karo Kena Ukur Karo Jambi didampingi sejumlah SKPD juga melakukan meninjauan pembangunan MCK di poskoposko pengungsian. ‘’Sedangkan tim DMC Dompet Dhuafa Waspada juga melakukan pembangunan 14 MCK semi permanen di posko Makamahuli lapangan Samura Kabanjahe bekerjasama dengan lembaga sosial dan instansi lainnya,’’ kata Ahmad selaku koordinator DMC Dompet Dhuafa Waspada saat di temui Waspada di posko Tiga Baru Kabanjahe. Terpisah PVMBG mengatakan kepada Waspada gempa tremor terlihat berkurang, namun guguran awan panas masih terus berlangsung.’’

Besok, Artis Ibu Kota .... Keluarga Wartawan Indonesia (IKWI) Sumut bekerja sama dengan Cahaya Ratu Mulia Jakarta. Kordinator acara Dewi Budiati Teruna Jasa Said yang j u g a k e t u a I K W I Su m u t mengatakan, acara bertema Kami Peduli ini rencananya dihadiri Gubsu H. Gatot Pujonugroho, Plt Wali Kota Medan H Dzulmi Eldin, jajaran Muspidasu dan sejumlah tokoh masyarakat Sumut.

Hujan Tahun Ini .... wajar, sebab musim penghujan memang terjadi di pada bulan Desember, Januari, dan Februari. Banjir yang lebih lama tahun ini, menurut dia disebabkan intensitas hujan yang lebih sering. “Kalau tahun lalu hujannya sangat deras 194—200 milimeter, tetapi sesekali saja. Kalau sekarang hujan cukup deras dan sering, hampir setiap malam. Tapi semua normal dalam arti terjadi di musim hujan Desember, Januari,

Fortuner Terjun .... Tahura Bukit Barisan antara simpang Daulu dengan Desa Taungkeh Berasragi.Peristiwa yang terjadi Selasa (4/2) itu mengakibatkan tiga penumpangnya, suami istri dan anaknya mengalami luka-luka. I n f o r m a s i Wa s p a d a peroleh Rabu (5/2), sebelum kejadian mobil yang dikemudikan Parulian Naibaho,62, penduduk Laubaleng Kab. Karo meluncur dari Medan menuju Karo.Dua penumpang lain di dalam mobil yakni istrinya Mahdalena Br Sembiring dan anaknya Alpalinda, 31. Namun setiba di TKP,

Anas Paparkan .... gedung KPK Jakarta, Rabu (5/2). Anas Rabu diperiksa sebagai tersangka dalam kasus dugaan penerimaan hadiah terkait pembangunan Pusat Pendidikan, Pelatihan dan Sekolah (P3SON) di Hambalang dan proyek-proyek lain. Proyek-proyek lain yang dimaksud KPK menurut Adnan adalah mengenai kongres Demokrat. “A n a s t a h u b a n y a k (mengenai kongres), biar dia bongkar semua yang terjadi dalam kongres itu, jadi kalau bicara soal kongres harus terbuka semua,” tambah Adnan.

WASPADA Kamis 6 Februari 2014 tahu yang besar menjawab,” iya mak, aku akan hati hati”. Saat menabur bunga dan memberi penghormat terakhir, keluarga Thomas terlihat membawa foto almarhum yang sedang merangkul salah satu anak pengungsi di salah satu posko pengungsian. Kepada wartawan, Mulungi mengaku pihak keluarga sudah sepakat akan mencari anak tersebut. Selain itu, pihak keluarga juga berjanji akan membantu pendidikan anak pengungsi yang dirangkul tersebut. Ketua Tim Relawan Save Sinabung yang terus bersinergi memberi bantuan selama

bencana Sinabung, Bersama Sembiring, mengaku seluruh masyarakat Tanah Karo sangat berduka atas keluarga korban yang terkena awan panas di Desa Sukameriah, Kec Payung, Sabtu (1/2) lalu. Didampingi Ustad Seherman Hutapea saat tebar bunga dan penghormatan terakhir, Bersama mengungkapkan dua di antara korban merupakan sahabatnya, yakni Thomas S Milala dan Rizal Syahputra. Kedua almarhum juga tercatat sebagai jurnalis dan mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-) Medan. (c10/m33)

Potensi awan panas dimuntahkan Sinabung cukup intens ( red zona) berbahaya radius 3 hingga 5 Km, ‘’ kata Kristianto mewakili Pusat Vulkanologi Mitigasi Benacana dan Geologi (PVMBG). ‘’ Memasuki hari ke lima, tim evakuasi pencarian korban awan panas terus melakukan penyisiran,’’ kata Dansatgas Letkol Inf Asep Sukar na kepada Waspada. Adapun nama-nama korban meninggal dunia : 1. Alexander Sembiring,17, 2. Daud Surbakti,17, 3. Diva Nusantara, 4. David Brahmana,17, 5. Mahal Surbakti,25, 6. Rizal Saputra,23, 7. Teken Sembiring,47, 8. Santun Siregar,22, 9. Fitriani Boru Napitupulu,19, 10. Asran Lubis,21, 11. Marudut Brisnu,25, 12. Daniel Siagian. 13. Tomas Lakae,27, 14. Zulfian Dimuri,21, 15. Surya Sembiring,24, 16. Doni Sembiring,70, Evakuasi Korban Ditunda Pantauan Waspada di Desa Guru Kinayan Kec. Payung dalam radius sekitar 4 kilometer dari Gunung Sinabung Kec. Namanteran, evakuasi korban awan panas yang diduga masih ada di Desa Sukameriah Kec. Payung dalam radius 3 kilometer dihentikan karena terjadi erupsi Gunung Sinabung. Sedangkan armada Brimob serta PMI siap untuk dipergunakan. Sekitar 200 personil Tim SAR Gabungan dikerahkan dalam proses evakuasi dengan berprinsip safety first. Tim melibatkan ahli dari PVMBG yang merekomendasikan potensi ancaman awan panas di lokasi pencarian korban. “Kita tidak jadi melakukan

pencarian evakuasi, karena larangan dari PVMBG. Mengingat cuaca tidak mendukung untuk terjun dalam pencarian evakuasi ke lereng Gunung Sinabung,” kata Dansatgas Letkol Inf. Asep Sukarna kepada Waspada di lokasi. Abu Sinabung Sampai Malaysia Lapisan tipis abu dari Gunung Sinabung, Sumatera Utara, sampai di bagian baratdaya semenanjung Malaysia Rabu (5/2) pagi. Media setempat mengutip Direktur Prakiraan Cuaca Pusat Muhammad Helmi Abdullah, daerah yang terkena dampak itu mencakup pesisir Negeri Sembilan, Malaka, Muar, Batu Pahat, Pontian dan Kulaijaya di Johor. Dia mengatakan, tidak terlalu banyak abu dan menyebabkan sedikit kabut. ‘’Seorang penasehat tentang abu vulkanik telah dikirim ke industri penerbangan, ‘’ kata Helmi. Departemen Meteorologi mengatakan Senin, abu vulkanik dari Gunung Sinabung bisa ditiup ke arah negara selatan karena angin barat laut yang diperkirakan bertahan sampai Kamis.Bahkan, katanya, penerbangan mungkin terpengaruh dan jarak pandang dapat berkurang. Namun, pejabat dari Dep a r t e m e n Pe n e r b a n g a n mengatakan operasi penerbangan di seluruh Malaysia saat ini tidak terpengaruh, dan prosedur operasi standar akan dilaksanakan jika visibilitas terus berkurang. Menurut Mokhtar Abdul Majid, direktur Departemen Negara Bagian Johor Baru Lingkungan Hidup, kualitas udara di sana akan diawasi secara ketat dan mereka tidak menemukan masalah dengan mutu udara. (c19/c10/ant)

Menurut Dewi Budiati penyelenggaraan ini dikemas dalam bentuk gala diner dan hiburan, di mana para tamu diharapkan dapat membawa bantuan apa saja untuk kebutuhan para pengungsi seperti sembako,pakaian,mainan anak-anak dan lainnya. Seluruh bantuan akan diserahkan langsung keesokan harinya ke kantung-kantung korban bencana alam di berbagai wilayah Indonesia yeng terkena bencana termasuk banjir Jakarta dan Manado. ‘’

Saya juga mendapatkan arahan dan bimbingan dari Gubsu, di mana beliau berpesan agar panitia dapat memegang amanah dan bekerja pantang menyerah untuk menggalang sikap solidaritas yang tinggi terhadap saudarasaudar kita yang tertimpa musibah,’’ kata Dewi dan menambahkan Gubsu berkenan hadir dan akan ikut melelang beberapa barang koleksi kesayangannya.Seperti reket dan beberapa jenis pohon langka. (m11)

dan Februari,” ujar dia. Kukuh mengatakan berdasarkan pantauan BMKG hujan Desember hingga Februari ini terjadi di daerahdaerah antara lain Sumatera Tengah, Sumatera Selatan, Banten, Jawa Barat, Jawa Tengah, Kalimantan Selatan, Sulawesi Selatan, Sulawesi Tengah, dan Papua Selatan. Puncak hujan lebat diperkirakan akan terjadi pada pertengahan Februari 2014. “Intinya ini bukan anomali, tetapi normal di musim hujan. Tetap harus waspada,

khususnya untuk Jabodetabek, karena masih ada puncak musim hujan di pertengahan Februari,” kata Kukuh. BMKG memprediksi akhir Februari hingga pertengahan Maret masih akan turun hujan di sejumlah wilayah di Indonesia, namun intensitasnya cenderung ringan karena merupakan hujan lokal biasa. “Pada Februari hingga Maret itu biasanya disertai angin, tetapi sejauh ini belum ada perkiraan angin kencang di Indonesia,” kata dia.

tepatnya di salah satu tikungan di Km 56 mobil yang meluncur kencang tersebut tiba-tiba menabrak palang plat besi pengaman jalan hingga tercabut, kemudian mobil beserta penumpangnya terjun bebas ke dalam jurang. Untungnya, mobil tersebut tidak menggelinding terlalu dalam karena terhalang semak-semak dan pepohonan. Namun, tiga orang di dalam mobil luka-luka. Sedangkan mobil warna hitam tersebut ringsek. Sejumlah warga yang melihat kejadian itu segera memberikan pertolongan

dengan membawa korban ke RSU Amanda simpang perumahan Korpri Berastagi. Petugas Polantas yang turun ke lapangan segera melakukan olah TKP dan mengevakuasi mobil naas tersebut. Kasat Lantas AKP Toni IR yang dikonfirmasikan mengatakan, penyebab kejadian karena Parulian Naibaho mengantuk ketika menyetir mobil. “Sesuai pengakuan korban kejadian tersebut merupakan peristiwa tunggal dan tidak ada keterkaitannya dengan yang lain”, ujar Toni. (c09)

Ia pun mengaku bahwa kliennya sudah membuka peran ketua “Steering committee” (panitia pengarah) yaitu Edhie Baskoro Yudhoyono alias Ibas maupun peran ketua umum Partai Demokrat saat pelaksanaan kongres Demokrat, Hadi Utomo. “Itu akan dibuka semua, semua peran orang yang ikut di kongres akan dibuka. Nama Ibas sudah disebut,” tegas Adnan. Namun Adnan tidak menjelaskan kaitan Ibas dengan dugaan penerimaan hadiah yang disangkakan KPK kepada kliennya.

“Steering committee juga jelas siapa, saya kira itu dulu, kita ikuti saja kewenangan penyidik asal jelas koridornya sehingga pembela pun tahu apa yang akan dibela,” tambah Adnan. Karena nama Ibas sudah disebut oleh Anas, maka Adnan mendorong agar KPK mengklarifikasi langsung kepada Sekretaris Jenderal Partai Demokrat tersebut. “Iya dong, semua orang harus dilakukan klarifikasi, itu satu teknik penyidikan kecuali Anas yang bohong, kalau Anas jujur ya semua bisa dibuka,” ungkap Adnan.

Berita Utama


WASPADA Kamis 6 Februari 2014

3 Rumah Terbakar Lau Baleng LAUBALENG ( Waspada): Kebakaran di Jalan Lau Renun, Gang Went, Dusun Went, Desa Lau Baleng ,Kec. Lau Baleng Kab. Karo Rabu (5/2), menghanguskan tiga rumah yang dihuni lima kepala keluarga.

Akibat kebakaran itu, mereka terpaksa menumpang di rumah kerabat dan bangunan darurat yang disediakan pemerintah setempat. Tidak ada korban jiwa, kerugian material diperkirakan Rp 300 juta.

Waspada/Basita Bukit

MOBIL Fortuner terjun ke jurang di Km 56 Medan-Berastagi mengakibatkan sopir dan dua penumpangnya mengalami luka-luka.

Fortuner Terjun Ke Jurang, 3 Luka-luka KABANJAHE (Waspada): Satu mobil Fortuner BK 411 II terjun bebas ke dalam jurang di Jl. Letjen Djamin Ginting’s Km 56 MedanBerastagi, tepatnya di kawasan Tahura Bukit Barisan antara simpang Daulu dengan Desa Taungkeh Berasragi.Peristiwa yang terjadi Selasa (4/2) itu mengakibatkan tiga penumpangnya, suami istri dan anaknya mengalami luka-luka. Informasi Waspada peroleh Rabu (5/2), sebelum kejadian mobil yang dikemudikan Parulian Naibaho,62, penduduk Laubaleng Kab. Karo meluncur dari Medan menuju Karo.Dua penumpang lain di dalam mobil yakni istrinya Mahdalena Br Sembiring dan anaknya Alpalinda, 31. Namun setiba di TKP, tepatnya di salah satu tikungan di Km 56 mobil yang meluncur kencang tersebut tiba-tiba menabrak palang plat besi pengaman jalan hingga tercabut, kemudian mobil beserta penumpangnya terjun bebas ke dalam jurang. Untungnya, mobil tersebut tidak menggelinding terlalu dalam karena terhalang semak-semak dan pepohonan. Namun, tiga orang di dalam mobil luka-luka.Sedangkan mobil warna hitam tersebut ringsek. Sejumlah warga yang melihat kejadian itu segera memberikan pertolongan dengan membawa korban ke RSU Amanda simpang perumahan Korpri Berastagi. Petugas Polantas yang turun ke lapangan segera melakukan olah TKP dan mengevakuasi mobil naas tersebut. Kasat Lantas AKP Toni IR yang dikonfirmasikan mengatakan, penyebab kejadian karena Parulian Naibaho mengantuk ketika menyetir mobil. “Sesuai pengakuan korban kejadian tersebut merupakan peristiwa tunggal dan tidak ada keterkaitannya dengan yang lain”, ujar Toni. (c09)

Artis Ibukota Turut ... rencananya dihadiri Gubsu H. Gatot Pujo Nugroho, Plt Wali Kota Medan H Dzulmi Eldin, jajaran Muspidasu dan sejumlah tokoh masyarakat Sumut. Menurut Dewi Budiati penyelenggaraan ini dikemas dalam bentuk gala diner dan hiburan, di mana para tamu diharapkan dapat membawa bantuan apa saja untuk kebutuhan para pengungsi seperti sembako,pakaian,mainan anak-anak dan lainnya. Seluruh bantuan akan diserahkan langsung keesokan harinya ke kantung-kantung korban bencana alam di berbagai wilayah Indonesia yeng terkena bencana termasuk banjir Jakarta dan Manado. ‘’ Saya juga mendapatkan arahan dan bimbingan dari Gubsu, di mana beliau berpesan agar panitia dapat memegang amanah dan bekerja pantang menyerah untuk menggalang sikap solidaritas yang tinggi terhadap saudara-saudara kita yang tertimpa musibah,’’ kata Dewi dan menambahkan GubJawaban Problem Catur, su berkenan hadir dan akan ikut melelang beberapa barang TTS Dan Sudoku koleksi kesayangannya.SeDari Halaman Sport. perti reket dan beberapa jenis pohon langka. (m11)

Jawaban Problem Catur:

Ada-ada Saja ...

1. Mxh5 (target

di Frankfurt, Jerman. Perampok berusia 44 tahun yang tak disebutkan namanya itu dilaporkan memasuki Deutsche Bank pada Senin (3/2) pagi waktu setempat. Sang perampok awalnya antri bersama para nasabah lainnya. Ketika sampai ke teller bank, ia menyerahkan sebuah catatan berbunyi: “INI ADALAH PERAMPOKAN! SAYA BUTUH UANG”. Dalam catatan tersebut sang perampok menuntut uang 1.000 euro atau sekira Rp16 juta. Tapi karena ia tidak mengincar uang, perampok itu mengatakan kepada pegawai bank untuk menekan tombol alarm. Perampok dan pegawai bank kemudian mengobrol, dan sang perampok mengaku bahwa ia benar-benar berusaha untuk ditangkap sehingga bisa berhenti menggunakan narkoba. Pegawai bank lalu menawarinya kursi dan secangkir kopi, sementara mereka menunggu polisi tiba. Pelanggan lain bahkan tidak menyadari bahwa mereka terlibat dalam kasus perampokan, kepolisian Frankfurt mengatakan dalam sebuah pernyataan. Ketika petugas tiba di bank di pusat kota Frankfurt, mereka membawa sang perampok ke markas polisi di mana ia mengakui segalanya dan mendesak untuk bisa masuk ke penjara agar terhindar dari narkoba. Namun polisi tidak mau memasukkan sang perampok ke penjara. “Dia tidak menyakiti siapa pun, tidak merusak apa-apa, sehingga tidak ada alasan bagi kami untuk menahannya. Ia kemudian diberitahu tempat di mana ia bisa mencari sendiri bantuan untuk mengatasi kecanduannya,” kata juru bicara polisi yang dilansir dari The Local, Rabu (5/2). Polisi menambahkan bahwa pihaknya tidak mengetahui jenis narkotika apa yang telah menyebabkan pria ini kecanduan. (net/rzl)

Mh8+), Md4+. 2. GxM, Kg6. 3. MxKg6+, Gg7. 4. MxG+mat. (Jika 1. ...., BxGc3. 2. Gxf7+, Rg7. 3. f6+mat). Jawaban TTS: TTS


Jawaban Sudoku:

5 6 7 3 8 4 9 2 1

3 9 1 5 2 7 4 6 8

4 2 8 1 6 9 7 3 5

9 3 4 6 5 2 8 1 7

1 8 6 9 7 3 2 5 4

2 7 5 4 1 8 6 9 3

7 5 9 2 4 1 3 8 6

6 4 2 8 3 5 1 7 9

8 1 3 7 9 6 5 4 2

Pemilik rumah yang terbakar kata Kapolsek Lau Baleng JM Tarigan, di antaranya Undang Ginting,50, Sutrisni Ginting ,51, Rawin Pinem ,35, dan Udan Ginting. Kebakaran terjadi sekira pukul 15:05 di mana pemilik rumah sedang berada di luar. Saksi mata Amin Ginting, 28, mengatakan kepada Waspada, kebakaran diduga akibat puntung rokok .Api cepat menjalar dari rumah ke tempat yang lain sehingga dalam hitungan menit rumah-rumah tersebut musnah jadi abu. Api dapat dipadamkan setelah warga bergotong royong menyiramkan air. Sedangkan kasusnya ditangani Polsek Lau Baleng.(c10)

Waspada/Dede Basri Hasibuan

Waspada/Dede Basri Hasibuan

WARGA Desa Sibintun, Kec. Simpang Empat, mengevakuasi ternaknya dengan menggunakan mobil terbuka saat menjelang erupsi Gunungapi Sinabung Kec. Namanteran Kab. Karo, Rabu (5/2).

EVAKUASI diduga masih adanya korban ditempat kejadian perkara, yang menewaskan 16 jiwa sampai saat ini. Tim SAR gabungan tidak jadi melakukan evakusi. Disebabkan erupsi masih terjadi dan larangan dari PVMBG. Seperti terekam kamera saat di simpang Desa Guru Kinayan, Kec. Payung Kab. Karo, Rabu (5/2).

PT KAI Pertimbangkan Buka Kembali Stasiun Perbaungan MEDAN (Waspada) : Manajemen PT Kereta Api Indonesia (KAI) Divre I Sumut/ Aceh berpeluang membuka kembali stasiun Kereta Api (KA) di Perbaungan, Serdang Bedagai, setelah ditutup Selasa (4/2) malam, akibat peristiwa yang dapat mengancam keselamatan petugas KA di sana. Kesimpulan itu diputuskan setelah pertemuan rapat koordinasi Satuan Kerja Perangkat Daerah (SKPD) Sergai dengan pejabat manajemen PT KAI di kantor PT KAI Medan Jl. HM. Yamin Medan, yang membahas masalah Ikatan Penjual Asongan (IPA), Rabu (5/2). Rapino Situmorang, manajer Humas PT KAI Divre I Sumut/Aceh membenarkan hal itu, setelah mengadakan

pertemuan lebih kurang 3 jam di ruang Dolok Martimbang, turut dihadiri Wakil Bupati Sergei Syahriono, Wakadivre I Sumut/Aceh Sarijal,Waka Polres Sergai dan pejabat lainnya. Menurut Situmorang, stasiun KA Perbaungan ditutup terkait ancaman keselamatan petugas KA di sana. “Kalau kondisi keamanan menjamin, tidak tertutup kemungkinan stasiun dibuka kembali,” kata dia. Sementara pejabat Sergai dalam pertemuan tersebut segera mengirim surat resmi, memohon ke manajemen PT KAI Divre I KA Sumut/Aceh, agar stasiun Perbaungan dibuka kembali dan dapat menjual tiket kepada penumpang. Wabup dan SKPD yang hadir juga meminta agar membantu koperasi Ikatan

Istana Negara ...

Aquino Samakan China Dengan Hitler

“Solusinya dengan membentuk satgas, jadi setiap jalan itu ada yang bertanggung jawab. Seperti zaman Belanda setiap enam kilometer ada mandor,” tutur Ahok. Sementara Badan PenanggulanganBencanaDaerah(BPBD) DKI Jakarta melaporkan hujan deras yang turun sejak Selasa (4/ 2) malam hingga Rabu pagi mengakibatkan 21 kelurahan di Jakarta terendam banjir. Menurut data BPBD DKI Jakarta, banjir hari ini merendam sebanyak21kelurahandisembilan kecamatan dan berdampak pada 96.593 warga. “Selain itu 16.135 warga terpaksa mengungsi dari rumah mereka masing-masing. Para pengungsi itu tersebar di 62 lokasi pengungsian di wilayah Ibu Kota,” ujar Edy. Di Jakarta Timur, ada enam kelurahan yang terendam banjir dengan ketinggian 30 hingga 250 sentimeter (cm), yakni kelurahan Kampung Melayu, Bidara Cina, Cililitan, Cawang, Balekambang dan Cipinang Melayu. (vvn/ant)

Tiga Oknum TNI ... Sementara Kapolda Sumut Irjen Pol. Syarief Gunawan memastikan akan saling dukung dengan Pangdam untuk kebaikan dan kenyamanan masyarakat. Terkait isu bentrok antar personel di lapangan dalam kasus penggerebekan lokasi

MANILA, Filipina (Waspada): Presiden Filipina Benigno Aquino menyamakan usaha China mengklaim wilayah yang dipertikaikan dengan Nazi Jerman.Untuk itu,dia mendesak para pemimpin dunia agar tidak membuat kesalahan yang sama, demikian menurut The New York Times. Filipina menuduh China menjadi semakin agresif dalam beberapa tahun terakhir dalam memperkuat klaimnya di hampir semua kawasan Laut China Selatan. Aquino mengatakan negaranya tidak bisa berpangku tangan terhadap tetangganya yang ingin menguasai kawasan itu sendirian. Aquino menurut laporan mengacu pada kegagalan Barat untuk mendukung Cekoslowakia ketika Adolf Hitleryang memimpin Nazi Jerman menduduki beberapa bagian negara Eropa tahun 1938 sebelum Perang Dunia II. Jurubicara Presiden itu tidak bersedia mengomentari wawan-

cara Aquino dengan The New York Times. Perbandingan yang dilontarkan oleh Aquino itu terkait sengketa wilayah Laut China Selatan antara Filipina dengan China. “Apa artinya ‘cukup sudah’? Pada kenyataannya, dunia harus bertindak. Kalian ingat bahwa Sudentland (wilayah barat Cekosvolakia) diserahkan kepada Hilter untuk mencegah Perang Dunia II,” ujar Aquino, dikutip Times, Rabu (5/2). Filipina tahun lalu membawa sengketa wilayah ini ke Pengadilan Internasional PBB. Mereka berupaya membuktikan bahwa klaim China terhadap Laut China Selatan adalah invalid. Namun, China tidak bersedia mengikuti proses tersebut. Aquino bersikeras Filipina yang kekuatan militernya dianggap yang terlemah di Asia- tidak akan menyerahkan wilayahnya kepada China. Tetapi, dia mengakui negaranya membutuhkan bantuan dari pihak asing. (m10)

perjudian di pekuburan Jepang, Selasa (4/2) sore, Kapolda membantah. “Saat itu atas perintah saya, tim Satgas Pekat melakukan penggerebekan, jangan sampai isu bentrok itu dimanfaatkan pihak lain, karena penggerebekan itu merupakan keinginan masyarakat karena banyak praktik perju-

dian. Kita ingin menyelesaikan sebaik-baiknya,” kata Kapolda dan menambahkan, pihaknya sudah berkoordinasi dengan Pangdam supaya bisa saling mendukung. “Kalaupun ada permasalahan di lapangan akan segera dituntaskan. Begitu juga kalau ada anggota saya yang menjadi beking judi, akan ditindak tegas,” kata Kapolda. Intinya, sebut dia, bagaimana personel TNI-Polri membantu masyarakat menghapus perjudian. Kapolda berharap agar peristiwa tersebut jangan sampai menjadi preseden buruk, sebab akan berdampak pada kegiatan masyarakat. “Apalagi kita juga sedang menghadapi tugas tahap pengamanan Pemilu,” sebutnya. Sebelumnya, Selasa (4/2) sore, puluhan petugas Poldasu bersama Brimob menggerebek judi dadu putar beromset puluhan juta di pekubu-ran Jepang Jl. Ardagusema, De-litua. Dalam penyergapan yang berlangsug ricuh tersebut , petugas sempat meletuskan tembakan beberapa kali dan mengamankan sejumlah orang dari lokasi. (m27)

Presiden: Allah Sedang ... Untuk itu, Presiden mengajak seluruh lapisan masyarakat untuk bergandengan tangan dalam mengatasi bencana alam yang melanda bangsa Indonesia. “Marilah kita bergandengan tangan untuk mengatasi masalah ini, di Sumatera Utara masih ada bencana letusan Gunung Sinabung, di Jambi, Bengkulu, Jakarta, Jawa Barat, Jawa Tengah, Jawa Timur banjir, demikian juga di Sulawesi, Maluku semua sedang mengatasi masalah ini, Pemerintah Pusat tentu memberikan bantuan sepenuhnya, namun itu semua diperlukan kebersamaan di antara kita,” kata Presiden. Presiden berharap kita bisa mengatasi bencana ini, dan kemudian kita melanjutkan pembangunan di berbagai bidang untuk hari esok yang lebih baik.

Anas Paparkan ... peran ketua “Steering committee” (panitia pengarah) yaitu Edhie Baskoro Yudhoyono alias Ibas maupun peran ketua umum Partai Demokrat saat pelaksanaan kongres Demokrat, Hadi Utomo. “Itu akan dibuka semua, semua peran orang yang ikut di kongres akan dibuka. Nama Ibas sudah disebut,” tegas Adnan. Namun Adnan tidak menjelaskan kaitan Ibas dengan

Tabrak Lembu, ... Betor yang dikemudikan Hendri menjadi tidak terkendali dan oleng serta meluncur ke sebelah kanan jalan. Pada saat bersamaan, meluncur dari arah berlawanan satu unit mobil Toyota Rush BK 1347 QH dikemudikan Abu Bakar, 61, pensiunan PNS, warga Jl. Padangsidimpuan, kompleks PU, Kel. Sarudik, Kota Sibolga dengan membawa penumpang S. Simbolon, 65, warga sama dengan Abu Bakar. Mobil dikemudikan Abu Bakar langsung menabrak betor hingga pengemudi dan penumpang betor terlempar ke kanan dan kiri jalan. Hendri

Pedagang Asongan agar bisa mengelola restorasi di dalam kereta api. Mereka juga meminta lahan-lahan KA di luar stasiun Perbaungan dapat dimanfaatkan untuk membuka kuliner atau dagangan lainnya dengan cara menyewa, sehingga mereka tidak menjadi pekerja asongan lagi. Namun, dalam pertemuan tersebut suasana sempat memanas saat Kolonel Marwan M, selaku manajer senior keamanan PT KAI Divre I Sumut/ Aceh kepada jajaran SKPD Sergai dan utusan IPA menyatakan, tidak bakal menjual tiket di stasiun Perbaungan dan KA tidak akan berhenti di sana. Salah satu alasan, di samping manajemen KA terus merugi, penumpang cukup minim, dan perjalanan KA ke

dugaan penerimaan hadiah yang disangkakan KPK kepada kliennya. “Steering committee juga jelas siapa, saya kira itu dulu, kita ikuti saja kewenangan penyidik asal jelas koridornya sehingga pembela pun tahu apa yang akan dibela,” tambah Adnan. Karena nama Ibas sudah disebut oleh Anas, maka Adnan mendorong agar KPK mengklarifikasi langsung kepada Sekretaris Jenderal Partai Demokrat tersebut. dan Liza tewas di tempat kejadian. Abu Bakar selamat namun S. Simbolon mengalami luka ringan. Warga bersama Polantas Dolok Merangir membawa dua korban tewas ke RSUD Dr. Djasamen Saragih, Kota Pematangsiantar. Sedangkan, Abu Bakar bersama mobilnya diamankan ke MakoSat Lantas Polres Simalungun. Kapolres Simalungun AKBP Andi Syahriful Taufik, SIK, M.Si saat dikonfirmasi melalui Kasubbag Humas AKP M. Syafi’i, Kasat lantas AKP Rudy Silaen, SH, SIK dan Kanit Laka Iptu Alsem Sinaga, Rabu (5/2), membenarkan peristiwa itu. (a30)

KPK Selidiki ... Menurut Ketua PPATK M. Yusuf, untuk pengelolaan ibadah haji memang belum sepenuhnya bisa diketahui publik terkait peruntukannya. Apalagi beberapa kajian yang dilakukan KPK maupun lembaga swadaya masyarakat menyebutkan sejumlah kejanggalan dalam pengelolaan dana ibadah haji. KPK sendiri pernah mengusulkan agar Kementerian Agama menghentikan sementara pendaftaran calon haji. Sebab, saat ini Biaya Perjalanan Ibadah Haji (BPIH) sudah mencapai Rp38 triliun hingga Rp40 triliun, dengan bunga sebesar Rp1,7 triliun. Wakil Ketua KPK, Busyro Muqoddas mengatakan, jika pendaftaran haji terus dibuka, jumlah itu akan terus menggelembung. Jika dikelola secara tidak transparan dan akuntabel, akan berpotensi dikorupsi. (vvn)

stasiun lain terlambat. Menurut Rapino Dirjen Kereta Api telah menyarankan agar menutup sejumlah stasiun yang merugi, seperti Perbaungan, stasiun arah Belawan, stasiun Pusat Pasar Jl. Thamrin dan stasiun arah ke Binjai. Namun, Wakil Bupati Sergai minta pejabat PT KAI mempertimbangkan hal itu dengan memberdayakan kembali IPA Sergai sesuai perjanjian awal 2012.Setidaknya setahun ini para asongan harus bekerja sambil mempersiapkan usaha lainnya. Bahkan Kadis Perdagangan/Pasar Sergei menyatakan, para asongan sudah bertahun-tahun menjajakan makanan di kereta api untuk menghidupi keluarga mereka, SDM mereka juga terbatas sehingga perlu dukungan. Sementara itu Sarbaini, utusan IPA menyatakan, masalah yang timbul kemarin akibat kurang koordinasi antara manajemen PT KAI dengan jajaran IPA. (m32)

Abu Sinabung ... Departemen Meteorologi mengatakan Senin, abu vulkanik dari Gunung Sinabung bisa ditiup ke arah negara selatan karena angin barat laut yang diperkirakan bertahan sampai Kamis.Bahkan, katanya, penerbangan mungkin terpengaruh dan jarak pandang dapat berkurang. Namun, pejabat dari Departemen Penerbangan mengatakan operasi penerbangan di seluruh Malaysia saat ini tidak terpengaruh, dan prosedur operasi standar akan dilaksanakan jika visibilitas terus berkurang.

Eldin Dukung ... bentuk dukungan itu akan direalisasikan dengan menyumbangkan sejumlah barang-barang koleksi kesayangannya untuk dilelang oleh panitia pada malam pengumpulan dana besok malam (6/2) di Wisma Benteng, yang dimeriahkan artis-artis ibukota seperti Dewi Persik, Dolce Gamalama, Erna Tarigan, Erna Listy,Vinnie Lupita dan artis cilik Amel Carla. Sementara di tempat yang sama, Dewi Budiati yang turut sebagai peserta rapat, mengatakan aksi solidaritas ini adalah kolaborasi antara Ikatan Keluarga Wartawan Indonesia (IKWI) Sumut bekerja sama dengan teman-teman sesama relawan dari Cahaya Ratu Media, yang mendatangkan sejumlah artis Ibu Kota tanpa dipungut bayaran. Kedatangan para artis difasilitasi oleh Cahaya Ratu Media untuk menggalang sikap kepedulian mereka terhadap saudara-saudara kita yang tengah dilanda bencana. Kata Dewi, bantuan akan disalurkan ke esok harinya (7 /2) di posko-posko pengungsian, yang disertai kehadiran para artis. Acara ini mendapat dukungan dari berbagai pihak termasuk Kepala Badan Lingkungan Provinsi Sumatera Utara, PDAM Tirtanadi dan BPBD Sumut. (m11)

Korban Meninggal Jadi ... secara intensif,”ungkapnya. Dengan meninggalnya Doni, korban meninggal dunia menjadi 16 jiwa. Sementara itu, Badan Penanggulangan Bencana Nasional (BNPB) harus membangun MCK di 17 posko pengungsian karena para pengungsi terus bertambah.Setiap posko maksimal memiliki lima MCK plus satu kamar mandi. Saat ini terdapat 85 MCK ditambah kamar mandi. BNPB mengharapkan penambahan itu mampu memenuhi kebutuhan para pengungsi. Pembangunan 85 MCK di 17 titik posko pengungsian dilakukan oleh Jitbang TNI dibantu Yon Zipur I Medan. Pembangunan titik MCK di posko pengungsian seperti, posko Makamahuli lapangan Samura Kabanjahe, UKA, KWK, Lods Berastagi, Lods Tongkoh, Lods Tigabinaga, Gedung Serba Guna KNPI, Jambur Sempakata dan berapa titik lainnya. Kasdam I BB Brigjen TNI Anggodo Wiradi meninjau langsung proses pembangunan MCK di 17 titik posko pengungsian. Selain itu, Bupati Karo Kena Ukur Karo Jambi didampingi sejumlah SKPD juga melakukan meninjauan pembangunan MCK di posko-posko pengungsian. ‘’ Sedangkan tim DMC Dompet Dhuafa Waspada juga melakukan pembangunan 14 MCK semi permanen di posko Makamahuli lapangan Samura Kabanjahe bekerjasama dengan lembaga sosial dan instansi lainnya,’’ kata Ahmad selaku koordinator DMC Dompet Dhuafa Waspada saat di temui Waspada di posko Tiga Baru Kabanjahe. Terpisah PVMBG mengatakan kepada Waspada gempa tremor terlihat berkurang, namun guguran awan panas masih terus berlangsung. ’’ Potensi awan panas dimuntahkan Sinabung cukup intens ( red zona) berbahaya radius 3 hingga 5 Km, ‘’ kata Kristianto mewakili Pusat Vulkanologi Mitigasi Bencana dan Geologi (PVMBG). ‘’ Memasuki hari ke lima, tim evakuasi pencarian korban awan panas terus melakukan penyisiran,’’ kata Dansatgas Letkol Inf Asep Sukarna kepada Waspada . Adapun nama-nama korban meninggal dunia : 1. Alexander Sembiring,17, 2. Daud Surbakti,17, 3. Diva Nusantara, 4. David Brahmana,17, 5. Mahal Surbakti, 25, 6. Rizal Syahputra, 33, 7. Teken Sembiring,47, 8. Santun Siregar, 22, 9. Fitriani Boru Napitupulu,19, 10. Asran Lubis, 21, 11. Marudut Brisnu, 25, 12. Daniel Siagian. 13. Thomas S Milala, 27, 14. Zulfian Dimuri, 21, 15. Surya Sembiring, 24, 16. Doni Sembiring, 70, Evakuasi Korban Ditunda Pantauan Waspada di Desa Guru Kinayan Kec. Payung dalam radius sekitar 4 kilometer dari Gunung Sinabung Kec. Namanteran, evakuasi korban awan panas yang diduga masih ada di Desa Sukameriah Kec. Payung dalam radius 3 kilometer dihentikan karena terjadi erupsi Gunung Sinabung. Sedangkan armada Brimob serta PMI siap untuk dipergunakan. Sekitar 200 personil Tim SAR Gabungan dikerahkan dalam proses evakuasi dengan berprinsip safety first. Tim melibatkan ahli dari PVMBG yang merekomendasikan potensi ancaman awan panas di lokasi pencarian korban. “Kita tidak jadi melakukan pencarian evakuasi, karena larangan dari PVMBG. Mengingat cuaca tidak mendukung untuk terjun dalam pencarian evakuasi ke lereng Gunung Sinabung,” kata Dansatgas Letkol Inf. Asep Sukarna kepada Waspada di lokasi. (c19/c10)

Penghormatan Terakhir Keluarga ... sebelum berangkat ke lokasi di mana akhirnya dia menghadap sang khalik. Kehadiran Mulungi dan keluarga di lokasi yang dianggap aman juga tak luput dari sorotan para warga dan tim relawan “Save Sinabung”. Terlihat warga juga sempat meneteskan air mata ketika ibunda Thomas bercerita beberapa kali mengingatkan putranya agar tidak terlalu dekat saat ke lokasi erupsi Sinabung karena awan panas yang dilihat melalui televisi sudah sangat berbahaya. Namun almarhum yang memang memiliki rasa ingin tahu yang besar menjawab,” iya mak, aku akan hati hati”. Saat menabur bunga dan memberi penghormat terakhir, keluarga Thomas terlihat membawa foto almarhum yang sedang merangkul salah satu anak pengungsi di salah satu posko pengungsian. Kepada wartawan, Mulungi mengaku pihak keluarga sudah sepakat akan mencari anak tersebut. Selain itu, pihak keluarga juga berjanji akan membantu pendidikan anak pengungsi yang dirangkul tersebut. Ketua Tim Relawan Save Sinabung yang terus bersinergi memberi bantuan selama bencana Sinabung, Bersama Sembiring, mengaku seluruh masyarakat Tanah Karo sangat berduka atas keluarga korban yang terkena awan panas di Desa Sukameriah, Kec. Payung, Sabtu (1/2) lalu. Didampingi Ustad Seherman Hutapea saat tebar bunga dan penghormatan terakhir, Bersama mengungkapkan dua di antara korban merupakan sahabatnya, yakni Thomas S Milala dan Rizal Syahputra. Kedua almarhum juga tercatat sebagai jurnalis dan mahasiswa Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan. “Sebagai jurnalis, kedua sahabat kami sedang mendokumentasikan kondisi di lokasi zona merah Sinabung. Namun keduanya gugur demi mendapatkan buah karya yang sangat mulia di mata masyarakat,” aku Bersama. (c10/m33)

Al Bayan ... sejak di dunia sampai di akhirat. Nabi Adam As mewariskan Aqidah itu pada putranya Syis, lalu Idris dan cucu Idris, Nuh, terus kepada Saleh, Hud, dan generesi sesudahnya. Kemudian dari keluarga Ibrahim As, lahir Ismail yang melahirkan bangsa Arab, Ishak yang melahirkan bangsa Israel, Ya’kub, Yusuf, Musa, Harun, Syu’ib, Luth, Daud, Sulaiman, Ilyas, Ilyasa’, Ayub, Zulkifli, Zakaria, Yahya, Isa. Dari jalur Nabi Ismail lahir Muhammad SAW. Para rasul Allah tersebut hanya mendakwahkan aqidah yang benar dan akhlak yang mulia. Nabi Ibrahim As berkata kepada anakanaknya, demikian pula cucunya Ya’kub: Wahai anak-anakku, sungguh Allah telah memilih agama ini (Islam) untukmu, maka janganlah kamu mati kecuali dalam Islam (QS:2:131). Semua anak Ibrahim menjawab: Kami menyembah Allah SWT dan tidak akan mensyarikatkannya dengan makhluk papun. Nabi Ibrahim mengucapkan “Alhamdulillah”. Allah juga mengabadikan tanggung jawab Nabi Ya’kub kepada anak-anaknya sebagaima-

na ayat berikut: Adakah kamu hadir ketika Ya’kub kedatangan (tanda-tanda) maut, ketika ia berkata kepada anak-anaknya: “Apa yang kamu sembah sepeninggalku?” Mereka menjawab: “Kami akan menyembah Tuhanmu dan Tuhan nenek moyangmu, Ibrahim, Ismail dan Ishak, (yaitu) Tuhan Yang Maha Esa dan kami hanya tunduk patuh kepada-Nya.”(QS.2:133). Nabi Zakaria As juga berkata kepada anaknya:”Wahai Yahya ambil kitab ini dengan sungguhsungguh.(QS.19:12). Maksudnya mengamalkan segala perintah Allah dalam kitab suci, dan menjauhi segala larangannya. Waliyullah Lukmanul hakim selalu menasihati anaknya supaya tidak syirik. Maryam mendidik Isa sehingga menjadi anak yang mulia di sisi Allah, menjadi rasul yang ulul azmi. Nabi Muhammad SAW sebagai pembawa Agama Islam dengan syariat yang universal dan kaffah, berkali-kali menasihatkan umatnya untuk memurnikan aqidah Islam agar tidak bercampur dengan aqidah agama lain. Tanggung jawab Rasulullah sangat tinggi sehingga sampai hari ini pesan-pesan beliau tetap dipegang teguh oleh umatnya yang mendapat hidyah dari Allah SWT.

Medan Metropolitan

WASPADA Kamis 6 Februari 2014


Polresta Medan Ringkus 38 Penjudi MEDAN (Waspada): Reskrim Unit Judi Sila Polresta Medan meringkus 38 penjudi dalam penyergapan selama bulan Janurai 2014 dari berbagai wilayah hukum di Polresta Medan. Ke 38 tersangka yang diamankan ini berdasarkan 19 kasus yang masuk ke Reskrim Polresta Medan. “Semua tersangka ini kita amankan dari 19 kasus,” ujar Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak didampingi Kanit Judi Sila AKP Jama Kita Purba saat ekspos di Polresta Medan, Rabu (5/2). Menurut Calvijn, para tersangka ini diamankan dari 4 kasus perjudian, yakni judi togel, judi jackpot, judi joker, dan judi domino. Menurutnya, pengungkapan kasus judi dalam sebulan terakhir ini didominasi kasus perjudian togel yang berhasil mengamankan 17 tersangka dari 13 kasus, kemudian kasus judi jackpot dengan 13 tersangka dari 4 kasus, jenis judi joker 3 tersangka dari 1 kasus, dan judi kartu domino 2 tersangka dari satu kasus. Sedangkan barang bukti, dari judi togel disita 11 hand-

phone, 5 lembar kertas berisikan nomor togel, dan uang Rp1.182. 000, dari judi jackpot disita uang Rp228.000, koin judi jackpot sebanyak 8000 koin, dan 5 set kartu domino. Untuk judi kartu joker disita satu set kartu joker dan uang Rp71 ribu, serta judi domino disita satu set kartu domino dan uang Rp71 ribu. Kata dia, para tersangka yang diamankan ini ada sebahagian telah diserahkan ke Jaksa Penuntut Umum (JPU) karena berkas pemeriksaannya telah lengkap. “Sebahagian ada yang sudah kita serahkan ke JPU karena berkasnya sudah P21,” sebutnya. Calvijn menegaskan, berdasarkan atensi dari Kapolresta Medan Kombes Nico Afinta, pihaknya akan terus melakukan berbagai razia dan penggerebekan untuk memberantas perjudian di wilayah hukum Polresta Medan. “Polisi mengimbau kepada pemilik rumah yang dijadikan lokasi judi akan ditindak karena terlibat perjudian dengan tuduhan sebagai penyedia tempat. Masyarakat juga diminta memberikan informasi kepada polisi kalau di lingkungannya ada praktik perjudian,” tutur Calvijn. (m39)

Polisi Tangkap Bandar Narkoba

Waspada/Rizky Rayanda

KASAT Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak (dua kanan) dan Kanit Judi Sila AKP Jama K. Purba (dua kiri) memperlihatkan barang bukti kasus judi yang diamankan dalam sebulan terakhir, Rabu (5/2).

Gubsu Berharap BPKP Beri Arahan Tata Kelola Keuangan MEDAN (Waspada): Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, MSi, berharap BPKP Sumut terus memberikan arahan dan bimbingan mengenai tata kelola pemerintahan yang baik dan benar terutama dalam hal pengelolaan keuangan. Sehingga Pemprov, Pemkab, dan Pemko di Sumatera Utara, dapat meraih opini WTP dari BPK RI. Harapan ini diungkapkan Gubsu pada acara serah terima jabatan (Sertijab) Kepala Perwakilan Badan Pengawasan Keuangan dan Pembangunan

(BPKP) Provinsi Sumatera Utara dari Drs Bonny Anang Dwijanto kepada Mulyana Ak, di Ruang Martabe Kantor Gubsu, Rabu (5/2). Kata Gubsu, BPKP memiliki peran yang sangat strategis, sebab penyelenggaraan pemerintahan saat ini menghadapi tantangan yang berat seiring dengan semakin kuatnya tuntutan reformasi, ditambah lagi semakin kritisnya masyarakat dewasa ini. “Semoga pergantian pimpinan perwakilan BPKP Sumut kali ini tetap terus dapat me-

ningkatkan kerjasama yang telah terjalin baik. Saya optimis hal tersebut tetap terwujud,” ujar Gubsu. Sesuai dengan peraturan pemerintah nomor 23 tahun 2011 yang mengatur tata cara pelaksanaan tugas dan wewenang serta kedudukan Gubernur sebagi wakil pemerintah pusat di provinsi. Pada pasal 4 ayat (1) huruf I disebutkan bahwa gubernur sebagai wakil pemerintah memiliki wewenang melantik kepala instansi vertikal dari kementerian dan lembaga pemerintah non kementerian yang ditugaskan di wilayah provinsi yang bersangkutan.

“Untuk melaksanakan amanat peraturan pemerintah tersebut selaku Gubernur Sumatera Utara pada hari ini saya telah melantik Kepala Perwakilan BPKP Provinsi Sumut yang baru,” ujarnya. Gubsu mengucapkan terimakasih kepada Kepala Perwakilan BPKP Provinsi Sumut yang lama yakni Drs Bonny Anang Dwijanto yang telah mengabdikan diri untuk kemajuan masyarakat Sumut, terutama dalam hal pengawasan dan pembinaan pengelolan penyelenggaraan pemerintahan. Menurut Gubsu, di masa kepemimpinan Bonny Anang

Kuliner Khas Tapsel Ala Resto MEDAN (Waspada): Manajemen Rumah Makan Rangkuti II siap menyajikan menu masakan daerah khas Tapanuli SelatanMandailing Natal kepada para pengunjung yang menyinggahi rumah makan tersebut. Masakan khas daerah itu pun siap disajikan ala resto. “Selama ini banyak pengusaha rumah makan khas daerah Tapsel yang belum berani mengelola bisnis tersebut ala resto. Padahal, cita rasa masakan khas Tapsel-Madina sudah mendunia,” sebut manager marketing RM Rangkuti II Lutfi Faizalsyah Lubis di sela-sela peresmian RM Rangkuti II Jln. Medan-Tanjungmorawa Km 16,5, Rabu (5/2). Dijelaskan Faizalsyah, masakan khas Tapsel-Madina memiliki cita rasa tersendiri, bahkan penikmatnya tidak hanya dari etnis Mandailing saja, namun sudah menasional. Maka, wajar saja masakan khas Tapsel-Madina merupakan warisan pusaka kuliner yang harus dikelola secara modern. “Pengunjung yang datang usai bersantap, juga bisa menikmati secangkir kopi Mandili asal Pakantan. Konon, minuman kopi ini sudah mendunia,” ujar Lubis seraya mengatakan, pihaknya juga menyediakan kamar VIP di lantai II dan III plus jaringan wi fi. Acara peresmian rumah makan tersebut diawali dengan pembacaan tahtim tahlil, pemberian makanan dan santunan kepada sejumlah anak yatim, dihadiri oleh sejumlah tokoh masyarakat Kabupaten Deliserdang dan Sumatera Utara. Sembari menikmati makanan khas mandailing tersebut, para tetamu disuguhkan hiburan Gordang Sambilan dan manortor. (h04)

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho memberi ucapan selamat kepada Kepala Perwakilan BPKP Sumut yang baru Mulyana Ak, di Aula

Dwijanto telah terjalin kerjasama yang sangat baik antara per wakilan BPKP Sumut dengan Pemerintah Provinsi Sumut dan juga dengan pemerintah daerah kabupaten dan kota. Terbukti dengan adanya MoU BPKP RI dengan Pemerintah Provinsi Sumut tahun 2012 dalam hal pengembangan manajemen dalam mewujudkan pengelolaan keuangan yang lebih baik. Selain dengan provinsi, MoU serupa dilaksanakan BPKP perwakilan Sumut,

dengan pemerintah kabupatan dan kota di Sumatera Utara dalam hal yang sama. Dalam kesempatan itu, Gubsu juga mengucapkan selamat datang dan selamat bertugas kepada Kepala Perwakilan BPKP Provinsi Sumut yang baru yakni Mulyana Ak. Semoga kedepan hubungan kerjasama yang telah terjalin dengan baik antara perwakilan BPKP Sumut dengan Pemerintah Provinsi Sumut dan pemerintah kabupaten/ kota dapat lebih ditingkatkan lagi.(m28)

MEDAN (Waspada): Polda Sumut meringkus empat bandar narkoba dari lokasi berbeda, dengan mengamankan barang bukti 2 Kg sabu-sabu siap edar. Selain itu, polisi mengamankan barang bukti lain, seperti timbangan dan beberapa telepon genggam. Kabid Humas Poldasu Kombes Pol. Heru Prakoso, Rabu (5/ 2) mengatakan, petugas pada Senin (3/2), menangkap tiga bandar sabu-sabu yaitu Iw alias Aan, 32, warga Blok V Komplek Cemara Hijau, Kec. Percut Seituan, HH, 51, warga Jln. Selam I, Medan Denai. dan To alias Acai, 23, warga Jln. Besi, Medan Area. Mereka diringkus di kediaman tersangka Aan. Dari para tersangka, polisi mengamankan barang bukti 1 Kg sabu-sabu, 1 timbangan, dan 3 telepon genggam. “Penangkapan mereka tergolong sulit dan lebih dua minggu dilakukan penyelidikan,” kata Heru. Berdasarkan penyidikan, para tersangka memperoleh sabusabu dari seseorang berinisial T yang kini masuk dalam daftar pencarian orang (DPO). “Para tersangka mengaku membeli 1 Kg sabu-sabu seharga Rp640 juta, kemudian kembali dijual Rp650 juta,” sebutnya. Menurut Heru, tiga tersangka yang ditangkap termasuk bandar besar narkoba. Alasannya, para tersangka menjual narkoba itu per kilo, tidak pernah memecah atau mengecer sabu-sabu secara keterangan atau per gram. Selain tiga tersangka, Polda juga menangkap bandar narkoba lainnya yaitu D alias Aguan, 41, warga Jln. Kalimantan, Kec. Medan Kota, berikut barang bukti 1 Kg sabu-sabu. “Tersangka ditangkap di Hotel Sulthan kamar 129 kawasan Jln. Darussalam, Medan Petisah, akhir Desember lalu,” ujar Heru menyebutkan, dari tersangka diamankan barang bukti 1 Kg sabu-sabu yang telah dipisah dalam empat plastik dengan berat berbeda. Kata Heru, seluruh pelaku akan dijerat pasal 114 ayat (2) subs 112 ayat (2) UU nomor 35 tahun 2009 tentang Narkotika dengan ancaman minimal 5 tahun penjara.(m27)

Cendikiawan Diminta Beri Penyuluhan Tentang Lebah Madu MEDAN (Waspada): Ketua Iptek Perlebahan Sumut Drs. Moch. Achir Lubis berharap, cendikiawan maupun perguruan tinggi berperan aktif member penyuluhan dan pendidikan tentang lebah madu. Dengan demikian, kebutuhan akan madu yang layak dikonsumsi dapat terpenuhi. “Selain itu, jika masyarakat memiliki pengetahuan tentang lebah madu, maka saat melihat pohon berbunga dan nectar (zat cair manis) yang ada di dalam bunga, maka mereka akan berpikir itu sebagai penyembuh. Karena Nectar itulah yang diisap lebah dan kemudian jadi madu,” terang Achir pada seminar Building Tough Productive Ummah with Al-Quran and Honey di Jalan Tritura No 10 Medan, baru-baru ini. Sampai saat ini, Achir terus melakukan pendidikan serta penyuluhan tentang lebah madu. Bahkan sudah mengunjungi tempat-tempat yang berkemungkinan menambah cakrawala tentang lebah madu. “Sudah 23 tahun saya menekuni tentang lebah madu ini,” tambahnya. Dari hasil investigasi Achir Lubis ke berbagai hutan yang ada di KEL (Kawasan Ekosistem Leuser), Tanah Karo, Jambi, Riau dan sebagainya, maka satu pohon tualang (raja) sedikitnya terdapat 30 sarang lebah. Satu sarang lebah, sediktinya dapat menghasilkan 30 kg madu. Harga 1 kg madu mencapai Rp120 ribu. “Jadi, satu pohon tualang saja sedikitnya dapat dihasilkan 900 kg madu. Jika dikali Rp120 ribu, maka satu pohon tualang dapat menghasilkan Rp10,8 juta. Dalam setahun madu dapat dipanen dua kali. Berarti satu pohon tualang, dalam setahun dapat menghasilkan Rp21,6 juta secara terus-menerus. Belum lagi ramuan obat, buah-buahan dan sebagainya yang terdapat di hutan,” ungkapnya. Dia mengumpamakan,


DRS MOCH Achir Lubis memperlihatkan madu pada seminar Building Tough Productive Ummah with Al-Quran and Honey di Jln. Tritura No 10 Medan, baru-baru ini. hutan ibarat ayam bertelur emas. Jika pemilik ayam sabar, maka setiap hari akan memperoleh sebutir telur emas. Tetapi jika tidak sabar, lalu sang ayam dipotong, maka bencanalah yang didapat. “Jika semua orang tidak ingin sakit, apalagi lapar, maka hutan harus dikelola tanpa dirusak. Jika hasil hutan dapat diambil tanpa dirusak, maka triliunan rupiah dapat diselamatkan dalam sebulan,” tegasnya sembari menambahkan, jika masyarakat sudah terbiasa minum madu, niscaya akan memelihara hutan untuk pakan lebah. Ditambahkannya, madu merupakan obat yang berasal dari “apotek” Tuhan, sehingga komplikasi penyakit dapat disembuhkannya. “Misalnya, seseorang ingin mengobati penyakit diabetes. Dengan mengkonsumsi madu, maka penyakit yang lain seperti kurang vitalitas, lever dan lainnya ikut sembuh,” jelas Achir.(h02)

Medan Metropolitan


WASPADA Kamis 6 Februari 2014

Kompol Dony Alexander: Bentengi Pelajar Dari Narkoba

Waspada/ Rizky Rayanda

KASAT Res Narkoba Polresta Medan Kompol Dony Alexander memberikan penyuluhan Narkoba kepada pelajar SD di ruang Aula Kantor Lurah Kuala Bekala, Rabu


MEDAN (Waspada): Kasat Reserse Narkoba Polresta Medan meminta kepada para guru dan orangtua agar membentengi para pelajar sejak awal dari bahaya penyalahgunaan narkoba. “Dengan membentengi pelajar sejak awal dari bahaya narkoba, berarti kita telah menyelamatkan generasi muda bangsa,” kata Kompol Dony Alexander, Rabu (5/2). Hal itu disampaikan Kompol Dony saat memberikan penyuluhan tentang bahaya penyalahgunaan narkoba kepada 300 pelajar di tujuh Sekolah Dasar yakni SDN 060934, SDN 060937, SDN 060938, SDN 064033, SDN 060936, SDN 060935 dan SDN 060933 di aula kantor Kelurahan Kuala Bekala, Kec. Medan Johor. Dijelaskannya, pelajar kelas 6 SD termasuk rawan terpengaruh memakai narkoba. Sebab, bisa saja orang yang baru dikenalnya memberikan narkoba atau rokok yang sudah dicampur ganja. Lebih bahaya lagi kalau pelajar itu ikut menghirup lem yang dibeli dengan cara patungan dari uang jajan sekolah. “Makanya perlu pengawasan dari orangtua dan para guru di sekolah agar anak didiknya tidak terlibat dalam pergaulan yang sesat dengan memakai narkoba,” katanya. Dengan adanya penyuluhan sejak dini, diharapkan masa depan anak-anak terutama pelajar SD ini sesuai dengan harapan orangtua serta berguna bagi nusa dan bangsa. Dengan adanya pengawasan dan membentengi pelajar sejak dini dari bahaya penyalahgunaan narkoba serta kenakalan remaja, maka ribuan bahkan jutaan pelajar atau generasi bangsa bisa diselamatkan. Kompol Dony menjelaskan, dalam kasus ngelem ini, sudah ada pelajar yang terlibat. Karena itu, dengan adanya penyuluhan narkoba di tingkat SD ini, maka para pelajar menjadi lebih tahu tentang efek buruk pemakaiannya yang bisa berujung kepada kematian. “Kegiatan ini terselengara karena adanya permohonan dari pihak sekolah dan kelurahan agar para pelajar di kawasan Kuala Bekala tidak terlibat penyalahgunaan narkoba,” jelasnya. Ditanya wartawan tentang adanya stiker yang mengandung narkoba dan sudah masuk ke sekolah, Kompol Dony menjelaskan, informasi tersebut masih diselidiki. “Kita juga mengimbau

kepada seluruh pelajar SD agar tidak mudah percaya kepada orang yang baru dikenal dan menitipkan barang,” ujarnya. Sedangkan Kepala SDN 060937 K. Pinem mengatakan, pihaknya merasa puas atas informasi yang disampaikan Kasat Res Narkoba Polresta Medan tentang bahaya penyalahgunaan narkoba bagi pelajar. “Ide pertama program ini datang dari Kompol Dony dan kita respon sehingga kegiatan penyuluhan tersebut bisa terlaksana. Kegiatan ini sudah menjadi kebutuhan dan harus dilaksanakan secara berkesinambungan,” katanya. Pinem juga menjelaskan, ada empat materi yang disampaikan dalam penyuluhan ini. Yakni seks bebas, ngelem, narkoba dan geng kereta. “Ngelem yang saat ini harus kita waspadai. Sebab, banyak pengamen di persimpangan jalan yang bernyanyi sambil ngelem,” katanya. Jadi, lanjutnya, pihak sekolah berupaya memberi pelajaran serta penyuluhan kepada anak didik agar memperdalam ilmu agama dan diingatkan tentang bahaya penyalahgunaan narkoba. Sedangkan Lurah Kuala Bekala E. Surbakti mengucapkan terimakasih kepada Polresta Medan terutama Kasat Res Narkoba Kompol Dony Alexander.“Kita siap membantu Polri dalam memberantas peredaran gelap narkoba,” ujarnya. Saat memberikan penyuluhan, Kompol Dony menjelaskan tentang jenis-jenis narkoba mulai dari ganja, ekstasi, sabu, putaw dan lainnya. Dia juga menjelaskan tentang bahaya narkoba bila dikonsumsi karena dapat menyebabkan kematian. “Laporkan kepada orangtua dan polisi bila ada orang yang mencurigakan agar ditindaklanjuti,” katanya. Kemudian, Dony mengharapkan para orangtua dan guru agar dapat melihat bakat anak didiknya yang besifat positif. Dengan demikian, anak didik tersebut bisa dibina dan dibimbing sehingga mereka mempunyai aktivitas yang positif. Bangun kepribadian anak-anak dengan keimanan yang kokoh dan dekatkan diri kepada Tuhan Yang Maha Esa. Tingkatkan amal ibadah, hati bersih, bijaksana dan teladan serta mampu mengendalikan hawa nafsu dan harus punya citacita yang baik.(m39)

Soal Penyalahgunaan Narkoba Di Kalangan PNS

Pimpinan Instansi Harus Berlakukan Tes Urin MEDAN (Waspada): Peredaran dan penyalahgunaan narkoba di Sumut sudah berada pada tingkat serius. Karenanya, Ketua DPD Partai Golkar Sumut H. Ajib Shah, minta pimpinan lembaga dan instansi di daerah ini melakukan pengawasan dan memberlakukan tes urin terhadap seluruh PNS. Ajib Shah yang juga anggota DPRDSU ini mengaku terkejut membaca berita di media massa, Rabu (5/2). Katanya, peristiwa memilukan terjadi di daerah ini. Oknum Pegawai Negeri Sipil (PNS) Pemprovsu dan asisten dosen di Universitas Sumatera Utara (USU) ditangkap karena mencuri kaca spion dan uang-

nya digunakan untuk membeli narkoba. ‘’Ini sangat luar biasa dan memilukan hati kita. Bayangkan, peredaran narkoba sudah begitu merebak dan pengaruhnya luar biasa. Bayangkan, PNS dan dosen saja rela mencuri demi untuk membeli narkoba. Luar biasa,’’ kata Ajib Shah. Diberitakan sebelumnya, Minggu (2/2), polisi menangkap SN, 30, PNS di Pemprovsu dan MPM alias Fiqri, 23, asisten dosen di USU serta seorang teman mereka, di Jln. Karya Gang Ampera. Ketiga tersangka diamankan berikut barang bukti berupa empat kaca spion mobil dan uang Rp700 ribu dari hasil penjualan kaca spion sebelumnya. Ketiga tersangka mengaku men-

curi kaca spion untuk membeli narkoba. Ajib Shah menilai peristiwa ini membuktikan kalau peredaran narkoba sudah masuk ke seluruh sektor kehidupan masyarakat. Artinya, seluruh elemen harus komit memberantas peredaran gelap narkoba. “Tentu saja polisi sebagai penggerak utamanya,” katanya. Para pimpinan lembaga, menurut Ajib, harus peduli dengan masalah ini. Misalnya, menjadwalkan pemeriksaan urin secara rutin di instansi yang dipimpinnya. Baik itu di lembaga pemerintah, seperti Pemprovsu, Pemko dan Pemkab, institusi perguran tinggi, termasuk juga instansi swasta. Melihat kenyataan ini, kata Ajib mengaku sangat miris.Yang

dibayangkannya adalah narkoba tidak saja telah menyentuh mahasiswa, tapi juga dosennya sekaligus. “Ini menunjukkan kalau pemberantasan narkoba di Sumut sangat lemah. Tergambar kalau seluruh kawasan di daerah kita ini sudah ‘dikepung’ oleh narkoba,’’ katanya. Pemeriksaan urin secara mendadak harus dilakukan di seluruh instansi. Para pimpinan instansi harus mau melaksanakan kebijakan itu secara rutin. Bila menemukan ada pegawainya menggunakan narkoba, maka harus ditindak tegas. ‘’Seluruh instansi. Termasuk juga institusi kepolisian. Karena sangat mungkin juga banyak aparat yang menggunakan narkoba,’’ kata Ajib. Untuk masalah penyalah-

gunaan narkoba ini, Ajib Shah memuji cara yang dilakukan organisasi Pemuda Pancasila (PP). Katanya, di lembaga itu sudah diwajibkan tes urin kepada kadernya yang ingin menjadi ketua, mulai dari tingkat ranting. Bila hasil tes urin itu terdapat unsur narkoba, maka yang bersangkutan tidak akan diberi kesempatan maju. ‘’Untuk setingkat organisasi Pemuda Pancasila saja sudah melakukan itu. Paling tidak, itu bukti PP komit terhadap pemberantasan narkoba. Dan harusnya pengawasan yang lebih ketat lagi diberlakukan di instansi dan lembaga-lembaga lainnya. Disamping juga aparat kepolisian tidak main-main dalam memberantas narkoba ini,” demikian Ajib. (m12)

Ir H Abdullah Rasyid ME:

Petani Jangan Sampai Kelaparan Di Lumbung Padi MEDAN (Waspada): Staf Khusus Menteri Prekonomian Ir H. Abdullah Rasyid ME menyambut baik Kongres Serikat Petani Serdangbedagai (SPSB) ke-4 yang telah digelar di Pantai Cermin, baru-baru ini. Caleg DPR RI dari Partai Amanat Nasional (PAN) Dapil Sumut I, nomor urut 4 itu berharap kongres tersebut membawa harapan baru tentang kesejahteraan bagi kaum tani. “Kongres SPSB harus jadi momentum kebangkitan petani di Sergai. Petani jangan sampai kelaparan di lumbung padi. Karena logika akal sehat, harusnya petani yang menghasilkan kebutuhan bahan pokok bisa hidup sejahtera,” katanya. Dengan terpilihnya M. Yamin sebagai Ketua SPSB, Abdul-

lah Rasyid berharap adanya perubahan dan arah pembangunan yang lebih kongkrit terhadap nasib petani. Dengan demikian, tidak ada lagi petani yang menjadi buruh di negerinya sendiri. Menurutnya, butuh kerja keras dalam mengangkat dan mengembangkan nasib para petani agar lebih mandiri dan kuat. Kerja-kerja pendampingan yang dilakukan SPSB adalah faktor penting dalam mengubah nasib petani menjadi lebih baik. “Semoga SPSB ini dapat menjalankan fungsinya dalam memberdayakan kaum petani di Serdangbedagai. Jika petani berdaya, negara akan kuat dan rakyat sejahtera,” kata Tokoh Muda Melayu bergelar Pendekar Perguruan Pencak Silat Mer-

pati Putih Putera Muhammazdiyah itu. Sebelumnya, Kongres SPSB masa kepengurusan 2014 – 2017 berjalan lancar, dihadiri 250 anggota sebagai perwakilan dari 50 kelompok di delapan kecamatan yakni, Perbaungan, Penggajahan, Pantai Cermin, Serbajadi, Dolok Masihul, Sei Rampah, Tebingtinggi danTeluk Mengkudu. Kongres dengan tema Quovadis Kebijakan Petani ini juga dihadiriWakil Bupati Sergai Syahrianto, Direktur Eksekutif Bitra Indonesia Wahyudi dan beberapa pejabat pemerintah daerah mulai tingkat desa hingga kabupaten. Pada kesempatan itu, Wakil Bupati Syahrianto menekankan, SPSB harus berani mengambil sikap politik dan memiliki posisi

tawar sepadan terhadap kekuasaan. SPSB harus mengembangkan wilayah kerja hingga mencakup 17 kecamatan di Sergai serta fokus dalam upaya pemberdayaan kaum petani serta memelihara jaringan kerja sampai ke pusat. “Jangan malu-malu lagi untuk terjun dalam politik karena perjuangan gerakan rakyat pada akhirnya harus disampaikan melalui perwakilan di legislatif. Untuk DPRD Kabupaten Sergai mungkin sudah cukup, tinggal DPRD provinsi dan DPR RI yang harus ada cantolan petani,” ujar mantan Ketua KPU Sergai itu. Syahrianto mengharapkan SPSB agar lebih berani untuk memperjuangkan hak-hak

kaum petani. Agar lembaga tersebut dapat menjalankan fungisnya sebagai wadah bagi para petani dalam menyongsong perubahan nasib kaum petani yang lebih baik ke depan. Ketua SPSB M. Yamin menuturkan, petani harus memiliki pemikiran cerdas dalam pengembangan kapasitas diri. Petani harus mampu berinovasi dengan memanfaatkan lahan pertanian lebih produktif sehingga tidak seperti tikus yang mati di lumbung padi. “Petani tidak boleh berhenti berpikir dan bekerja, karena kemiskinan adalah neraka dunia bagi semua kaum petani. Petani harus bangkit, berani berinovasi dengan memaksimalkan lahan secara produktif,” ujar Yamin. (h03)

Dua Rumah Dan Sepedamotor Terbakar

Waspada/Rustam Effendi

KELUARGA korban kebakaran di Jln. Pancing I, Lingk.VII, Kel. Besar, Kec. Medan Labuhan, Rabu (5/2) siang, menyelamatkan barang berharga ke tempat yang lebih aman.

BELAWAN (Waspada): Dua unit rumah masing-masing dihuni Suriadarmi, 55, dan Jasril, 65, di Jln. Pancing I, Lingk. VII, Kel. Besar, Kec. Medan Labuhan, Rabu (5/2) siang, terbakar. Selain itu, dua sepedamotor yakni Yamah Mio dan RX King milik Jasri, juga ikut ludes terbakar. Sedangkan dalam peristiwa itu tidak ada korban jiwa, tetapi kerugian diperkirakan mencapai ratusan juta rupiah. Informasi dari lapangan menyebutkan, api pertama kali terlihat dari atas atap rumah milik Suriadarmi diduga bersumber dari hubungan arus pendek meteran listrik. Saat itu, Suriadarmi sedang masak di dapur hingga dia tidak mengetahui adanya api itu. Api yang membesar membuat warga heboh dan langsung menjerit kebakaran. Suriadarmi

langsung keluar rumah dan dibantu warga menyelamatkan sejumlah hartanya dan menyiramkan air seadanya untuk memadamkan api. Usaha warga memadamkan api tidak berhasil. Api yang membesar menyambar rumah milik Jasril (menantu Suriadarmi). Akibatnya, dua sepedamotor kereta milik Jasril ikut terbakar. Petugas pemadam kebakaran dari Belawan dan KIM datang ke lokasi memberi bantuan pemadaman. Akhirnya berselang sekitar satu jam api dapat dipadamkan. Kanit Reskrim Polsek Medan Labuhan AKP Kusnadi mengatakan, pihaknya sudah melakukan cek TKP dan untuk sementara diduga api berasal dari hubungan arus pendek. (h03)

Mencuri Spion Untuk Beli Narkoba

PNS Pemprovsu Terancam Dipecat MEDAN (Waspada): Oknum PNS Pemprovsu berinisial SN, 30, yang menjadi tersangka dalam kasus pencurian spion mobil untuk membeli narkoba, terancam sanksi pemecatan. “PNS yang ditahan sementara oleh pihak berwajip karena diduga melakukan tindak pidana, baik yang ada hubungannya dengan tugas jabatan sebagai PNS maupun yang tidak ada hubungannya, harus diberhentikan sementara dari jabatan organiknya sebagai PNS,” kata Kepala BKD Provsu Pandapotan Siregar menjawab wartawan, Rabu (5/2). Pandapotan menilai aksi yang dilakukan oknum PNS tersebut sangat memalukan dan mencoreng citra PNS. “Kejadian ini sangat memalukan. Kasus pencurian banyak, namun karena PNS yang melakukannya, tentu sangat memalukan. Sebab dia berbaju PNS,” ujarnya. Pandapotan mengharapkan kasus yang menimpa SN menjadi pelajaran bagi para PNS lainnya agar selalu menaati peraturan. Status SN sebagai PNS terancam diberhentikan apabila yang bersangkutan telah dihukum penjara berdasarkan putusan pengadilan yang berkekuatan hukum tetap. Berdasarkan UU Nomor 8 tahun 1974 tentang Pokok-pokok Kepegawaian sebagaimana yang diubah dengan UU Nomor 43 tahun 1999 dengan tegas menyatakan, PNS dapat diberikan sanksi pemberhentian karena dihukum penjara berdasarkan putusan pengadilan yang mempunyai

kekuatan hukum tetap karena melakukan tindak pidana kejahatan yang ancaman hukumannya empat tahun lebih. Pandapotan mengatakan, untuk sanksi pemberhentian sementara, pihaknya menunggu surat dari kepala SKPD terkait. Saat ditanya tentang rekam jejak SN selama bertugas sebagai staf di Sekretariat Daerah Provinsi Sumatera Utara, Kepala BKD Provsu mengaku belum pernah mendapat laporan. “Selama ini kami belum pernah mendapat laporan dari Biro Umum sebagai pembina kepegawaian,” tuturnya. Di tempat terpisah, Kabag Humas Universitas Sumatera Utara Bisru Hafi mengatakan, pihaknya belum bisa memastikan apakah MFM alias Fikri yang menjadi tersangka kasus pencurian spion mobil, merupakan PNS di lingkungan USU. “Kami masih meragukan pengakuan tersangka. Sebab setelah kami cek ke sejumlah program studi (prodi) di fakultas, ternyata tidak ada asisten dosen berinisial MFM,” ungkap Bisru. Kendati demikian, pihaknya terus melacak status tersangka di USU. Jika memang benar asisten dosen, maka MFM akan diberi sanksi administrasi sesuai UU Kepegawaian. “Sanksi tegas pasti diberikan, sanksi terburuk mungkin dikeluarkan dari USU. Pada prinsipnya tindakan tersangka sangat tidak terpuji dan sangat memalukan bagi dunia pendidikan, apalagi dia mengaku sebagai asisten dosen,” tegas Bisru. (m28/m49)

LPMP: Profesi Guru Bukan Panggilan Ekonomi MEDAN ( Waspada): Kepala Lembaga Penjamin Mutu Pendidikan (LPMP) Sumut Drs. H. Bambang Winarji menegaskan, profesi guru merupakan panggilan jiwa, bukan panggilan ekonomi. Karena itu, kurikulum 2013 ini akan mengembalikan guru-guru serta kepala sekolah kepada kesejatiannya. Hal itu dikatakan Bambang Winarji saat menerima audiensi Pimpinan BT/BS BIMA Indonesia dr. RobertValentino Tarigan, SPd, SH bersama Kepala Sekolah BPNM 1 Dra. Adelina Silaen, MPd di Jln. Bunga Raya No. 96 Asam Kumbang Medan, Rabu (29/1). Dijelaskannya, kurikulum 2013 akan diberlakukan efektif pada Juli 2014. Dalam hal ini, instruktur nasional akan mendiklat guru-guru dan kepala sekolah. “Ada tiga komponen dasar yang disajikan dalam diklat tersebut. Yakni kognitif, knowledge dan attitude. Dana untuk itu dari pemerintah,” terangnya didampingi Staf LPMP Benamuli S. Sementara itu, Robert Valentino yang juga

Ketua Bidang Pendidikan Perguruan Nasrani (BPNM) Medan mengatakan, tujuannya beraudiensi agar semua guru dan kepala sekolah di bawah naungan BPNM dapat dilatih untuk menerapkan Kurikulum 2013. “Sebab, guru itu bukan orang yang sekadar tahu, tetapi paham. Sehingga dapat menjelaskan apa-apa tuntutan Kurikulum 2013 kepada siswasiswinya,” tegas Valentino. Menjawab hal itu, Bambang mengemukakan, keinginan tersebut dapat dilaksanakan lewat Diklat pendampingan oleh yayasan bekerjasama dengan LPMP. Perlunya para guru dan kepala sekolah didiklat karena yang memberikan senyum hangat ke siswa adalah guru, bukan komputer. “Misalnya, bagaimana menerapkan agar guru memberikan senyum hangat ke siswa dan tidak boleh marah. Guru mau menerima jabat tangan siswa. Manfaatnya, siswa merasakan betapa guruguru lebih memperhatikan dirinya,” tambah Bambang. (h02)


PIMPINAN BT/BS BIMA dr RobertValentino Tarigan, SPd, SH (kiri) memberikan cenderamata kepada Ketua LPMP Sumut Drs. H Bambang Winarji, MPd, Rabu (29/1).

Medan Metropolitan

WASPADA Kamis 6 Februari 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-804 20. Pekanbaru GA-276 21. Tanjungkarang GA-270

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 07.15 09.40 17.10 06.00 17.40 09.30 14.20 10.35 10.55 06.00 12.35

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-805 GA-277 GA-271

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 09.50 12.35 19.45 09.55 21.35 12.50 20.45 16.25 13.20 08.45 20.10

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55





MANDALA AIRLINE 1 Singapura RI-861

Tiba Dari



WN Malaysia Dirampok MEDAN (Waspada): Warga Negara (WN) Malaysia yang menumpang becak bermotor (betor) dirampok dua pelaku mengendarai sepedamotor dekat Komplek Tomang Elok Jln. Gatot Subroto Medan, Rabu (5/2) siang. Informasi Waspada peroleh di lapangan, korban Abdul Rahman, 58, bersama istrinya Inem Binti Sakiman, 55, dan anaknya Nurfadilah, penduduk Jln. Klang Puncung, Batu XIII, Selangor, Malaysia, berada di Medan hendak pergi menjenguk mertuanya (ayah istrinya) yang sakit di Binjai. Siang itu Abdul Rahman bersama keluarganya menumpang betor yang dikemudikan Asron Sianturi dari Carefour Medan Fair Plaza hendak menuju ke hotel Saka Jln. Ringroad, Medan Sunggal. Setiba di depan Komplek Tomang Elok, tas korban dirampok dua pelaku mengendarai sepedamotor. Akibatnya, korban menderita kerugian tas berisikan paspor, uang Rp1.400.

000, uang ringgit, tiket pesawat pulang pergi (PP), dan surat berharga lainnya. Selanjutnya, pengemudi betor membawa korban ke Polsek Sunggal membuat laporan pengaduan. Karena korban Warga Negara Asing (WNA), petugas Polsek Sunggal membawa mereka ke Polresta Medan untuk membuat pengaduan seputar kejadian tersebut. Abdul Rahman kepada Waspada mengatakan, usai berhasil mengambil tas mereka, kedua pelaku langsung kabur. “Tas yang diambil pelaku berisikan dekumen, uang dan lainnya. Kami datang ke Medan untuk melihat mertua yang sakit di Binjai. Rencana balik ke Malaysia, Jumat (7/2),” kata Abdul Rahman sembari memohon kepada polisi agar mengemudi betor diperiksa karena diduga mengetahui kejadian tersebut. Kanit Reskrim Polsek Sunggal Iptu Adhi Putranto Utomo SH, ketika dikonfirmasi membenarkan adanya WN Malaysia yang menjadi korban perampokan. (m36) Waspada/Ismanto Ismail

Korban Pengeroyokan Minta Polisi Tindaklanjuti Pengaduannya Pencuri Di Pusat Pasar Diringkus

WN MALAYSIA Abdul Rahman (pakai topi pet) menuntun istrinya Inem Binti Sakiman didampingi petugas Polsek Sunggal, untuk dibawa ke Polresta Medan membuat laporan pengaduan.

MEDAN (Waspada): Merasa laporannya tidak ditanggapi polisi, Antoni Situmorang, 45, warga Jln. Raya Menteng No. 247, Kel. Binjai, Kec. Medan Denai mendatangi Polresta Medan, Selasa (4/2) sore. Dia menyayangkan lambannya kinerja polisi dalam menangkap pelaku pengeroyokan terhadap dirinya. Kepada Waspada, Antoni mengaku dikeroyok sekitar 40 orang di depan anak dan istrinya saat berada di rumahnya.“Peristiwa itu terjadi pada 1 Juli 2003. Saat itu, aku sedang bersama anak dan istriku di rumah. Tibatiba datang sekelompok orang membawa senjata tajam dan langsung memukuliku,” tutur Antoni. Antoni menceritakan, pengeroyokan itu bermula karena dirinya tidak mau menjual tanah yang terletak di Jln. Jermal

XV Medan Denai kepada salah seorang temannya. “Aku sempat dibujuk dengan imingiming uang ratusan juta. Karena dia mendesak terus, akhirnya kujual kepadanya. Namun, entah apa sebab, tiba-tiba saja, TS (terlapor) datang dengan teman-temannya dan langsung mengeroyokku.” ujar Antoni. Setelah dikeroyok, Antoni langsung dinaikkan ke dalam mobil dan dibawa kabur. Selama di dalam mobil, Antoni dianiaya hingga lengan kirinya patah. Untung saja, saat mobil berhenti dan sopir menerima panggilan telepon, Antoni langsung lompat sembari berteriak minta tolong. Dalam kondisi tubuh lemah, Antoni dibawa pihak keluarga ke rumah sakit. Sedangkan istrinya, Dumasari boru Nainggolan membuat

pengaduan ke Polresta Medan dengan bukti STTLP/1765/K/ VII/2003/RESTA MEDAN dan diterima oleh Kanit SPKT ‘A’ Ipda J. Sitanggang. Namun, Antoni merasa terpuruk, karena pihak terlapor malah melaporkannya ke Polresta Medan dengan tuduhan penggelapan dan penipuan. “Laporanku belum diproses dengan tuntas, bahkan kini aku malah dilaporkan oleh terlapor. Aku berharap polisi berlaku adil,” ucapnya. Di tempat terpisah, Kasat Reskrim Polresta Medan, Kompol Jean Calvijn Simanjuntak mengatakan, pihaknya segera memanggil Kanit yang menangani kasus itu. “Sudah lama ya, mengapa belum diproses. Nanti saya tanyakan kepada Kanit terkait perkembangan kasusnya,” ujar Kompol Calvijn. (h04)

Nama KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A









RANTAU P 07.47 RANTAU P 10.17 RANTAU P 15.44 RANTAU P 23.03 MEDAN 07.52 MEDAN 14.58 MEDAN 17.18 MEDAN 23.13 MEDAN 08.08 SIANTAR 14.30 MEDAN 07.50 TANJUNG 06.49 MEDAN 13.06 TANJUNG B 13.11 MEDAN 19.36 TANJUNG B 17.33 MEDAN 05.42 TEBING TINGGI 18.44 MEDAN 05.46 BINJAI 05.02 MEDAN 07.14 BINJAI 06.30 MEDAN 09.15 BINJAI 08.30 MEDAN 12.18 BINJAI 10.00 MEDAN 13.53 BINJAI 13.09 MEDAN 16.49 BINJAI 14.37 MEDAN 19.00 BINJAI 18.16 MEDAN 21.40 BINJAI 20.56

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA



Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

MEDAN (Waspada): Seorang pria yang diduga kerap melakukan pencurian di kios-kios Pusat Pasar Medan, Selasa (4/2) sore, diringkus petugas jaga malam. Pria berinisial Ra, 30, warga Jln Mesjid, Desa Medan Estate, Kec Percut Seituan itu, selanjutnya diserahkan ke Polsek Medan Kota. J. Simanjuntak, seorang petugas keamanan Pusat Pasar menjelaskan, penangkapan terhadap tersangka pencurian itu berawal ketika seorang petugas kebersihan memergokinya di lantai 2 dan berteriak. Mendengar teriakan tersebut, Simanjuntak mengejar pelaku yang berlari sembari membawa tas. Pelaku sempat melompat ke bawah dan membuang tas yang dibawanya. “Kukejar pria tersebut. Ketika hendak kutangkap, dia lompat ke bawah dan membuang tas,” jelas Simanjuntak. Tak mau buruannya kabur, Simanjuntak ikut melompat. Akibatnya, Simanjuntak mengalami cedera pada kakinya. Petugas jaga malam lainnya yang melihat tersangka kabur segera mengepung hingga berhasil menangkapnya. Ketika diinterogasi, awalnya Ra sempat membantah melakukan pencurian. Namun setelah dihadirkan beberapa saksi yang melihat Ra

berkeliling di lantai 2, tersangka tidak berkutik lagi. “Memang dia pelakunya. Jelas dia kulihat mondar-mandir bawa tas di atas,” kata Samsiah, 34, saksi yang melihat tersangka. Setelah itu, tersangka Ra diboyong ke Polsek Medan Kota bersama barang bukti tiga bola lampu hasil curian. Penangkapan ini disambut positif oleh Kepala Pasar Pusat Pasar. “Yang menangkap pencuri itu petugas jaga malam. Jadi, kami dan seluruh pedagang mengucapkan terimakasih atas kesigapan petugas jaga malam pasar,” kata J. Lumbantoruan, Kepala Pasar Pusat Pasar Medan. Seorang pedagang, Jabat Muda menuturkan, aksi pencurian sudah sering terjadi di Pusat Pasar, namun pelaku tidak pernah tertangkap. “Kita berharap kepolisian mengusut kasus ini dan memproses tersangka karena selama ini kasus pencurian tidak pernah terungkap,” ujar Jabat Muda. Sementara itu, Kanit Reskrim Polsek Medan Kota AKP Faidir Chan menjelaskan, pelaku pencurian tersebut masih menjalani pemeriksaan. Sedangkan korbannya sudah membuat laporan pengaduan. (h04)

Satgas Joko Tingkir Audiensi Ke Dandim 0201 BS

Jadwal Perjalanan Kereta Api No KA



SEKRETARIS Komisi C DPRD Sumut Sonny Firdaus SH, mengomentari turunnya dana perimbangan bagi hasil pajak dalam rapat kerja Komisi C dengan Dispendasu, di ruang dewan, Rabu (5/2).

Dispendasu Harus Dongkrak PAD MEDAN (Waspada): Komisi C DPRD Sumut dalam rapat kerja dengan Dinas Pendapatan Daerah Sumatera Utara (Dispendasu), meminta Kadis Pendapatan Sumut H Rajali SSos, MSP, dan jajarannya agar dapat mendongkrak kinerjanya dalam upaya pencapaian target estimasi penerimaan pajak daerah dan sumber pendapatan lainnya sepanjang tahun 2014 ini. Rapat yang dipimpin Ketua Komisi C DPRD Sumut H Isma Padli Atya Pulungan SAg, SH, MH, dan Sekretaris Sonny Firdaus SH, di ruang dewan, Rabu (5/2), mendengarkan paparan Kadispendasu mengenai PAD Provinsi Sumut tahun 2014 dan diproyeksikan akan mencapai Rp4,9 triliun atau naik 2,81% dari tahun 2013. “Porsi terbesar penyumbang untuk PAD tersebut adalah pajak daerah yang mencapai Rp4,5 triliun, termasuk pajak rokok yang diproyeksikan mencapai Rp500 miliar untuk tahun 2014,” kata Rajali didampingi jajaran pejabat eselon III dan IV Dispendasu di antaranya Kabid PKB Dr Victor Lumbanraja, Kabid Bangdal H Guntur Hasibuan, Kabid APU Rita Mestika,

Ka UPT Muhammadin Lubis, dan lainnya. Seusai pemaparan tersebut, anggota Komisi C DPRD Sumut Tohonan Silalahi SE, MM, mempertanyakan proyeksi perolehan pajak daerah tersebut. Karena, menurut dia, bukan meningkat malah sebaliknya menurun drastis. Pasalnya, dari data yang diberikan Kadispenda kepada Komisi C DPRD Sumut, struktur pendapatan dari sektor pajak daerah tahun 2013 adalah hampir mencapai Rp4,3 triliun tanpa adanya pajak rokok yang angkanya mencapai Rp500 miliar. “Mengapa di tahun 2014, jika dikurangi pajak rokok Rp500 miliar malah sektor pajak daerah turun hingga di bawah Rp4 triliun ?” sebutnya. Sementara itu, Sekretaris Komisi C DPRD Sumut Sonny Firdaus SH, mempertanyakan turunnya dana bagi hasil pajak yang tercantum dalam pos dana perimbangan hingga Rp232 miliar dibanding tahun 2013. Padahal, kata Sonny, dari kebijakan Dirjen Pajak yang memberlakukan PKP 1% dari penghasilan, semestinya pendapatan pajak meningkat tajam

dan setiap individu yang telah berpenghasilan lebih dari Rp24 juta per tahun seharusnya menjadi wajib pajak dengan diberikan NPWP kepadanya. Sonny meminta Kadispendasu untuk memulai program tokoh panutan wajib pajak dari kalangan Dispenda Sumut sendiri. “Coba dicek apakah seluruh jajaran Dispendasu yang berpenghasilan lebih dari Rp24 juta/tahun itu sudah atau belum memiliki NPWP ?” ujarnya. Ketua Komisi C DPRD Sumut H Isma Padli Arya Pulungan dalam menyimpulkan hasil rapat kerja tersebut, merekomendasikan dibentuknya Tim Mapping Komisi C DPRD Sumut untuk mendata dan tabulasi pajak bahan bakar dari seluruh perusahaan distributor bahan bakar yang beroperasionaldiSumateraUtara. Selain itu, Isma meminta agar Kadispenda Sumut dan jajarannya dapat mengejar kembali angka pendapatan daerah seperti tunggakan pajak kendaraan bermotor, pajak air permukaan, bea balik nama kendaraan bermotor yang porsi pencapaiannya sepanjang tahun 2013 tidak begitu menggembirakan. (m22)

MEDAN (Waspada): Pengurus Daerah (PD) Satgas Ormas Joko Tingkir Kota Medan beraudiensi ke Kodim 0201 BS Jln. Pengadilan Medan, Rabu (5/2). Rombongan yang dipimpin Ketua PD Satgas Joko Tingkir Medan Irsyadanur diterima oleh Dandim 0201 BS Letkol Inf Hendriyadi. Audiensi itu bermaksud untuk bersilaturahmi dengan Dandim 0201 BS selaku Pembina Satgas Joko Tingkir, sekaligus mengajak dan mengundangnya hadir pada HUT ke 8 tahun Joko Tingkir dan Pelantikan Satgas Ormas Joko Tingkir Kota Medan di Asrama Haji Medan, Minggu (16/ 2) mendatang. “Kami ingin memperkenalkan diri dan mengundang bapak pada HUT dan pelantikan Joko Tingkir se-kota Medan,” kata Irsyadanur. Pada kegiatan itu nanti akan dihadiri Ketua Umum Joko Tingkir Mayjen TNI (Purn) Lintang Waluyo, Ketua Pembina Pusat Jend TNI (Purn) Endiartono Sutarto, Jend TNI (Purn) Pramono EdhieWibowo, Ketua Umum Sumut Sukirmanto, Pembina Sumut H Ngogesa Sitepu, dan Ibrahim Sakti Batubara. Irsyadanur bersama pengurus daerah lainnya meminta arahan atau masukan kepada Letkol Inf Hendriyadi. Menanggapi hal ini, Hendriyadi mengaku senang dengan adanya organisasi kepemudaan dan masyarakat, termasuk Satgas Joko

Tingkir ini. “Karena ormas dan organisasi kepemudaan yang terorganisir merupakan komponen pendukung pertahanan negara untuk menggandakan kekuatan negara,” ujarnya. Oleh karena itu, Dandim meminta Satgas Joko Tingkir untuk mewaspadai efek global seperti pengaruh narkoba, pornografi, dan lainnya yang bisa merusak moral dan mental anak bangsa. “Jaga anak-anak kita dari pengaruh global yang bisa merusak mental bangsa kita,” sebutnya. Hendriyadi berharap agar PD Joko Tingkir menjaga soliditas dan jangan terpengaruh halhal negatif. “Mau menerima saran dan masukan dari orang lain dan jaga kerukunan serta silaturahmi dengan organisasi lain. Karena silaturahmi kunci sukses kita di dunia,” tuturnya sembari meminta Joko Tingkir ikut membantu menjaga keamanan dan ketertiban menjelang pesta demokrasi ini. Dalam kesempatan itu, Irsyadanur mengaku siap mendukung tugas TNI untuk menjaga keamanan dan ketertiban. “Kehadiran kita untuk mendukung program pemerintah dan ikut bekerjasama dengan seluruh masyarakat,” katanya. Hadir pada audiensi itu, Sekretaris PD Ormas Satgas Joko Tingkir Medan Eri Darma Putra,Wakil Ketua I A Rusdi Rahman, Sekretaris Panitia Kegiatan ErnadiWibisono, dan Penasehat Andi Mulya. (h02)

Waspada/Mursal AI

KETUA PD Satgas Joko Tingkir Medan Irsyadanur (dua kanan) menyerahkan baju Satgas Joko Tingkir kepada Dandim Letkol Inf Hendriyadi, di Makodim 0201 BS Jln. Pengadilan Medan, Rabu (5/2).


Medan Metropolitan

WASPADA Kamis 6 Februari 2014

Dugaan Korupsi Rp4,8 M

Mantan Kepala Dan Bendahara Satpol PP Segera Disidangkan

Waspada/Andi Aria Tirtayasa

KETUA TPM Medan Mahmud Irsad Lubis SH menceritakan kronologis kasus penembakan gas air mata ke dalam Masjid Taqwa Polonia dan tindakan kekerasan yang dilakukan sejumlah aparat kepolisian terhadap Ustadz KH Zulkarnain kepada Edy Syahputra Hasibuan dan Logan Siagian dari Kompolnas di lahan FPTRABK Kel Sei Mati, Kec Medan Labuhan, Selasa (4/2).

Soal Tembakan Gas Air Mata Dan Penganiayaan Ustadz Zulkarnain

TPM Mengadu Ke Kompolnas MEDAN (Waspada): Tim Pengacara Muslim (TPM) Medan mengadu kepada dua anggota Kompolnas Edy Syahputra Hasibuan dan Logan Siagian di Medan, Selasa (4/2), terkait tembakan gas air mata terhadap jamaah Masjid Taqwa Polonia dan penganiayaan Ustadz KH. Zulkarnain.

Al-Ittihadiyah Peringati Maulid Nabi Dan HUT Ke-79 MEDAN (Waspada): Dalam rangka kegiatan HUT ke-79, DPC Al-Ittihadiyah Kota Medan akan mengadakan peringatan Maulid Nabi Muhammad SAW, di Wisma PHI Jln. Gatot Subroto Km 6,2 No.227 Medan, Minggu (9/2) mendatang. “Acara yang direncanakan mulai pukul 08:30 s/d 18:00 ini akan dihadiri Wali Kota Medan, Kakan Kemenag Medan, seluruh warga Al-Ittihadiyah kota Medan, tokoh masyarakat, dan tokoh pemuda,” ujar Ketua Panitia HUT Dra Hj Nurhayati Zain MPd, didampingi Sekretaris Muslim Abdurrahman MA, dan Ketua Al-Ittihadiyah Kota Medan H Nuruddin Rangkuti BA, Rabu (5/2). Sementara itu, Sekretaris Muslim Abdurrahman menjelaskan, peringatan HUT Al-Ittihadiyah kali ini bertemakan “Merajut ukhuwah memupuk silaturahmi demi mewujudkan visi dan misi Al-Ittihadiyah dalam memperjuangkan aspirasi umat Islam.” “Acara ini dirangkaikan peringatan Maulid Nabi Muhammad SAW dengan tausiyah akan disampaikan oleh HT Zulkarnein, salah satu tokoh Al-Ittihadiyah dari Jakarta. Selain itu juga diadakan Muscab Al-Ittihadiyah kota Medan,” sebutnya. Ketua Al-Ittihadiyah Kota Medan Nuruddin Rangkuti mengimbau seluruh warga Al-Ittihadiyah agar dapat hadir dalam acara tabligh akbar tersebut, hal ini sangat penting untuk merajut dan memupuk silaturahmi antar warga Al-Ittihadiyah demi mewujudkan visi dan misi sebagai salah satu organisasi dakwah. Dia berharap segar seluruh Dewan Pengurus Anak Cabang (DPAC) Al-Ittihadiyah yang ada di 21 kecamatan agar berperan aktif menyukseskan Muscab untuk menentukan arah organisasi ini lima tahun kedepan. (cwan)

Pengedar Ganja Ditangkap MEDAN (Waspada): Seorang ibu rumahtangga berinisial FH, 55, warga Jln. M Yusuf, Desa Percut, Kec. Percut Seituan ini, yang menjual ganja kering di sekitar tempat tinggalnya diringkus petugas Reskrim Polsek Percut Seituan, Rabu (5/2). Informasi yang diperoleh di kepolisian, tersangka FH ditangkap petugas di satu warung depan rumahnya. Saat petugas masuk ke dalam warung, tersangka mengira polisi berpakaian preman tersebut hendak membeli rokok. Setelah berada di sampingnya, polisi langsung menciduk FH. Ternyata, dari pakaian yang dikenakannya, polisi menemukan 1 amplop daun ganja kering yang siap diedarkan. Tersangka FH kepada petugas mengaku, selama ini di sekitar rumahnya banyak orang berjualan ganja sehingga dirinya terpengaruh, apalagi suaminya sedang mendekam dalam penjara. “ Anak-anak muda di sini banyak yang jual ganja pak, jadi saya terpengaruh. Apalagi, anak saya butuh uang kuliah,” sebutnya. Dijelaskan FH, dirinya melakukan jual beli ganja sejak setahun lalu. Bahkan, dia menyediakan tempat berjualan ganja di rumahnya. “Memang orang itu sering ngisap ganja di rumah saya. Saya cuma kasih tempat aja,” katanya. Terpisah, Kanit Reskrim Polsek Percut Seituan AKP Zulkifli Harahap ketika dikonfirmasi di ruang kerjanya membenarkan penangkapan ibu rumahtangga tersebut. “Dia (FH) pengedar ganja dan ditangkap Rabu sekira pukul 08:00,” ujarnya. (h04)

Pengaduan kepada Komisi Kepolisian Nasional (Kompolnas) dilakukan karena hingga kini tidak ada tindaklanjut proses hukum atas kasus tersebut meski sudah dilaporkan kepada Kapoldasu dan Kapolri. Ketua TPM Medan Mahmud Irsad Lubis, SH didampingi Ustadz Indra Suheiri mewakili jamaah Masjid Taqwa Polonia Medan dan Ustadz Zulkarnain menuturkan, pihaknya sudah melaporkan kasus penembakan gas air mata yang dilakukan sejumlah petugas kepolisian terhadap massa Aliansi Ormas Islam Sumatera Utara Pembela Masjid dan jamaah Masjid Taqwa. Peristiwa itu terjadi saat berlangsung unjukrasa menuntut perubuhan gedung parkir Hotel Hermes yang lokasinya berdampingan dengan masjid tersebut, beberapa bulan lalu. “Ada bukti berupa 100 selongsongan peluru gas air mata yang ditembakkan ke dalam masjid. Akibat tembakan gas air mata tersebut, banyak warga, anak-anak, kaum ibu yang

pingsan. Hingga sekarang, pengaduan tersebut tidak ada tindaklanjutnya,” ujar Ustadz Indra Suheiri. Mahmud Irsad Lubis menambahkan, nasib yang sama juga dialami Ustadz KH Zulkarnain bersama seratusan warga yang tergabung dalam Forum Perjuangan Tanah Rakyat Asli Batang Kilat (FPTRABK). Pada 18 Desember 2013, Ustadz KH Zulkarnain dan warga yang tergabung dalam Kelompok Tani FPTRABK melaksanakan doa dan zikir di lahan Batang Kilat/Seruwei, Kel Sei Mati, Kec Medan Labuhan. Tiba-tiba sejumlah personel Brimob membubarkan kegiatan itu secara paksa. Seratusan warga dipukuli dengan pentungan dan tameng. Bahkan Ustadz KH Zulkarnain dan anaknya Zakwan diseret serta dipukuli. “Ustadz KH Zulkarnain, anaknya serta seratusan warga dari Kelompok Tani FPTRABK dianiaya hingga menderita lukaluka. Kami sudah mengirimkan surat pengaduan kepada Kapol-

dasu dan Kapolri atas tindakan sewenang-wenang dari aparat kepolisian terhadap masyarakat. Namun, hingga kini tidak ada tindaklanjutnya,” tegas Mahmud. Karena itu, tambah Mahmud, pihaknya berharap Kompolnas dapat membantu proses hukum atas pengaduan tersebut. Sementara itu, Komisioner Kompolnas Edy Syahputra Hasibuan mengatakan, pihaknya segera menemui Kapoldasu dan Kapolri untuk mempercepat tindaklanjut pengaduan dari Tim Pengacara Muslim agar kasus ini segera diselesaikan. “Kami segera menemui Kapoldasu dan Kapolri agar masalah ini menjadi perhatian khusus demi tercapainya kepastian hukum,” ujar Edy. Pada kesempatan itu, kedua komisioner Kompolnas tersebut menyaksikan rekaman film peristiwa penembakan gas air mata ke Masjid Taqwa Polonia. Setelah itu, Ketua TPM Mahmud Irsad Lubis menyerahkan CD rekaman tersebut kepada Edy Syahputra Hasibuan. (h04)

Kejari Belawan Tetapkan PPATK Dinas Bina Marga Jadi Tersangka BELAWAN (Waspada): Kejaksaan Negeri (Kejari) Belawan menetapkan dua pejabat pelaksana teknis kerja (PPTK) Dinas Bina Marga Kota Medan berinisial JS dan AM sebagai tersangka dugaan memanipulasi kontrak kerja dan besaran dana proyek pembangunan drainase di Medan Utara yang bersumber dari APBD tahun 2012. Kasi Intelijen Kejari Belawan Novan Hadian SH, Senin (3/1) mengatakan, pihaknya telah melakukan pemeriksaan dua proyek pembangunan drainase di Kec. Medan Deli, yang nilai proyek Rp2 miliar yakni pembangunan drainase di sisi rel kawasan Kel. Titipapan dan di parit Belaga Besi Kel. Tanjung Mulia. Novan didampingi Kasi Pidsus Haris Hasbullah menjelaskan, pihaknya juga telah meme-

riksa empat orang saksi, di antaranya ketua perencana proyek dan dua orang pejabat yang merupakan Kuasa Pemengang Anggaran (KPA). “Total nilai dana yang diduga diselewengkan kedua tersangka masih dalam pemeriksaan dan keduanya belum ditahan karena dinilai masih kooperatif,” katanya. Ditanya tentang kemungkinan akan dilakukan pemanggilan terhadap Kadis Bina Marga Kota Medan, Novan menyebutkan, kemungkinan ke arah itu ada. Namun, masih menunggu hasil pemeriksaan tim Pidsus. “Kita masih melakukan pemeriksaan lebih mendalam agar semua pihak yang terlibat bisa terungkap,” sebut Novan bersama Tim Pidsus Imam Nulhakim. Sementara itu, Ketua Prese-

dium Masyarakat Medan Utara Syaharuddin memberi apresiasi kepada Kejari Belawan yang terus memberantas korupsi di jajaran Pemko Medan. “Kinerja ini mesti kita beri apresiasi, namun kami berharap perkaranya jangan mengambang seperti beberapa kasus sebelumnya yang sampai sekarang belum sampai ke persidangan,” tuturnya. Harapan yang sama dikatakan Rizaldi Gultom, salah sorang pemerhati sosial Kota Medan. Dia berharap Kejari Belawan tetap serius menangani kasus korupsi yang semakin marak. “Ini bisa menjadi pelajaran ke dinas yang ada di Pemko Medan, agar jangan coba-coba mengkorupsi uang rakyat dengan alasan apapun,” katanya. (h03)

MEDAN (Waspada): Penyidik Kejaksaan Negeri (Kejari) Medan melimpahkan berkas perkara dugaan korupsi pengelolaan anggaran langsung dan tidak langsung pada tahun anggaran (TA) 2012 di Satuan Polisi Pamong Praja (Satpol PP) Sumatera Utara sebesar Rp4,8 miliar ke Pengadilan Negeri (PN) Medan. “Dengan pelimpahan tersebut, mantan Kepala Satuan Polisi (Satpol) PP Pemprov Sumut Anggiat Hutagalung dan Bendahara Paian Sipahutar akan disidangkan di Pengadilan Tindak Pidana Korupsi (Tipikor) Pengadilan Negeri Medan,” ujar Kasi Penerangan Hukum (Kasipenkum) Kejaksaan Tinggi Sumatera Utara (Kejatisu) Chandra Purnama, di Medan, Selasa (4/2). Pelimpahan berkas perkara tersebut pada 24 Januari 2014 lalu. “Saat ini kita sedang menunggu proses persidangan di PN Medan. Sedangkan untuk kedua tersangka ini, pihak kejaksaan telah menitipkan ke Rumah Tahanan (Rutan) Tanjung Gusta Medan,” kata Chandra. Terpisah, Kasi Pidana Khusus (Pidsus) Kejari Medan Jufri Nasution menuturkan, kedua terdakwa korupsi seluruh berkasnya sudah dilimpahkan ke PN Medan. Dengan Surat pelimpahan perkara acara pemeriksaan biasa, No. B-04/N.2.10/mdn/Ft.2/01/2014 tanggal 24 Jan 2014. Terdakwa atas nama Paian Sipahutar. Sedangkan No. B-03/N.2.10/mdn/Ft.2/01/2014 tanggal 24 Jan 2014. Dengan terdakwa atas nama Anggiat Hutagalung. “Sudah kita limpah berkasnya ke PN Medan dan sudah menunjuk tim Penuntut Umumnya dalam kasus ini,Yakni OkiYuda Tama dan kawankawan,” sebut Jufri Nasution. Sementara itu, Humas PN Medan Nelson Marbun ketika dikonfirmasi membenarkan

berkas dugaan korupsi pengelolaan anggaran Satpol PP Rp4,8 miliar telah dilimpahkan ke Pengadilan Negeri Medan. “Benar bahwa telah dilimpahkan dan untuk mengadili tersangka tersebut, Pengadilan Negeri Medan telah menetapkan untuk ketua majelis hakim Lebanus Sinurat dan dua anggota majelisnya Agus Setiawan, dan Ahmad Derajat,” tuturnya. Kedua tersangka yakni Staf Ahli Gubernur Sumatera Utara Bidang Pemberdayaan Masyarakat dan Penanggulangan Kemiskinan Anggiat Hutagalung, yang juga mantan Kepala Satpol PP Pemprov Sumut bersama Bendahara Paian Sipahutar dijerat dengan Pasal 2 ayat (1) jo Pasal 3 jo UU RI No 31 Tahun 1999 sebagaimana yang telah diubah dengan UU RI No 20 tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi jo Pasal 55 ayat (1) ke-1 KUHPidana. Setelah penyidik menggelar ekspose pada 3 Oktober 2013 silam, status perkara ditingkatkan ke penyidikan. Anggiat Hutagalung dan Paian Sipahutar ditetapkan sebagai tersangka pada 9 Oktober 2013 silam. Dugaan tindak pidana korupsi itu dilakukan oleh kedua tersangka pada pengelolaan anggaran langsung dan tidak langsung di Satpol PP Pemprov Sumut pada Tahun Anggaran 2012. Di antaranya kelebihan belanja pegawai Rp90 juta, dana Tambahan Penghasilan Pegawai (TPP) tidak dibayarkan ke PNS Satpol PP sebesar Rp19 juta, sisa anggaran pembayaran honor Rp3,2 miliar, sisa belanja tidak terduga Rp129,2 juta, bukti transfer dari Bendahara Paian Sipahutar kepada Kepala Satpol PP Anggiat Hutagalung Rp70 juta, biaya perjalanan dinas ganda dan biaya makan tidak dibayarkan serta pungutan pajak yang tidak disetor senilai Rp210 juta. (m38)

Tangisan Korban Kebakaran Belawan DENGAN berurai airmata, korban kebakaran Kel. Belawan Bahari, Kec. Medan Belawan, mengisahkan peristiwa yang menghanguskan 48 rumah dan 12 rumah di antaranya terpaksa dirusak untuk mencegah kebakaran makin meluas. Peristiwa kebakaran 26 Januari 2014 ini ibarat mimpi buruk. “Tak ada yang bisa diselamatkan. Hanya baju yang melekat di badan,” ujar Legiman, salahseorang korban kepada Waspada di lokasi kebakaran, Rabu (5/2). Suaranya bergetar menahan isak. Dia kini tinggal di bekas rumahnya yang dibangun dari sisa-sisa puing kebakaran. Pria yang bekerja mocok-mocok ini mengungkapkan, dia memiliki tiga anak, dua bersekolah di SD dan si bungsu berusia tiga tahun. Musibah kebakaran ini benar-benar membuatnya hampir putus asa. “Semuanya terbakar, TV, VCD, pakaian, semuanya, semuanya. Tak ada tersisa. Rumah beserta isinya habis, termasuk buku anakanak, pakaian sekolah, kartu keluarga, bahkan KTP,” sebutnya. Airmatanya terlihat makin mengucur. Legimin mengungkapkan, mereka belum pernah memperoleh bantuan dari siapa pun, walaupun di lokasi kebakaran sampai saat ini diakuinya didirikan dapur umum. “Makanya, kami sangat berterimakasih, ketika Pak Rahudman Harahap tiba-tiba mendatangi kami kemudian menyerahkan bantuan berupa beras dan uang,” katanya. Mereka saat ini tidak saja membutuhkan bantuan berupa pangan dan sandang, fasilitas untuk anak sekolah, juga bahan material untuk mendirikan kembali rumah mereka yang sudah menjadi puing. “Kami harapkan bantuan dermawan,” tutur Legiman. Sedangkan Drs H Rahudman Harahap MM mengungkapkan, bantuan yang diberikan jelas tidak seberapa. “Tapi, insya Allah, bantuan atas

nama pribadi dan keluarga ini, dapat menyambung silaturahmi kita yang sudah lama kita bangun,” kata Wali Kota Medan nonaktif itu didampingi Ketua Persaudaraan Pekerja Muslim Indonesia (PPMI) Medan Indra Syafii dan sejumlah pejabat. Dia mengaku sangat prihatin melihat kondisi korban kebakaran di Kel. Belawan Bahari. Rahudman menyerahkan bantuan satu goni beras berisi 15 kg kepada setiap KK yang rumahnya terbakar ditambah sejumlah uang. Ini, kata dia, sematamata ingin membantu meringankan beban para korban musibah. “Mungkin, nanti Pemko Medan juga akan datang membantu,” ujarnya. Rahudman berharap, para korban kebakaran tabah menghadapi musibah ini. Musibah ini benar-benar sangat memprihatinkan, tapi diingatkannya agar kita dapat mengambil iktibar. Pemerintah kecamatan dan pemerintah kelurahan, ke depan diharapkan Rahudman mampu menata pemukiman yang lebih repsentatif. Dia berpesan kepada korban kebakaran yang kini tidak lagi memiliki Kartu Keluarga dan Kartu Tanda Penduduk karena terbakar dalam musibah ini, agar segera melapor ke pemerintah kecamatan untuk seterusnya pihak kecamatan berkoordinasi dengan Dinas Kependudukan dan Catatan Sipil Kota Medan. “Mudah-mudahan tabah menghadapi musibah ini, semoga mendapat jalan keluar,” sebut Rahudman Harahap. Para korban kebakaran Kel. Belawan Bahari mengucapkan terimakasih tidak terhingga kepada Rahudman Harahap dan rombongan. “Kami sangat terharu. Terus terang, ini membuat kami makin kuat menghadapi cobaan ini. Ternyata, masih ada yang peduli terhadap penderitaan kami. Terimakasih, Pak,” ujar salahseorang korban kebakaran kepada Rahudman Harahap. Irham H Nasution

Waspada/Irham H Nasution

UNTUK meringankan beban korban kebakaran di Kel. Belawan Bahari, Kec. Medan Belawan, Drs H Rahudman Harahap MM, atas nama pribadi dan keluarga menyerahkan bantuan beras dan sejumlah uang kepada para korban.


WASPADA Kamis 6 Februari 2014


JELANG PILEG DAN PILPRES 2014 Sikapi Putusan Pemilu Serentak

DPR Segera Setujui RUU Pilkada JAKARTA (Waspada): Ketua Komisi II DPR RI Agun Gunanajar Sudarsa menegaskan, Komisi II DPR segera membawa Rancangan Undang Undang (RUU) Pemilihan Kepala Daerah (Pilkada) ke paripurna DPR untuk disetujui menjadi UU menyusul putusan Mahkamah Konstitusi (MK) yang memerintahkan digelarnya pemilu serentak pada tahun 2019. “ Apapun alasan dan kondisinya, RUU Pilkada harus disetujui DPR. Harapannya tidak ada substansi yang ditolak dalam RUU Pilkada itu, ujar Agun dalam forum legislasi “RUU Pilkada” di Gedung DPR RI Jakarta, Selasa (4/2). Menurutnya, kalau pada periode DPR 20142019 nanti yang akan melanjutkannya, maka akan sarat kepentingan politik. “Sekarang ini terus kita godok bersama pemerintah dan fraksifraksi,” tandasnya. Agun mengakui menunggu sikap fraksi itu penting, karena pihaknya tidak ingin terulang seperti kasus dana saksi, yang sudah disepakati di Komisi II DPR, tapi anggota fraksinya menolak. “Jadi, hal itu tak boleh terulang lagi,” ujarnya. Pada forum itu Dirjen Otda Kemendagri Djohermasyah Johan menegaskan, jika pemilu dan pilkada digelar secara serentak sejalan dengan putusan MK, maka ada dua pemilu;

yaitu Pemilihan Umum legislatif -pemilihan presiden dan Pilkada. Konsekuensinya, tambahnya, kedua pemilu tersebut biayanya dianggarkan melalui APBN agar bisa dikontrol secara nasional. “Idealnya, pemilu serentak tersebut semuanya dipilih langsung oleh rakyat, sehingga tidak terjadi belang-belang atau berbeda mekanisme. Untuk itu pemerintah dan DPR akan terus menyingkronkan hal itu sebelum disahkan dalam waktu dekat ini,” tegas Djohermansjah UU-nya pun, menurut Djohermansjah, cukup satu. Persoalannya apakah dalam Pilkada itu diusung secara paket antara kepala dan wakil kepala daerah atau tidak? “Pemerintah mengusulkan cukup kepala daerah yang dipilih, sedangkan wakil kepala daerah dipilih oleh kepala daerah terpilih, dan DPRD bisa menyiapkan 2 wakilnya; satu dari PNS dan satu orang non-PNS,” jelasnya. Bahkan dalam pandangan Kemendagri, jika di satu kabupaten itu penduduknya hanya 100 ribu orang, maka tidak perlu wakil. Sedangkan bagi yang penduduknya lebih dari satu juta orang, maka diperlukan wakil, dan jika lebih dari 10 juta penduduknya, maka dibutuhkan dua wakil kepala daerah. (aya)

KY Diminta Evaluasi Mekanisme Seleksi Calon Hakim Agung JAKARTA (Waspada): Anggota Komisi III DPRRI dari Fraksi Gerindra Martin Hutabarat meminta Komisi Yudisial perlu mengevaluasi mekanisme penyeleksian dalam memilih calon Hakim Agung yang diajukannya ke DPR. Permintaan ini disampaikan Martin Hutabarat setelah hasil pemungutan suara di Komisi III memperlihatkan, calon Hakim MA Suhardjono dan Maria hanya disetujui 3 orang, sedang yang menolak 44 orang dan 1 orang abstain. Dengan hasil ini, Komisi III DPR menolak hasil seleksi KY karena tidak puas terhadap kinerja KY dalam melakukan seleksinya. “Kedepan KY perlu mengevaluasi bagaimana proses seleksinya dengan memperbanyak calon-calon yang akan diseleksi dan membuat proses seleksinya lebih transparan ke publik, “kata Martin Hutabarat, Selasa (4/2) di Gedung DPR Jakarta. DPR setuju atau tidak setuju terhadap calon Hakim Agung yang diajukan KY ini adalah pertama kali dilakukan DPR sesudah putusan Mahkamah Konstitusi (MK) no 27 thn 2013 yang merubah aturan sebelumnya dimana UU Mahkamah Agung yang memberi wewenang

kepada DPR untuk memilih Hakim Agung yang diajukan KY. “ Sekarang sudah tidak lagi memilih, DPR hanya berwenang menyetujui atau tidak menyetujui calon Hakim Agung yang diajukan KY,” ujar Martin Hutabarat. Pada rapat pleno, Selasa, Komisi III DPR RI memutuskan menolak menyetujui tiga calon Hakim Agung yang dikirimkan KY. Keputusan diambil setelah melewati proses pemungutan suara yang diikuti oleh 48 orang anggota komisi hukum ini. Menurut Ketua Komisi III DPR Pieter C. Zulkifli, penolakan Komisi III ini bukan merupakan bentuk perlawanan terhadap hasil judicial review MK yang memangkas kewenangan DPR. Politisi Fraksi Partai Demokrat ini menambahkan, langkah Komisi III selanjutnya adalah melakukan rapat internal untuk menyikapi hasil fit and proper test yang disebutnya mengecewakan. “Dalam waktu dekat kita akan rapat internal pimpinan dan anggota. Kita akan bicara dengan KY untuk mengetahui terminologi apa yang dipakai KY sehingga 3 calon Hakim Agung ini dikirim ke Komisi III,” ujar Pieter. (aya)


MENTERI Negara Badan Usaha Milik Negara (BUMN), Dahlan Iskan (kedua dari kanan) dan Direktur Utama PT Semen Indonesia Tbk, Dwi Soetjipto (tiga dari kanan) berfoto bersama usai peluncuran buku ‘Road to Semen Indonesia’ di Balai Kartini, Selasa (4/2) malam. Buku terbitan Penerbit Buku Kompas ini dikatakan Dahlan patut dibaca para pemimpin korporasi. Bagaimana kemampuan Dwi Soetjipto menggabungkan tiga perusahaan besar yakni Semen Padang, Semen Gresik dan Semen Tonasa menjadi PT Semen Indonesia Tbk, patut dicontoh.

Kebun Binatang Ragunan Tutup Setiap Senin JAKARTA (Waspada): Taman Margasatwa Ragunan (TMR) meliburkan diri setiap hari Senin dalam sepekan. Sebelumnya kebun binatang yang berada di kawasan Pasar Minggu, Jakarta Selatan ini buka seminggu penuh. Pemberlakukan tutup tiap Senin ini sudah dilakukan sejak Senin ini (3/2). Kendati begitu beberapa pengunung masih ada yang datang karena tidak tahu. Humas TMR, Bambang Wahyudi mengatakan kebijakan libur satwa ini merupakan salah satu butir yang dihasilkan dari dialog publik yang dilakukan pada 8 Oktober 2013 dari elemen masyarakat dan para ahli. Dialog menghasilkan 20 butir kesepakatan. Salah satunya mengenai kesejahteraan hewan yang memuat mengenai libur satwa, yang kemudian diusulkan kepada Gubernur DKI Jakarta Joko Widodo yang kemudian dijadikan Pergub Nomor 7 Tahun 2014. Menurut Bambang Wahyudi penutupan TMR setiap Senin untuk memberi hari libur bagi satwa sekalian untuk melakukan peningkatan kualitas perawatan seluruh satwanya. Dia menjelaskan kendati setiap Senin tutup, para karyawan TMR tetap masuk. Menurutnya

hari libur bagi satwa tersebut justru akan memberi kesempatan pengelola TMR melakukan berbagai hal yang berhubungan dengan perawatan kesehatan dan fasilitas satwa di TMR itu sendiri. “Kalau libur petugas jadi lebih leluasa membersihkan kandang dan memberi perawatan. Kalau tidak dilibur, rasanya kurang etis karena mengganggu pengunjung,” jelasnya di Jakarta. Keputusan Ragunan meliburkan diri setiap Senin mendapat respon positif warga Jakarta dan organisasi pecinta hewan. Linda, 25, yang mengaku sering ke Ragunan mengatakan salut atas pemberlakukan libur tiap Senin ini. “Kalau tujuannya buat perawatan hewan-hewannya, saya setuju dan mendukung saja, biar hewannya tetap sehat tidak seperti Kebon Binatang Surabaya yang binatangnya sering mati,” akunya. Sementara Ketua Pro Fauna Indonesia, Rozek Nursahid mengatakan penentapan ragunana libur tiap Senin ini bagus untuk memperbaiki psikologi satwa agar tidak stres. Ragunan merupakan salah satu obyek wisata favorit yang ada di Jakarta. Selain tiket masuknya murah, lokasinya juga mudah dijangkau karena terhubung dengan bus TransJakarta. (adji k.)


TAMAN Margasatwa Ragunan, Jaksel menjadi salah satu obyek wisata favorit di Jakarta.

KETUA Umum Pujakesuma Komjen Pol Drs Oegroseno, SH yang juga Wakapolri foto bersama dengan pengurus Pujakesuma.


Oegroseno: Silatnas Jadi Panduan Pujakesuma MEDAN (Waspada): Ketua Umum Pengurus Pusat Paguyuban Keluarga Besar Pujakesuma, Komjen Pol Drs Oegroseno, SH., berharap Silaturahim dan Rapat Kerja Nasional (Silatnas) Pujakesuma mampu menyusun panduan bagi warga Pujakesuma khususnya dan masyarakat umumnya untuk menjadi pemilih yang cerdas pada Pemilu 2014 maupun pada setiap even pilkada. “Perlu panduan agar warga menjadi pemilih cerdas,” ujar Oegroseno, saat pertemuan dengan jajaran pengurus Pujakesuma, beberapa waktu lalu di Hotel Santika Dyandra Medan. Oegroseno menekankan, panduan cerdas tersebut hendaknya dirancang sedemikian rupa tidak hanya semata-mata untuk mensukseskan Pemilu

2014. Lebih dari itu, panduan tersebut juga untuk menjaga keutuhan Pujakesuma, serta menjamin tersalurnya aspirasi warga. “Saya percaya, kualitas SDM yang dimiliki Pujakesuma mampu menyusun panduan cerdas semacam ini.” Pertemuan menjelang tengah malam itu dihadiri Ketua Majelis Pembina/wakil, Dr. Drs. H. Kasim Siyo, M.Si., dan Prof Darmono, Ketua Majelis Pakar/ wakil, Prof. Dr. Subanindyo Hadiluwih, MBA., Prof, Aldwin Surya dan Prof Dian Armanto, Penasihat Pujakesuma Ir Soekirman danWagirin Arman, jajaran pengurus pusat, Ketua Pujakesuma Sumut AKBP Joko Susilo, Ketua Pujakesuma Medan Hendra DS, Ketua Pujakesuma Deliserdang Kompol Sujono dan Ketua Pujakesuma

Sergai Syahrianto, SH. Lebih lanjut Oegroseno minta semua warga Pujakesuma untuk tidak melakukan politik praktis di dalam paguyuban ini, sesuai dengan amanat Mubes IV/2011 yang telah menetapkan Pujakesuma sebagai paguyuban budaya, sosial kemasyarakat dan perekonomian. Oegroseno juga minta Pujakesuma tetap menjaga semangat guyub dan keseduluran yang menjadi roh terbentuknya Paguyuban Pujakesuma pada 10 Juli 1980 lalu. “Jika paguyuban ini tidak lagi dilandasi semangat guyub dan keseduluran, maka paguyuban ini tidak lagi bernama Pujakesuma.” Dalam pertemuan tersebut disepakati Rakernas Pujakesuma akan dilaksanakan pada Minggu-Senin/9-10 Februari

2014 di Arena Wisata Thema Park Pantai Cermin, Kab. Serdangbedagai. Siap Dilaksanakan Sementara itu Ketua Panitia Silatnas Pujakesuma, H. Subandi, SH., Sp.N., menyatakan kesiapan panitia melaksanakan acara tersebut sesuai jadwal yang telah disepakati. Semula, dijadwal berlangsung 18-19 Jan.2014. “Panitia telah siap melaksanakan Silatnas,” tegas Subandi. Dalam Silatnas Pujakesuma yang diharapkan akan dihadiri Sri Sultan Hamengkubowono X selaku Penasihat Pujakesuma, serta pencerahan dari Ketua KPU Pusat dan Ketua Bawaslu Pusat itu, lanjut Subandi, akan membahas konsolidasi organisasi serta sikap Pujakesuma dalam mensukseskan Pemilu 2014 itu. Selain itu, juga dijad-

walkan acara ramah tamah warga Pujakesuma Sumut dengan seluruh caleg DPD, DPR-RI dan DPRD Sumut yang berasal dari etnis Jawa. Ditambahkan, semua Pengurus Wilayah Propinsi dan Kab/Kota yang ada telah menyatakan kesediaannya untuk hadir pada Rakernas tersebut. Diantaranya Aceh, Sumut, Sumbar, Riau, Kepri, Lampung, Sumsel, Jambi, Jakarta dan Banten, berikut sekitar 60 kab/kota di provinsi tersebut. Diperkirakan, jumlah peserta Silatnas sebanyak 200 orang. “Direncanakan, acara pembukaan Silatnas bersamaan dengan pelantikan Pengurus Pujakesuma Kab. Sergai pimpinan Syahrianto, SH, yang saat ini menjabat sebagai Wakil Bupati Serdangbedagai.” (rel/m09)

Wiranto: Perubahan Dapat Dilakukan Kalau Pemimpinnya Mau Dan Mampu MEDAN (Waspada): Ketua Umum Partai Hanura Wiranto, SH menegaskan, satu perubahan dapat dilakukan kalau pemimpinnya mau dan mampu melakukan perubahan itu. “Perubahan akan terjadi kalau pemimpinnya mau melakukan perubahan,” tegas Wiranto di hadapan caleg, kader dan simpatisan saat melakukan kunjungan kerjanya di DPC Partai Hanura Medan di Jln. DI Panjaitan, Rabu (5/2). Menurutnya, dalam pertemuan ini ada perubahan kalau dibandingkan di tahun 2009. “Sebuah partai memang menghadapi pasang surut dan perjuangan serta hadangan, hambatan, tantangan namun semua itu bisa teratasi dengan baik,” katanya. Hanura lanjutnya, didirikan dengan tujuan yang mulia berdasarkan suatu pertimbangan yang saggat dalam. “Negara ini seharusnya dapat dikelola dengan lebih baik lagi dan punya potensi yang cukup luarbiasa untuk meraih mimpi Indonesia yakni negara bersatu, berdaulat adil dan makmur,” jelasnya. Untuk itu pemerintah harus melindungi tumpah darah Indonesia, memajukan kesejahteraan umum dan mencerdaskan kehidupan bangsa. “Saya bertekad mengantarkan negeri ini untuk mendaat kebaikan bagi seluruh rakyatnya,” kata Wiranto. Menurutnya, satu perubahan dapat dilakukan kalau pemimpinnya mau dan mampu melakukan perubahan. Perubahan akan terjadi kalau pemimpinnya mau melakukan perubahan itu. “Partai Hanura dibangun untuk membangun para pemimpin baru untuk mempunyai kekutan hati nurani rakyat,” katanya. Dalam kesempatan ini Wiranto juga mengucapkan terimakasih kepada para kader setelah 8 tahun hingga saat ini Partai Hanura dinilai lembaga survei, ICW, Sekretaris Kabinet sebagai partai yang bersih dari korupsi dari semua partai. “Namun perjuangan belum

Waspada/Rudi Arman

KETUA Umum Partau Hanura Wiranto, SH berbincang dengan salah satu caleg DPRD Kota Medan Dapil I Hendra DS didampingi Ketua DPC Medan Hariman Tua Dibata Siregar, saat kunjungan kerja di sekretariat DPC Jl. DI Panjaitan Medan, Rabu (5/2). selesai, Hanura masih mengawal pejalanan ini dan dengan hati nurani bisa membangun negara ini,” katanya. Ditegaskannya, ada gambaran kalau Partai Hanura ingin menjadi besar tidak boleh tinggal diam harus ada terobosan supaya partai ini disegani. “Betapa beratnya perjuangan Partai Hanura,” katanya. Wiranto juga menjelaskan, hasil survei yang diambil dari 30 ribu responden, Partai Hanu-

ra sudah berada tiga besar, Win –HT berada di peringkat 2 baik dari survey yang resmi maupun tidak resmi. “Makanya kita harus menjadikan moment ini ke depan sebagai partai penentu dan Sumut akan berlipat pendapatan suaranya dan seluruh kader bisa mendulang suara terbanyak,” harap Wiranto sambil menambahkan Win-HT akanberusaha dengan berbagai cara mendongkrak suara Partai Hanura.

“Partai Hanura tidak akan berkianat, hidup mati untuk rakyat sudah kita ucapkan karena sudah mendapat predikat partai bersih dari korupsi,” tegas Wiranto. Mengenai adanya pimpinan DPD Sumut yang dinonaktifkan, Wiranto menjelaskan, sementara ini karena terlibat masalah pelanggaran hukum. Selesaikan dulu urusan hukum ini dan buktikan kalau tidak bersalah, kalau tidak terbukti akan

kita kembalikan jabatannya. Diakhir sambutannya, Wiranto meminta semua kader menggalang persatuan dan kebersamaan karena ini modal kemenangan kita. “Pertempuran bisa dimenangkan kalau kita kompak dan bersatu, sehingga Partai Hanura bisa dipercaya menjadi partai yang membawa perubahan di RI ini,” katanya. Sedangkan Ketua DPC Hanura Medan Hariman Tua Dibata Siregar mengatakan, bersama PAC dan Kader siap memberikan perubahan untuk membesarkan partai. “Untuk itu kita mempunyai komitmen dan sikap jika tidak berhasil memperoleh satu fraksi siap mengundurkan diri,” tegas Hariman. Janji dan komit saya ini sebagai bukti, saya benar-benar cinta Partai Hanura dan mengabdi kepada Hanura. “Saya ini kader dan telah membentuk 21 PAC dan ranting di kota Medan,” katanya. Namun kondisi politik di Sumut ini lanjutnya, sangat berdampak terancam pencapaian satu fraksi karena adanya penafsiran dan kondisi saat ini. “Kita menginginkan kesatuan dan persatuan serta merapatkan barisan untuk keberhasilan Partai Hanura dan bisa mengusung WIN-HT menjadi Presiden dan wakil presiden,” kata Hariman. (m39)

Potensi Konflik Sosial Di 2014 Cukup Tinggi JAKARTA (Waspada): Indonesia PoliceWatch (IPW) mengapresiasi ajakan Kapolri Jenderal Pol Sutarman kepada wartawan untuk menjadi intelijen dalam Pemilu 2014 patut disambut positif, tetapi jangan sampai mengkebiripers.Organisasipers,seperti PWI dan AJI harus melihat ajakan ini dengan semangat kebangsaan demi menjaga stabilitas kamtibmas di Pemilu dan Pilpres 2014 yangdikhawatirkanbanyakpihak akan diwarnai konflik. Jangan sampai ajakan kerja sama tersebut justru mengkebiri pers dan membuat pemihakan pers ke Polri. Pers harus tetap kritis dalam menyikapi kinerja

Polri saat menjaga kamtibmas di sepanjang tahun politik 2014. Sehingga kerja sama pers dan Polri hanya sebatas untuk membantu memberikan informasi awal agar Polri bisa memberikan langkahpencegahansecaracepat di tiap daerah,” kata Ketua PresidiumIPWNetaSPane diJakarta, Rabu (5/2). Meski demikian, kata Neta Pane, masyarakat pers tetap independen dan profesional, karena secara informal dan individu kerja sama kalangan pers dengan jajaran Polri sudah sejak lama terbangun. “Cukup banyak kalangan pers memberikan informasi

dan data intelijen ke polisi. Namun menjelang tahun politik 2014 kerja sama ini perlu diformalkan, sehingga ajakan Kapolri tersebut sebuah kondisi yang kontekstual, patut diapresiasi kalangan pers demi menjaga situasi kamtibmas di seluruh Indonesia,” ucap Neta Pane. Dari data IPW, potensi konflik sosial di 2014 cukup tinggi, indikasinya sudah terlihat di 2013, dari 33 provinsi 27 di antaranya diterjang konflik sosial. “Jumlah konflik mencapai 153kali,yangmembuat203orang tewas,361luka,483rumahdirusak dan 173 bangunan dibakar. Pertikaian antar warga dan antar

kelompok mendominasi hilangnya nyawa rakyat di 2013,” terang Neta Pane. Terbatasnya jumlah polisi, sambung Neta Pane, membuat Polri kesulitan melakukan deteksi dini, dengan adanya bantuan masyarakat pers yang tersebar di berbagai daerah diharapkan potensi konflik yang ada bisa dengan cepat dicegah. “Hanya saja, dalam kerja sama ini Kapolri harus menekankan jajaran bawahnya agar senantiasa tanggap. Jangan sampai informasi yang disampaikan pers didiamkan, yang kemudian membuat masyarakat pers frustrasi,” kata Neta Pane.(j02)

AirAsia Indonesia Raih Excellent Service Experience Award 2014 JAKARTA (Waspada): AirAsia Indonesia meraih mystery shopping, yakni surveyor berperan penghargaan Excellent Service Experience Award sebagai pelanggan untuk mengetahui tingkat 2014 sebagai perusahaan penerbangan dengan pelayanan perusahaan. pelayanan di kabin pesawat serta eelayanan CEO Carre CCSL Yuliana Agung menuturkan ground handling terbaik dari Carre Center for metode riset mystery shopping adalah salah satu Customer Satisfaction and Loyalty (Carre CCSL). alat penjaminan kualitas layanan yang mampu Penghargaan tersebut diberikan oleh CEO memberikan informasi awal apabila terjadi Carre CCSLYuliana Agung kepada Presiden Direkpenyimpangan proses pelayanan. tur AirAsia Indonesia Dharmadi dalam acara yang Melalui survey tersebut, AirAsia Indonesia digelar di Hotel Mulia, Jakarta, Selasa (4/2) malam. berhasil memperoleh nilai Indonesian Service “Peng-hargaan ini menunjukkan komitmen kami Experience Index (ISEI) sebesar 85,106 untuk dalam memberikan layanan terbaik kepada makategori pelayanan kabin (cabin service) dan syarakat. Sebagai brand maskapai penerbangan pelayanan di darat (ground handling). berbiaya hemat terbaik di dunia, AirAsia senantiasa Adapun kriteria yang dinilai adalah pengalaman berupaya memberikan pengalaman perjalanan Waspada/istimewa yang melibatkan panca indera pelanggan (customer berkesan bagi seluruh pelanggan,” kata Dharmadi. PRESIDEN Direktur AirAsia Indonesia Dharmadi (memegang sense experience), pengalaman yang melibatkan Carre CCSL yang merupakan lembaga riset piagam penghargaan) bersama dengan CEO Carre CCSL emosi/mood pelanggan (customer emotion/mood independen di bidang service quality dan customer Yuliana Agung. experience), dan pengalaman atas solusi pemecahan management ini memberikan penghargaan masalah (customer problem solution experience). kepada AirAsia Indonesia berdasarkan hasil survei yang dilakukan pada Oktober Dharmadi menambahkan, penghargaan ini menjadi salah satu motivasi 2013 hingga Desember 2013 di Jakarta dan Surabaya. bagi AirAsia Indonesia untuk terus berinovasi dalam meningkatkan kenyamanan Survei yang melibatkan 1.000 responden ini menggunakan metode riset perjalanan pelanggan. “(j02)

A8 1 CM


Rp. 22.200

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

DAIHATSU TARUNA 2000 Tipe Csx. Wrn Abu - Abu Metalik, Ban Besar, Ac, Tv. Hub 0 8 2 3 6 4 2 0 4 8 4 9 DAIHATSU BARU PROMO SPECIAL * TERIOS ADV DP. 35Jtan * G.Max Pu DP 9Jtan * Xenia Sporty DP 32Jtan * Ayla Dp 25Jtan INFO Sales Hub : Riza 0 8 5 2 7 7 4 7 2 5 4 2

Rp. 33.000

3 CM

Rp. 44.000

PAK ET DAI H AT SU PAST I M U RAH Xenia DP 26 Terios DP 33 Pick up DP 10 Ayla DP 23 Hubungi : I r n a n d a

Jtan Angs Jtan Angs Jtan Angs Jtan Angs 0813 7580

3 Jtan 4 Jtan 2 Jtan 1 Jtan 2895

ASTRA DAIHATSU MOBIL BARU All New Xenia DP Mulai 33 Jtan All New Terrios Disc Sampai 17 Jtan Pick Up DP Mulai 10 Jtan/ Ayla Ready Stock Gratis Kaca Film / Alas Dasar/Selimut Mobil Hot Line : 0852 6203 0339

4 CM

Rp. 55.000

6 CM

Rp. 121.000

8 CM Rp. 137.500

6x6,6 kolom Rp. 165.000

Kamis, 6 Februari 2014

FAX.4531010 I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0


T OYOTA INNOVA G SOLAR Th’05 Manual, Hitam Metalik, Full Orisinil, Mobil Cantik, Rp. Jl. Sm Raja No. 200. 0812 6038 5555 / 7851402


- TOYOTA CAPSUL 97 SSX, Ps, Pw, Ac, RT, Vr, Br, 5 Speed, 78Jt. - SU Z U K I KATANA Th 2000. Originil, Belum Pernah sisip cat, 62Jt. 0821 6041 5416/Nego



TOYOTA RUSH MATIC Th’10. Wrn Silver Metalik, Bln 6, Mobil Cantik Sekali, Rp. 155Jt. Hub 0 8 5 3 6 2 3 1 2 3 2 3




J U AL CEPAT DAI H AT SU TAFT GT (4X4) 1997. BK Mdn Asli, Ac, Tape, Ban baru, B.S, Velg Racing, Abu - Abu Metalic, Body Kaleng - kaleng, Mesin Gardan Bagus, Serius Hub 0821 6564 2662

T OYOTA VIOS G 1.5 2004. Silver, Mulus, Pajak Panjang, Medan Asli, Harga Nego. Telp 0852 6003 9101

Ac, Tape, Vr, BK Mdn, Wrn Abu - Abu Metalik, Body Long. Hub 0812 6569 3737

ASTRA DAIHATSU PROMO FANTASTIS Setiap pembelian Xenia, Terios, Ayla, GM Pick Up, Sirion, Luxio, pesan sekarang dan dapatkan Hadiah nya, Dp Rendah OKE, 100 % baru. Hub : ADWIN 0821 6116 9721 DAIHATSU TAFT GT 4X4 88. Hitam met, PS, Vr, Br, Velg Cobra, Harga : Rp. 55Jt (Damai). Hub 0823 7688 8808

OPEL BLAZER LT Injection Biru Met Th 96. Sgt Mulus, Orisinil, Mesin Sehat, Ac Dingin, Hrg 43Jt Nego. Hub 0812 6063 7823

TOYOTA VIOS MATIC 2003 Type G Warna Silver. Hub 0 8 5 2 6 1 1 3 7 5 9 2

TOYOTA RUSH 2009. Warna Hitam Type G Manual, BK Medan. HP 0852 1622 0092

T O Y O T A KIJANG COMMANDO SHORT 6 SPEED Th 89. Mulus Orisinil, Vr, Br, RTP, Ac Dingin, Lamp Grand, Hrg 42Jt Nego. Hub 0823 6432 0052

DAIHATSU GRAND MAX Pick Up 1.5 cc Over Kredit Th 2012. Ex Angkat Telur, Sudah Dibayar 18 x SISA 30 X 2.668.000, Balik Dp 35Jt Nego. Hub 0 8 1 2 6 2 8 1 6 5 8 5

DIJUAL TOYOTA KIJANG KRISTA 7. Warna hijau bensin, lengkap, cantik, liad dlu baru tawar. Hub 0852 6148 1929

DAIHATSU XENIA Mi VVTi 2006 Silver. BK Siantar, pajak panjang, Vr, Ps, Cl, Ac Dingin, Harga 89Jt Nego. Hub 0 8 5 2 0 6 1 6 8 0 8 4

DIJUAL 1 UNIT TOYOTA SOLUNA Warna merah Thn 2000. Asli BK Medan, 1 tangan dari baru, harga 66 juta. HP 0813 6101 8855



HP. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

# T OYOTA D E A L E R M E DA N # INFO MOBIL BARU, Special Februari. Hub. Anwar Damanik. 0823 7088 0815 T O Y O T A SE SALOON Merah Manggis, Pemakaian Th 86. Sgt Orisinil Sekali, Masih Enak dipakai, Ac Dingin, Hrg 33Jt Nego. Hub 0852 6134 0538 - 0821 6738 7047

TOYOTA COROLLA SE Saloon 87. Hitam Metalic, Ac, Vr, Br, Cl, RT, Body Mesin Oke, Harga Rp. 33Jt (nego). Hub 0823 7688 8808 T OY OT A KIJANG COMMANDO G LONG 95. Biru Metalic, Ps, Pw, Cl, RT, Vr, Br, Pakai RPM, Harga Rp. 58Jt (Damai). Hub 0823 7688 8808





PROMO I Rp. 700.000 Rp. 800.000 PROMO II Rp. 1.000.000 Rp. 1.100.000 PROMO III Rp. 1.400.000 Rp. 1.600.000 Hub.

ELITE MOTOR Jl. Nibung II No. 114 Medan (Samping Medan Plaza)

Telp. 061- 76224409, 0811608140 dekat Carrefour

BUTUH DANA GEBY AR D AN A CEP AT GEBYAR DAN CEPA Proses 3 Jam Cair, Tanpa Usaha. Jaminan : SHM, SK Camat, HGB, BPKB Mobil, Spd Mtr, Truk dan Mobil yang masih Kredit, Over Leasing/ Bantu Pelunasan BPKB. Hub : Rinaldi 0821 6757 1653 , 0853 6100 3453


Informasi Pembaca Bursa Property G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH DIJUAL Lok. Tanjung Gusta, Permai 9, Letak disudut, Thn Uk. 12,5 x 16, 4 Kmr. Hub 0 8 5 3 6 0 9 1 9 1 2 7

RUMAH MEWAH JUAL MURAH Jual Cepat LT. 9x22. LB. 350 M. 4 KT, 5 KM, 2 Mushola, Full Granit, Srt Sertifikat dan IMB. Jln. Brigjen Zein Hamid Gg. Anggrek No. 33. Hub Pa k Ya t a 0 8 1 2 6 0 7 8 8 8 5 5


LOWON GAN K ERJ A Kami Perusahaan Distributor Membutuhkan : Adm & Ope ra siona l - Pria/Wanita max, 27 tahun - Pendidikan Min. SMK/D3 Komputer - Jujur, Disiplin dan Bertanggung Jawab - Bersedia ditugaskan keluar kota Lamaran Lengkap dikirim ke : Jl. Kapten Muslim Ujung Gg. Lestari No. 6 A - Medan. Lamaran Paling lambat dikirim 2 minggu setelah iklan ini terbit

LOWO N G A N K E R J A Dibutuhkan tenaga kerja untuk posisi marketing representative (MR), dengan kualifikasi sbb : - Jenis Kelamin: Pria/Wanita - Usia:min 18 tahun dan max 23 tahun - Pendidikan terakhir: SMA/Sederajat, D-I, D-II atau D-III - Bersedia ditempatkan di wilayah Medan dan sekitarnya Bagi yang berminat dapat langsung mengantar surat lamaran ke PT. Kelola K ar ya Bersama (PT. KKB), Jalan Gajah Mada No. 23 B Medan (samping Bank Bukopin).

D I J U A L R U M A H Type Minimalis Di Perum. Garu Mas Jl. Garu 6 No.18 Simp. Marindal Mdn. Type 80/78, Type 75/72 ,Type 68/72, Type 54/78, Type 48/72, Special Promo di awal Jan 2014. Hub 0 8 1 3 6 1 4 2 4 9 7 2

DI J U AL RU M AH Luas Tanah 263 M2, K. Tidur 4, Garasi, R. Keluarga, R. Makan, Sertifikat Hak Milik, Di Komplek Perumahan Bumi Serdang Damai (Pante Rambung). Mariendal Jl. Mutiara Raya No. 34. Hub 0852 7557 7080 - 0853 8000 0672


DI J U AL RU M AH Psr 5 Gg. Saun Tembung. TP. Hub Ibu Indah 0 8 2 3 6 6 6 4 6 1 3 1 RU M AH DI J U AL LT : 124 M2, Ukuran 9,6 x 12 M, SHM, Full Keramik, Berpagar & Canopy di Perumahan Kuis Indah Permai Blok O No. 10. Batangkuis, Harga Rp. 160Jt/ Nego. Hub 0 8 1 3 6 2 2 1 5 7 7 8 TP



SEGERA MILIKI !!! Nikmati Suasana Hunian Yang Indah Dan Nyaman Hanya Di

GRAND SETIA RESIDENCE Keunggulan: * Tersedia taman yang asri * 15 menit dari terminal Amplas * 7 menit dari Pekan Tembung * 10 menit dari Pasar Gambir

* Tersedia angkot sampai lokasi (KPUM No. 11) * Dekat lokasi pendidikan (TK s/d Universitas) * Bebas banjir. Contac Person : * Hanya 15 menit ke Ring Road 0813 7630 2583 - 0813 7044 6972 Kuala Namu Airport



Luas tanah 20x60 m2, Bgnan 18x20 m2, K. Tidur 4, K. Mandi 3, R. Sholat, R. Tamu, Garasi Di Jln. Purnawirawan No. 35 Medan Estate - L. Dendang (Blkg Comp. Citra Bagya Land), Hrg 1.5 M Nego. Hub 0 8 5 2 0 6 8 0 5 4 7 4


BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000



Bpk. Umar & Ust. A. Aziz # LOWON GAN # Menerima cepat p/w (17 - 38 thn) utk diposisikan di “K AN T OR” Min SMU/SMK sederajat, Mahasiswa/i. pengalaman kerja tdk diutamakan. Pe ngha sila n Rp. 2 .5 0 0 .0 0 0 /Bln. Hub : IBU HELENA / BPK AGUSTINUS SIHITE HP : 0 8 5 3 7 3 7 6 2 8 0 5 / 0 8 5 3 5 9 9 8 2 1 2 4 Alamat Kantor : Jln. Setia Luhur Komplek Griya Millenium No. 11 A (Dekat Mesjid Amaliah). Syarat : Bawa KTP + Guntingan iklan utk interview

DICARI AGEN T I AP K OTA /K AB PRODUK SPIDOL & TINTA Spidol Supply Ke Sekolah 2, Keuntungan 50-100%, Modal Kecil, Gratis Penawaran. Hub 0 8 1 1 2 7 9 9 9 0 6


MELAYANI BERBAGAI MACAM KELUHAN ANTARA LAIN : * Khusus Pria, Tambah Ukuran - Panjang 13-16-19-22 cm diameter : 3,5, 4-4,5, 5-5,5,5-6 cm - Kuat dan Tahan Lama - Ejakulasi dini, Sphilis/rajasinga mani encer - Lemah Syahwat, diabetes, impoten, dll

* Khusus Wanita - Memperbesar Payudara - Terapi Perawan/Virgin - Kista, Lemah Kandungan - Kanker Payudara - Ingin mempunyai keturunan, dll

* Ingin cepat dapat jodoh, pengasihan & disegani atasan, menyatukan dan memisahkan PIL/WIL, puter giling, juga melayani pasang susuk. Tersedia pegangan untuk dagang, lulus tes, keselamatan, buka tambang, membuka lahan baru, pekerja hiburan, untuk jual beli tanah, rumah, mobil dengan cepat. Pengisian kosmetik, rokok, membuat anda tampil karismatik, cantik dan menarik, tampan, dll. Bergaransi, alami tanpa efek samping, langsung reaksi ditempat. Hasil permanen untuk seumur hidup

Alamat Praktek : Jl. SM Raja No. 134/10 (Depan Taman Makam Pahlawan) Samping Gedung Dakwah Muhammadiyah

HP. 0 8 1 3 8 0 4 2 6 2 5 3 , 0 8 2 1 6 6 5 6 4 5 1 3 Buku setiap hari jam 08.00 - 22.00 WIB 1 NB : Mobil Bisa Masuk, Rahasia Terjamin. Izin :B-70/DSP.5/II/2007


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia la t vit a lm a ke rot .c om




DIBUTUHKAN Beberapa orang wanita untuk dididik menjadi Beautysion Syarat : - Wanita - Belum menikah - Usia Max 25 Thn - Pendidikan SMA / sederajat - Penempatan di Jakarta - Disediakan Mess / tempat tinggal - Lamaran lengkap + pas photo terakhir. Lamaran ditujukan ke : Jl. Jend Gatot Subroto No. 6-D /10-D Medan

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain?




CU CI + B . PASAN G Kulkas, M. Cuci, Dispenser H u b . M a j u Te k n i k - 0 6 1 .7 0 3 0 1 1 8 - 0813 6244 4913


DI J U AL 2 nd : Mixer mx 182 Y, Inter M (2.0). Power 1500 w, 2000 W, BMB Drox 55 (c) Daj7 II, Dar 800, 500, 1000, EQ Dod, Yamaha, Terima Visa 0 %. Jln Indragiri Dkt Asia 7 3 4 5 4 8 7

KENANGA CITI HOTEL My Residence in Medan

J l. Sisinga m a nga ra ja N o. 8 2 Medan Te lp. (0 6 1 ) 7 3 4 .2 1 0 6





HP. 0813 7035 7291 0813 6210 8239

Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

Ada Garansi

T U M PAT / S A L . A I R

8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim


Luar Negeri

WASPADA Kamis 6 Februari 2014


Badai Salju Hantam 2/3 Daratan AS KANSAS CITY, AS (Antara News): Badai salju yang tidak biasa menghantam bagian tengah Amerika Serikat, bergerak menuju timur dan mengancam sekitar duapertiga negara itu dengan salju yang menurut prakiraan bisa sampai setebal 30 cm. Badai itu memaksa penutupan banyak kantor negara bagian dan sekolah di Kansas, daerah yang paling parah terdampak badai. Gubernur Kansas Sam Brownback mengumumkan ke-

adaan ‘darurat bencana.’ PihakberwenangdiKansasdan Missourimenganjurkanwargatetap tinggal di rumah dan National WeatherService(NWS)memperingatkanperjalananakanjadisangat

Rusia: 32 Gerbong KA Bawa Gas Terjungkal Dan Terbakar MOSKOW, Rusia (AP): Kementerian Situasi Darurat Rusia mengatakan puluhan gerbong kereta api yang membawa gas telah terjungkal dari rel dan terbakar di timurlaut Moskow, yang memaksa dievakuasinya ratusan warga yang tinggal dekat lokasi kecelakaan. Kementerian itu mengatakan bahwa kecelakaan itu terjadi Rabu (5/2) di stasiun kereta api Kirov, kota yang terletak kira-kira 800 km di timurlaut Moskow, ketika 32 gerbong yang penuh dengan gas terjungkal dari rel dan terbakar. Tidak ada korban cedera dalam peristiwa itu. Lebih lanjut kementerian itu mengatakan kebakaran besar menghanguskan satu kawasan luas di sekitar stasiun, yang memaksa pengevakuasian kira-kira 700 penduduk dari sejumlah gedung apartemen di dekat kawasan itu. Beberapa ratus pekerja darurat terlibat dalam usaha memadamkan api, yang telah memutuskan lalulintas di kawasan rel KA TransSiberia. (m10)

sulit. Setidaknya dua orang tewas dalam kecelakaan mobil di Crawford County di Kansas Timurlaut akibat kondisi cuaca yang berbahaya, kata para pejabat negara bagian itu seperti dikutip kantor berita Reuters Selasa (4/2). Garda Nasional Kansas mengerahkantentaradankendaraan Humveeuntukmengangkutpara pekerja medis dan membantu pengendara motor yang terdampar. “Kami masih berada dalam kondisi sulit ke depan karena salju akan turun saat salju turun diikuti anginkencangdantemperaturyang sangat dingin,” kata Brownback. “Perjalanan akan tetap berbahaya dan temperatur akan sangatdingindanberbahaya,”katanya. Kondisi sangat buruk terjadi di bagian Interstate 70, jalan raya penting yang menghubungkan

KansasCitydanSt.Louis,Missouri, tutup di kedua arahnya Selasa pagi dekat Columbia, Missouri, setelah beberapa traktor bertabrakan, demikian menurut Patroli Jalan Raya Missouri. “KansasCitydanKansastimur akandilandabanyaksaljulagi,”kata Greg Carbin, ahli meteorologi di PusatPrediksiBadaiNWS.Sejumlah kecelakaan dilaporkan terjadi di Missourisaatmobiltergelincirdari jalan raya licin, kata patroli jalan raya negara bagian itu. Salju setebal 18 cm turun daerah Kansas City menjelang awal petang, dan lebih banyak salju akanturunsetelahbadaibergerak ke timurlaut Rabu (5/2) pagi waktu setempat, kata NWS. Salju tebal dan es bergerak melalui daerah tengah Amerika Serikat menuju ke timur laut me-

masukiPennsylvania,NewYorkdan NewEngland,kataparaahlicuaca. Dan hujan deras bisa mengakibatkanbanjirdiseluruhTennessee Valley Ohio Valley, demikian menurutNWS.Lebihdari9.500penerbanganditangguhkandiseluruh negaraitupadaSelasadanhampir 1.800penerbangandibatalkan,kata,yangmengawasi lalu lintas udara. Badai itu terjadi Senin malam di Kansas barat daya dan memuncak di Kansas City Selasa. Bencana ini tidak biasa terjadi, kata ahli meteorologi NWS Dan Hawlitzel, karena hanya sekitar tiga persen badai saju yang melanda Kansas City ketebalan saljunya total lebih dari 15 cm. Melihat badai salju mendekat, negara-negara bagian lain mulai berjaga-jaga.

Gubernur Connecticut DannelMalloymenundapidatokenegaraannya sehari dan mengatakan badai yang akan datang itu juga menyebabkan para pemimpin legislatif negara bagian itu menunda sehari sidangnya. “Sayaberharapbadaiinitidak seburuk yang diperkirakan,” kata Malloy saat mengumumkan penundaansesipidatonya.Sekolahsekolah di Providence, Rhode Island, juga diminta menghentikan aktivitas karena badai mendekat. Gubernur New Jersey Chris Christie menyatakan kondisi darurat dan menginstruksikan penutupan kantor-kantor negara bagian Rabu. New York mengeluarkananjuranperjalananuntuk Rabu danWali Kota Bill de Blasio meminta warga bersiap-siap untuk perjalanan yang sulit.

MANILA, Filipina (Antara/Xinhua-0ANA): Operasi Kepolisian Nasional Filipina (PNP) Selasa menangkap 10 warga Korea Selatan yang diduga terlibat dalam operasi judi gelap online di Filipina, kata seorang pejabat polisi Rabu (5/2). Kepala Kelompok AntiCyber PNP Inspektur Senior Gilbert Roa mengatakan para tersangka ditangkap setelah polisi menggerebek sebuah kondominium mewah di Taguig City di wilayah ibu kota Filipina Metro Manila. Roa mengatakan, polisi menemukan berbagai macam bukutabungan,ponselberbagaimacam,kartuidentifikasi,berbagai macam dokumen, laptop, perangkat jaringan, unit telepon, komputer desktop dan berbagai macam kartu yang diyakini digunakan dalam kegiatan ilegal mereka. Dia mengatakan, para tersangka diyakini mengoperasi sebuah bisnis perjudian online ilegal yang dilindungi oleh bos-bos taruhan Korea yang melakukan pembayaran secara online atau melalui kartu kredit. Hanya dua dari delapan orang yang dicari oleh Interpol ditangkap selama operasi. Mereka diidentifikasi sebagai Lee Youn Jin Ju dan Ho Lee.

Polisi Thai: Maju, Penyelidikan Bentrokan Di Simpang Laksi BANGKOK, Thailand (Bangkok Post): Polisi mengungkapkan Rabu (5/2) tercapainya kemajuan penyelidikan atas penembakan yang terjadi di persimpangan Laksi. Deputi Kepala Polisi Nasional Ek Angsananon mengatakan hasilpenyelidikankejahatan,fotodanrekamanvideomenyimpulkan bahwa ada sebanyak 21 orang yang membawa, memegang dan menembakkan senjata api. Tiga dari21 orang bersenjata itu telahdikenalidan polisi berusaha mendapatkan surat penangkapan mereka. Para penyelidik belum dapat menjelaskan apakah ketiga orang tersangka adalah petugas kepolisian atau militer karena penyelidikan masih berlangsung. Polisi juga mencari satu kendaraan yang mirip dengan van pengiriman barang yang membawa senjata ke kawasan Laksi yang berhasil direkam video. Jend. Pol. Ek mengatakan semua tersangka yang terlibat dalam bentrokan bersenjata Sabtu, termasuk anggota polisi dan militer yang ikut terlibat, akan diadili. Diamengatakanparapenyelidiktelahmempercepatpenyelidikan terhadapinsidenkerusuhanbesarsejakbentrokandiRamkhamhaeng pada 30 November lalu, namun banyak saksimata dalam beberapa kasus harus tampil bila diminta untuk memberikan kesaksiannya di depan polisi . (m10)


Obama Bahas Pasukan AS, Karzai Berunding Dengan Taliban WASHINGTON/KABUL (Reuters): Presiden AS Barack Obama bertemu dengan para panglima militer senior untuk membahas kehadiran pasukan Amerika di Afghanistan di saat para pejabat di Kabul membenarkan kalau Presiden Hamid Karzai mengadakan pembicaraan rahasia dengan pemberontak Taliban. AS mengatakan, pihaknya menyambut pembicaraan yang akan menciptakanperdamaiandiAfghanistan.“Pentinguntukmenekankan di sini bahwa kita telah lama mendukung rekonsiliasi yang dipimpin Afghanistan,yangtentusajaberupapembicaraanantarorangAfghanistan sendiri,” kata jubir Deplu AS Jen Psaki Selasa (4/2). “Jadi anggapan bahwa kita tidak mendukung dialog adalah hal yang tidak benar.” Dia menambahkan bahwa AS tidak akan berunding dengan Taliban. Di Kabul, jubir Karzai membenarkan laporan New York Times bahwa pemerintah sedang bicara dengan Taliban dengan harapan bisa membujuk mereka untuk menciptakan perdamaian. “Saya bisa pastikan bahwa.. Taliban sangat senang bisa terlibat dalam proses perdamaian,” kata Aimal Faizi.“Kontak telah dilakukan dan kita juga telah menghubungi mereka,” Seorang anggota Dewan Perdamaian Tinggi Afghanistan juga membenarkan bahwa pembicaraan telah berlangsung. “Pembicaraan berlangsung di Dubai tiga minggu lalu antara pejabat pemerintah dan Taliban yang terbang dari Doha, namun kami masih menunggu hasilnya,” katanya kepada Reuters. Pejabat Barat dan Afghanistan yang bicara dengan Times juga mengatakan pembicaraan tersebut sedikit membuahkan hasil. Sejauh ini bahkan tidak membuka perundingan bagi perjanjian perdamaian, kata suratkabar itu.(m23)

10 Warga Korsel Ditangkap Karena Judi Gelap Di Filipina

3 Saudara Bunuh Ibu Kandung Dan Memakan Mayatnya The Associated Press

DALAM foto yang disiarkan Kementerian Keadaan Darurat cabang Kirov menunjukkan bahwa para petugas pemadam kebakaran menyaksikan gerbong-gerbong kereta api yang membawa gas terbakar Rabu (5/2) pagi dekat Posdino di kawasan Kirov, Rusia, kira-kira 800 km timurlaut Moskow. 32 Gerbong terguling dan 12 di antaranya terbakar, tidak ada korban.

Libya Musnahkan Senjata Kimia

Dua Korea Setuju Lakukan Reuni Keluarga Bulan Ini

TRIPOLI,Libya(CNN):Libyamengatakansenjatakimianya,termasuk peluru artileri dan bom berisi gas mostar, telah dimusnahkan. Pemusnahanitu,yangdituntaskanbeberapaharilalu,merupakan ‘tindakan penting’ bagi Libya dalam memenuhi kewajibannya sesuai konvensi senjata kimia, demikian menurut Kementrian Luar Negeri Libya Selasa (4/2). “Libya telah bebas dari senjata kimia yang menjadi ancaman bagi keamanan komunitas lokal, lingkungan dan negara tetangga,” kata Kemlu itu. Menurut Andrew C. Weber, Asisten Menteri Pertahanan AS untuk program pertahanan senjata nuklir, kimia dan biologi, senjata yang dimusnahkan adalah: 517 peluru artileri berisi gas mostar, delapan bom seberat 250 kilogram yang berisi gas mostar dan 45 tabung berisi gas mostar. “Kami memastikan senjata-senjata tersebut tidak pernah jatuh ke tangan ekstrimis, sehingga kami mencegah terorisme dengan senjata pemusnah massal,” kataWeber kepada wartawan di Tripoli. Operasi pemusnahan itu yang berlangsung beberapa bulan lalu merupakan upaya bersama yang melibatkan warga Libya yang dilatih untuk tugas tersebut, dibantu tenaga teknis dan bantuan logistic dari AS, Jerman dan Kanada. Tahap berikutnya adalah persiapan bagi pemusnahan ‘dasar senjata kimia’ atau kimia Kategori 2, menurut Organisasi Larangan Senjata Kimia. Para pejabat mengatakan, pemusnahan dasar senjata kimia tersebut diperkirakan akan tuntas sampai akhir 2016.(m23)

SEOUL, Korea Selatan (AP): Korea Selatan (Korsel) dan Korea Utara (Korut) setuju Rabu (5/2) untuk mengadakan reuni keluarga pertama dalam tiga tahun terakhir ini setelah mereka terpisah akibat Perang Korea. Pertemuan yang dilakukan akhir bulan Februarimerupakansatulangkah maju menuju peredaan ketegangan meski Korut marah atas latihan militer gabungan antara Korsel dan Amerika Serikat. Banyak orang menganggap skeptisdiSeoulbahwaKorutakan setuju untuk mempercepat reuni dramatis itu karena latihan militer tahunanyangtelahdirencanakan SeouldanWashingtonakhirbulan ini juga. Korit menyebut latihan itu suatu gladi menuju invasi dan menggunakan latihan tahun lalu untuk melontarkan berbagai ancaman dan provokasi bahwa

hubungandiSemenanjungKorea masih ditutupi kabut. Korut juga membatalkan satu rencana reuni pada September setelah melontarkan tuduhan Korsel merencanakan latihan perang dan tindakan bermusuhan lainnya. Negara itu menyerukan lagi pembatalan latihan militer tahunan itu. Seoul danWashington menyatakan latihan mereka itu murni pertahanan dan menolak untuk membatalkannya. Kedua Korea mengadakan pembicaraan untuk melanjutkan pembahasan mengenai penyelenggaraan reuni keluarga yang terpisah oleh Perang Korea - sebuah isu krusial yang diduga telah dieksploitasi oleh Korut sebagai “alat tawar-menawar”. Pertemuan kedua belah pihak di desa Panmunjom, daerah perbatasan untuk gencatan sen-

jata,bertujuanuntukmenetapkan tanggal acara reuni keluarga Korea, yang merupakan ajang langka yang dilakukan kembali sejak 2010. Kesepakatantentangpelaksanaan reuni itu akan menjadi suatu tanda kemajuan antara dua rival yang dalam beberapa tahun terakhir ini telah berjuang untuk bekerjasama, bahkan berusaha salingmembangunkepercayaan. Sebelumnya, pembicaraan serupaantaraPalangMerahKorut dan Korsel Agustus tahun lalu diakhiri dengan kesepakatan untuk mengadakan reuni pada bulan berikutnya bagi beberapa ratusanggotakeluargaKoreayang terpisah. Namun, pada saat prosesseleksiselesaidanparaanggota keluarga yang terpilih bersiap untuk berkumpul di resor Gunung Kumgang, pihak Korut tibatiba membatalkan reuni itu, yakni empat hari sebelum acara reuni dengan alasan adanya sikap“permusuhan” dari pihak Korsel.

Berdasarkan pengalaman itu, ada kekhawatiran besar bahwa acara reuni kali ini akan kembali gagal dan mengecewakan banyak anggota keluarga. Korsel akan memulai latihan militer gabungandenganAmerikaSerikat pada akhir Februari, meskipun Koruttelahmemperingatkanakan ada “konsekuensi” jika kedua negara itu tetap melaksanakan latihan militer tersebut. Latihan militer tahunan Korsel-AS selalu menjadi isu diplomatik di semenanjung Korea, dan tahun lalu hal itu mengakibatkan ketegangan militer yang meningkat antara Korsel dan Korutselamabeberapaperiode.“Kami akan melakukan yang terbaik untuk membawa kabar baik bagi keluarga Korea yang terpisah,” kata kepala delegasi Korsel Lee Duck-Hang sebelum meninggalkan Seoul untuk menuju Desa Panmunjom. (m10)

Gema Internasional

MANILA, Filipina (Waspada): Tiga bersaudara di Ampatuan, Filipina, membunuh ibu kandung mereka sendiri dan memakan mayatnya. Diduga, ibu mereka dibunuh dalam sebuah ritual pengusiran setan. Menurut Daily Mail, Selasa (4/2), polisi menemukan jasad Musala Amil, wanita 56 tahun, itu dalam keadaan tidak utuh di peternakan Purok Nabadtog, Barangay Kamasi. Beberapa organ dalam tubuhnya hilang dan darahnya dikeringkan. Menurut pengakuan tetangga, mereka mendengar suara aneh dalam rumah korban selama beberapa hari terakhir sebelum mayat ditemukan. Ketiga putranya, Dante, 35, Paroy, 21, dan Ibrahim, 18, diduga membunuh ibunya dengan parang dan memakan organ dalamnya mentah-mentah. Tokoh adat di wilayah tersebut mengatakan bahwa ketiganya telahmembunuhibumerekadanmemakantubuhnyasepertibinatang liar. Ketiganya membantah telah membunuh ibu mereka.Tersangka yang merupakan warga etnis Moro mengaku tengah melakukan ritualpengusiransetanyangmenyebabkansakitpadakeluargatersebut. Polisi menyelidiki kemungkinan adanya gangguan mental pada pelaku. Polisi juga mencari kemungkinan penyalahgunaan narkoba oleh para pelaku.(vn/r-m10)

AS Kurangi Serangan Pesawat Tanpa Awak Di Pakistan ISLAMABAD,Pakistan(Reuters):ASmengurangiseranganpesawat tanpa awak di Pakistan setelah pemerintah Islamabad meminta pengekangandiridisaatmerekamengupayakanpembica-raandamai dengan Taliban Pakistan, lapor Washington Post. SuratkabaritumengutipketeranganpejabatASyangmengatakan “Itu yang mereka minta, dan kita tidak bisa bilang‘tidak’.” Suratkabar itu mengatakan Selasa (4/2), serangan semacam itu telah dihentikan sejak Desember, jeda waktu terpanjang sejak 2011. SuratkabaritumengatakanpemerintahObamamengindikasikan pihaknya akan melanjutkan serangan terhadap pejabat senior alQaidajikamerekaadaataumerencanakanancamanbagiwargaAmerika. WashingtonPostmengutipketeranganpejabatseniordipemerintahan Obama yang membantah tentang adanya perjanjian tidak resmi, dengan mengatakan “Masalah apakah akan berunding denganTalibanPakistansepenuhnyamasalahdalamnegeriPakistan.” PM Pakistan Nawaz Sharif mengatakan, dia menginginkan serangan pesawat tanpa awak itu dihentikan. Suratkabar itu mengatakan, penghentian sementara serangan AS berlangsung setelah serangan November lalu menewaskan pemimpin Taliban Pakistan Hakimullah Mehsud.(m23)

Iran Dan Stabilitas Regional SEKITARMeidanJunitahun ini,persetujuansementaraJenewa IImengenaiprogramnuklir Iran akanberakhir,tinggalmenunggu langkah lebih lanjut baik oleh negara-negara anggota DK PBB plus Jerman maupun Iran . Sementara menghadapi situasi ini, Iran nampaknya mulai berpikir bahwa demi ketenteramankawasanTimurTengah,pemerintahan Iran mulai melihat bahwa Dunia Arab akan lebih stabil apabila ada kesamaan pandangan sesama negara di kawasan ini.Terlebih lagi dipicu dengan situasi Syria yang masih dilandakonflik.Intinyaharuslah dicarikan solusi yang terbaik terhadap krisis Syria, dengan demikian,kekonpakansesamanegara Arab akan mengarah pada stabilitas regional. Pemerintahan Iran saat ini dianggap “moderat” dan ingin kembali bergabung dalam kerjasama internasional. Langkah positif yang diambil Iran sebagaimana diungkapkanolehMenteriLuarNegeriMohammadJavadZarif,menghimbau negara-negara Teluk untuk mengatasi perbedaan dan bekerjsama bagi stabilitas regional. Diharapkanbahwasemuanegara di kawasan perlu memisahkansektarian yangmengandung ancaman kekerasan dan ekstrimisme,khususnyadiSyria.Diperlukan kerjasama untuk mengakhiri kekerasan yang menghasilkan solusi politik, menghentikan tragedi yang memalukan keduanya, Sunni dan Syi’ah.

Situasi konflik yang menyangkut perbedaan keyakinan ini memang memalukan dunia Islam,terlebihlagibagiduniaArab sendiri, seharusnya perlu realisasi bahwa pemisahan ini tidak akan membantu negara-negara Arab memecahkan masalahnya. Oleh karena itu Iran merasa perlu mengirim Menlunya ke KuwaitdanOmanuntukmelakukan pertemuan berkenaan dengan perjanjian nuklir baru-baru ini dengan world power dalam hal ini AS, Inggris, Russia, China, dan Prancis plus Jerman. Kunjungannya ke Doha pun untuk meyakinkan negara-negara Teluk bahwa persetujuan yang dicapai dan ditandatangani di Jenewa adalah untuk kepentingan bersama. Iran yakinkemungkinanakantercapai perjanjianyangpermanendengan Barat mengenai program nuklir Iran, namun diperlukan kepercayaan dan kemauan baik. Sanksi yang diberlakukan terhadap Iran boleh dikatakan gagal berpengaruh pada program pengayaan nuklir Iran dan pruduktivitasmesin-mesincentrifugal. ‘Hasil bersih’ sanksi ini bagi Iran yaitu tercapainya sekitar 18,800 centrifugal yang ditambahkan pada persediaan Iran. Namunbegitu,JenPsaki,JurubicaraDepluASmenyatakanbahwa sanksi terhadap Iran sangat berpengaruh bagi ekonomi Iran. Walaupun faktanya Iran telah membuat kemajuan dalam pengayaan dengan pembangunan, itulahsebabnyaASmeningkatkan

sanksinya. Persetujuan nuklir Iran yang dicapai di Swiss 24 November lalu disambutbaikolehpemerintahan Sunni negara-negara Teluk yang telahlamaprihatindenganambisi regional Iran. Tetapi pemerintah Arab Saudi bereaksi dengan hatihati, negara ini menyatakan bahwa perjanjian ini dapat menjadi tanda langkah pertama terhadap solusi yang komprehensif bagi program nuklir Iran. Menlu Iran Javad Zarif menyuarakan harapan akan mengunjungi Arab Saudi sesegera mungkindanjugaUAEyangmenlunya mengumumkan akan mengunjungi Tehran dengan tujuan UAE siap membentuk komisi kerjasama ekonomi dengan Iran. MenluZarifjugamemberikan pujian pada peranan Oman dalam negosiasi bulan lalu antara Iran dan world powes yang telah memberi jalan sebagai milestone persetujuan nuklir. Menurut laporan, Sultan Oman bertindak sebagaituanrumahpembicaraan rahasia antara Iran dan AS yang menyetujui enam bulan persetujuan bagi program nuklir Iran. Tidak seperti Arab Saudi yang menjadirivalyanglamabagiSyi’ah yangmendominasipemerintahan Iran, Oman mempertahankan hubunganyangbaikdenganIran. Menteri-menteri luar negeri Teluk atau Gulf Co-operation Council (GCC) melakukan pertemuan di Kuwait City bulan lalu, menyatakanharapanbahwa‘deal sementara’ akan mengarah pada

permanent agreement bagi program Nuklir Iran. GCC yang dipimpinolehArabSauditermasuk Bahrain,Kuwait,Oman,Qatar, dan UAE. Setelah terpilih Juli tahun lalu, Presiden Iran Hassan Rouhani berucap bahwa dia menginginkan untuk meningkatkan hubungan dengan negara-negara tetangganya, khususnya dengan negarap-negara Teluk. Nampak di sini bahwa Iran denganpemerintahanbaruyang dianggap ‘moderat’ jika dibandingkan dengan penguasa-penguasaIransemenjakPemimpin Tertinggi Ayatullah Khomeini cenderungdianggapekstrimdan setelah Ali Khamenei sebagai penerusjabatanpemimpinterting-gi Iran melihat bahwa perlu perubahan sistem pelaksaan pemerintahan Iran tidak lagi berperilaku keras namun memperlihatkan sikap ‘moderat’ setelah Hassan Rouhani memegang tampukkekuasaan.Mungkinpula Iraninginmengubahpan-dangan bahwaIransedang‘memersiapkan diri’ mengambil peran sebagai ‘pemimpin baru’ dunia Arab denganharapanstabilitasregional terjaga, dan Iran akan bersamasamade-ngannegara-negaraArab meng-hadapi ‘musuh bersama’ yangdatangdariluar. OlehkarenaitulahIraningin mengembangkanpembicaraan tentang adanya “perbedaanperbedaan” yang ada dicarikan solusi menyeluruh bagi kepentingan Dunia Arab. (Kosky)



WASPADA Kamis 6 Februari 2014

Friulani Lanjuti Mimpi ROMA (Waspada): Udinese melanjuti mimpi indahnya di awal tahun 2014 , Selasa (Rabu WIB), saat mengkandaskan Fiorentina 2-1 pada leg pertama semifinal Coppa Italia di Stadion Friulli, Udine.


Angsa Putih Pecat Laudrup SWANSEA (Antara/Reuters): Swansea City telah memecat pelatih Michael Laudrup (foto), setelah klub itu hanya unggul dua angka dari zona degradasi Liga Utama Inggris. “Ini merupakan keputusan yang kami ambil dengan enggan. Namun ini keputusan yang kami ambil demi kepentingan Swansea City Football Club dan para pendukung kami,” kata Ketua Swansea Huw Jenkins, seperti dilansir Reuters, Rabu (5/2). Kekalahan 0-2 Si Angsa Putih dari tuan rumah West Ham United, Sabtu lalu, yang merupakan kekalahan keenam dari delapan laga liga terakhir, menjadi pemicu pemecatan pelatih asal Denmark itu.


“Ini pertama kalinya hampir dalam sepuluh tahun, klub berpisah dengan pelatih melalui cara seperti ini. Tapi kami harus menghapus keti-

dak pastian konstan yang mengelilingi klub dan masa depan jangka panjang Michael bersama kami,” jelas Jenkins. Ditambahkan, awalnya Angsa Putih akan memilih mempertahankan Laudrup, namun kemudian dinilai tak akan mempengaruhi stabilitas tim. Buat sementara, The Swans akan ditangani duet caretaker Garry Monk dan Alan Curtis. Laudrup datang dua musim lalu untuk menggantikan peran Brendan Rodgers yang membawa Swansea meraih trofi bergengsi untuk pertama kalinya dalam usia 100 tahun, yaitu Piala Liga Inggris 2013. Sukses ini membawa Rodgers ke Anfield untuk menukangi Liverpool.

Ibra Spektakuler PARIS (Waspada): Paris Saint Germain mencapai final Piala Liga Prancis, Selasa (Rabu WIB), setelah dengan susah payah mengatasi tuan rumah Nantes 2-1. Dalam duel semifinal di Stade de la Beaujoire itu, striker Zlatan Ibrahimovic (foto) kembali menjadi pahlawan dengan memborong kedua gol Les Parisiens. Ibra bahkan mencetak gol spektaluer dengan tendangan voli yang mengecoh kiper Nantes Remy Riou. “Kami lolos ke final, jadi kami semakin dekat dengan target musim ini. Kami memenangi laga, saya mencetak dua gol, tapi ini belum selesai,” ujar Ibra melalui situs resmi PSG, Rabu (5/2). Gol pertama bomber ber-

umur 32 tahun itu menit kelima yang menjadi sorotan, memanfaatkan blunder Riou. Kiper berkepala pelontos itu gagal membuang bola dengan sempurna setelah menerima backpass dari salah seorang bek Nantes. Kondisi lapangan licin akibat hujan, membuat tendangan Riou tidak sempurna. Bola mengarah ke Ibra yang berdiri sekitar 30 meter dari gawang. Dengan sekali sentuhan, dia langsung melepaskan tendangan voli indah, yang tidak mampu dijangkau Riou. Ibra memang sering mencetak gol spektakuler. Penyerang jangkung Swedia ini berhasil merebut gelar FIFA Puskas Awards 2013, karena gol saltonya yang luar biasa saat

“Mimpi kami berlanjut, bahkan semuanya mungkin saja terjadi. Saya menyukai tim saya, tapi saya juga suka Fiorentina,” ucap Francesco Guidolin, allenatore I Friulani, seperti dilansir RAI Sport, Rabu (5/2). Bermain di hadapan publiknya sendiri, Stadion Friuli, Udinese langsung tancap gas menyerang benteng La Viola. Namun gol pembuka Udinese baru tercipta menit 36 melalui kapten Antonio Di Natale. Berawal dari umpan sodoran Silvan Widmer, Di Natale (foto) yang lolos dari kawalan bek lawan dengan mudah memasukan bola ke gawang tim tamu. Tetapi Fiorentina mampu menyamakan kedudukan jelang berakhirnya babak pertama. Juan Vargas melepaskan sepakan keras dari jarak jauh, yang tak mampu diamankan kiper Simone Scuffet. Memasuki babak kedua, Friulani dan Viola terlibat jual beli serangan. Beberapa peluang pun terjadi hingga pertengahan babak kedua, namun tak ada satupun yang menjadi gol. Menit 82 sepakan Luis Muriel mulus menjebol gawang kiper tamu, Norberto Murara. Kedudukan 2-1 bertahan hingga bubaran pertandingan. “Kami tahu ini akan sulit, tapi kami masih terbuai mimpi itu. Saya tak tahu apakah kami


melawan Inggris. Bek Nantes Olivier Veigneau sempat menyamakan kedudukan menit 81. Ibra kemudian memulihkan keunggulan tim tamu menit 90. Les Parisiens pun menembus final

untuk menjajal pemenang semifinal Olympique Lyon melawan Troyes. “Masih ada satu laga tersisa sebelum mengangkat trofi,” beber mantan bomber AC Milan, Barcelona, Inter Milan dan Juventus tersebut. “Tim saya mungkin agak lelah, tetapi mereka menghindari perpanjangan waktu dan itu sangat bagus bagi kami,” jelas Laurent Blanc, pelatih Les Parisiens. Dia merasa lega, karena skuadnya mampu menghentikan perlawanan hebat Nantes. “Di babak pertama, Nantes menolak bermain. Di babak kedua, mereka menyadari tidak bisa menang tanpa mengubah gaya. Mereka main lebih ke depan,” pungkas Blanc. (m15/vvn/afp)

British Airways Kampanye Anti Prostitusi Bawah Umur LONDON ( Wa s p a d a ) : Maskapai penerbangan Inggris, British Airways, berencana menayangkan video kampanye anti prostitusi bawah umur dalam semua penerbangan ke Brazil selama berlangsungnya Piala Dunia 2014. Kampanye itu merupakan program Happy Child International, Jubilee Campaign dan A21 Campaign. Menurut Huffington Post, Rabu (5/2), video itu akan menampilkan bek Brazil yang saat ini memperkuat Chelsea, David Luiz. “Tolong bantu untuk melindungi anak-anak kami,” pinta Luiz, kekasih Sara Medeira (foto), lewat video yang akan tayang selama penerbangan British Airways ke Negeri Samba pada Juni-Juli 2014. Prostitusi bawah umur di Brazil memang cukup mengkhawatirkan. Berdasarkan data Unicef, kini di negara itu ada sekitar 250 ribu pekerja seks di bawah umur. Jumlahnya diramalkan akan bertambah selama Piala Dunia. Upaya ini mendapat dukungan dari manajer Timnas Inggris Roy Hodgson. “Kampanye ini merupakan salah satu yang penting untuk me-

ningkatkan kesadaran kalau sesuatu yang menjijikkan masih terjadi,” jelas Hodgson. Mantan pelatih Liverpool dan Fulham itu menganggap, kampanye bertajuk “It’s a Penalty” tersebut akan menjadi pembelajaran bagus untuk suporter The Three Lions. Sedangkan Johnny Gwynne, Presiden National Crime Agency (NCA) Inggris, memperingatkan suporter untuk menjauhi prostitusi di bawah umur selama berada di Negeri Sama. Sebab, suporter yang terlibat masih bisa diadili di Inggris. “Anda mungkin berpikir bisa melakukan sesuatu di Brazil, lolos dan kembali ke Inggris. Tapi, Anda masih bisa menjalani pengadilan di Inggris,” ancam Gwynne. Di Inggris sendiri, pengusaha pub dan café kembali ceria, karena pemerintah setempat mempertimbangkan lagi izin untuk menambah jam operasi saat berlangsungnya Brazil 2014. Perdana Menteri Inggris David Cameron bahkan sudah meminta kepada Home Office, departemen yang mengurusi masalah imigrasi dan keamanan dalam negeri, memberikan izin kepada pub dan café untuk menambah jam operasi, yang biasanya mesti tutup

Arah Benar Curitiba RIO DE JANEIRO (Antara): Sekjen FIFA Jerome Valcke, Rabu (5/2), menyatakan keyakinannya bahwa pembangunan Stadion Curitiba sebagai salah satu arena Piala Dunia 2014, sudah berada di arah yang benar. Padahal bulan lalu, Valcke sempat mengeluarkan ancaman Curitiba bisa dicoret sebagai penyelenggara empat laga babak penyisihan grup. Sikap Valcke kemudian melunak dan melalui surat elektronik menyatakan, FIFA menilai semua sudah berjalan dengan baik. Curitiba sebelumnya dinilai paling lamban dibanding 11 stadion lainnya yang akan menjadi tuan rumah Piala Dunia pada 12 Juni-13 Juli mendatang.

pukul 11 malam GMT. Masalahnya, ada perbedaan waktu antara Brazil dan Inggris. Laga Piala Dunia 2014 digelar rata-rata pada tengah malam GMT. Duel Inggris menghadapi Italia pada 4 Juli di Grup B, bahkan baru dimulai pukul 11 malam waktu Inggris. Penambahan jam buka pub dan cafe sempat diberikan ketika kerajaan Inggris merayakan 60 tahun tahta Ratu Inggris pada 2012, juga pernikahan keluarga kerajaan pada 2011. (m15/vvn/hftp/bbc)


akan sampai ke sana (final), tapi kami akan berusaha,” klaim Guidolin. Pada leg kedua, giliran Udinese tandang ke markas Fiorentina di Artemio Franchi, 12 Februari mendatang. Udinese terakhir kali mencapai final Piala Italia tahun 1992 silam. “Saya senang dengan gol saya, tapi lebih senang lagi karena ini memberi kami kemenangan penting. Kami punya keunggulan dan itu penting untuk bisa mencapai final,” jelas Luis Muriel. “Saya berharap untuk mulai dari awal. Tapi pelatih membuat keputusan dan saya bermain dengan ketajaman yang sama seperti saat saya menjadi starter,” katanya menambahkan. Hanya saja Fiorentina juga tak kalah yakin untuk membalikkan keadaan pada semifinal kedua. Allenatore Vincenzo Montella malah merasa, La Viola semestinya bisa menang di Friuli. “Mungkin kami terlalu memberi banyak ruang pada Muriel dan dia menentukan pertandingan. Kami seharusnya bisa berbuat lebih, tapi secara keseluruhan kami bermain bagus,” ucap Montella. “Ini merupakan salah satu laga terbuka untuk hasil apa pun. Jadi, Fiorentina bisa menang dan berakhir dengan kekalahan. Kami tahu Udinese klub bagus,” tambahnya. Semifinal lainnya mempertemukan AS Roma kontra Napoli. Montella optimis skuadnya berpeluang lolos untuk menantang Roma atau Napoli. “Ini sepenuhnya masih terbuka. Setelah Udinese menang di leg pertama, saya bisa katakan kalau mereka punya peluang 51 persen untuk lolos,” pungkas Montella. (m15/goal/rai/tf)


GELANDANG Fulham Pajtim Kasami (tengah) terjengkang dikeroyok pemain Sheffield United di Craven Cottage Stadium, London, Rabu (5/2) dinihari WIB.

Cottagers Tragis LONDON (Waspada): Fulham bernasib tragis lagi, Selasa (Rabu WIB), setelah menelan kekalahan 0-1 akibat gol di menit akhir perpanjangan waktu pada laga ulang babak keempat Piala FA melawan Sheffield United. Shaun Miller yang memberikan pil pahit buat The Cottagers di Craven Cottage, London. Golnya menit 120 menjebol gawang kiper David Stockdale sekaligus membawa tim strata kedua Inggris itu melaju ke putaran kelima menghadapi pemenang laga Preston kontra Nottingham Forest.

Laga berlangsung monoton di babak pertama, sehingga tidak banyak peluang tercipta. Bek Sheffield Bob Harris mendapat peluang memecah skor di babak kedua, namun sepakannya saat mengeksekusi tendangan bebas masih melebar. Suporter tuan rumah mulai gelisah dengan penampilan Fulham. Pelatih Rene Meulensteen kemudian memutuskan menarik keluar Hugo Rodallega di sisa 30 menit laga, karena bermain tidak efektif di lini depan. Penggantinya Ashkan Dejagah masih gagal mengangkat mutu serangan Cottagers. Skor duel tetap tidak berubah hingga waktu normal berakhir, sehingga dilanjutkan ke per-

Fulham 0 67% 14 2 2 16 3 2 0


1 Skor Akhir Penguasaan Bola 33% 20 Tembakan Total 3 Tembakan Tepat 2 Penyelamatan 13 Pelanggaran 1 Offsides 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

panjangan waktu 2x15 menit. Tujuh menit perpanjangan waktu digelar, Sheffield memasukkan Shaun Miller untuk menggantikan Steven Scougall. Keputusan manajer Nigel Clouh terbukti jitu. Memasuki menit 120, Miller melepaskan sundulan keras setelah menjangkau umpan silang Harry Maguire dan si kulit bundar melesak ke gawang kiper Stockdale. (m15/goal/uefa)

Mertesacker Aneh Dengar Statistik LONDON ( Wa s p a d a ) : Duet bek sentral Per Mertesacker (foto kanan) dan Laurent Koscielny (foto kiri) di jantung pertahanan Arsenal, telah menghasilkan statistik mengesankan dalam dua tahun terakhir. Setiap kali bermain dengan duet Mertesacker-Koscielny sejak 22 Januari 2012, The Gunners bahkan belum sekalipun menelan kekalahan. Mereka telah melakoni 31 partai dan 22 di antaranya berakhir dengan kemenangan. “Saat saya pertama kali mendengarnya, (statistik) itu tampak aneh. Itu statistik yang bagus, tapi dari situ, kami harus mengembangkannya (jadi gelar),” ujar Mertesacker melalui situs resmi Arsenal, Rabu (5/2). Duet Mertesacker-Koscielny juga menorehkan catatan gemilang, hanya kebobolan satu gol dari 11 laga kandang terakhir Meriam London. Bek jangkung Jerman itu berharap, catatan impresif itu membawa Gunners meraih trofi Liga Premier dan juga trofi lainnya akhir musim nanti.

Sabtu, 8 Februari (GMT) Liverpool v Arsenal Aston Villa v West Ham Chelsea v Newcastle C Palace v West Brom Norwich v Man City Southampton v Stoke Sunderland v Hull Swansea v Cardiff

(1245) (1500) (1500) (1500) (1500) (1500) (1500) (1730)

Minggu, 9 Februari (GMT) Tottenham v Everton Man United v Fulham Getty Images

“Saya pikir, kami telah menunjukkan kepada banyak orang yang mengkritik selama lebih dari 2,5 tahun, bahwa kami sudah jauh lebih baik. Kami saling melengkapi satu sama lain, jadi tampaknya kami duet yang bagus,” beber Mertesacker. Namun dia enggan melupakan bek tengah Arsenal lainnya, Thomas Vermaelen, yang kerap menghangatkan bangku cadangan pasca pulih cedera panjang. Menurutnya, mantan kapten Ajax Amsterdam itu juga punya peran penting bagi Gunners, yang kini memuncaki klasemen Liga Premier.

“Tapi, saya tak akan mengatakan ini hanya untuk kami berdua,” jelasnya. “Saya pikir, saat saya berbicara tentang bek tengah, saya ingin menyertakan Thomas Vermaelen, karena dia kapten kami. Dia punya peran vital bagi kami,” tambah mantan bek Werder Bremen berumur 29 tahun itu. Arsenal selanjutnya menjajal Liverpool pada matchday 25 Liga Premier, Sabtu (8/2). Duet bek dimaksud tentu akan menghadapi ujian berat dari top skor Luis Suarez dan tandemnya Daniel Sturridge di Stadion Anfield. “Mereka pemuncak klase-

(1330) (1600)

men saat ini, tapi kami dapat mempersulit mereka,” tekad Martin Skrtel, bek tengah The Reds. “ Ini tak akan menjadi laga mudah, tapi saya yakin kami dapat melakukan sesuatu di hadapan pendukung sendiri,” katanya menambahkan. Si Merah kini menghuni peringkat terakhir zona Liga Champions, tapi ketinggalan delapan poin dari Arsenal, setelah akhir pekan lalu ditahan 1-1 oleh tuan rumah West Bromwich Albion. “Saya yakin kami mampu mengalahkan Arsenal, karena kami pastinya memiliki kekuatan untuk melakukannya,” tegas Skrtel. (m15/vvn/rtr/espn)


WASPADA Kamis 6 Februari 2014


SMAN 1 Takengen Siap Bersaing Honda DBL Aceh Series TAKENGEN (Waspada): Tim bola basket SMAN 1 Takengen, Kabupaten Aceh Tengah, memastikan ambil bagian dalam ajang Honda Development Basketball League (DBL) 2014 Aceh Series, di GOR KONI Banda Aceh, 10-15 Februari. “Kami akan menurunkan 20 pemain terbaik. Rencananya, tim akan bertolak ke Banda Aceh pada 9 Februari nanti,” kata Manajer Tim Basket SMAN 1 Takengen, Roni Juanda, kepada Waspada, Rabu (5/2). Dijelaskan, keberangkatan tim basket SMAN 1 mendapat dukungan penuh pihak sekolah. Diharapan para pemain dapat menambah banyak pengalaman, sehingga ke depan terbiasa menghadapi kompetisi besar. “Selama ini, pebasket kami hanya rutin berlatih. Jam tanding mereka pun sangat kurang. Dengan mengikuti Honda DBL tahun ini, kami berharap tim basket SMAN 1 mendapat banyak pengalaman, khususnya dalam meningkatkan pola permainan,” katanya.

Ditambahkan, meski tim tidak dipatok target juara, para pemain diharapkan tampil maksimal di setiap laga dan tetap optimis menjadi yang terbaik. Terlebih semua tim dalam suatu turnamen memiliki peluang sama untuk berprestasi. “Informasi kami terima dari panitia, event kali ini akan diikuti 16 tim se Aceh. Meski buta dengan kekuatan lawan, kita tetap punya target, setidaknya bisa melaju ke babak semifinal atau bahkan tampil di partai puncak,” ucap Roni. Ketua Harian Perbasi Aceh Tengah, Illiyandi SE, memberikan apresiasi atas keikutsertaan tim basket SMAN 1 Takengen dalam ajang DBL 2014 Aceh Series. Dia pun berharap tim berjuang maksimal mengharumkan nama daerah. “Kami juga akan ‘mengawal’ keberangkatan tim ke Banda Aceh. Semoga prestasi optimal nantinya bisa diraih anak-anak dan kami berharap muncul atlet-atlet andal bagi masa depan basket Aceh Tengah,” pungkasnya. (cb09)

Waspada/Arianda Tanjung

PEMAIN PSMS Medan menjalani latihan hari kedua di Stadion Kebun Bunga, Medan, Rabu (5/2) sore. Sesi latihan tersebut sebagai persiapan untuk menghadapi kompetisi Divisi Utama Liga Indonesia musim ini.

Pro Duta Andalkan Skuad Lama MEDAN (Waspada): Dalam mengarungi kompetisi Divisi Utama Liga Indonesia musim ini, Pro Duta FC masih tetap mengandalkan sejumlah wajah lama. Setidaknya ada 14 pemain yang dipertahankan, di antaranya pemain kunci Ghozali Muharam Siregar dan Rahmad Hidayat. Media Officer Pro Duta FC, Handoyo Subosito, mengatakan sebagian besar pemain Kuda Pegasus musim lalu ma-

PEMAIN kunci Pro Duta FC di musim lalu, Ghozali, masih menjadi andalan skuad Kuda Pegasus pada kompetisi Divisi Utama musim ini. -Waspada/Arianda Tanjung-

Aceh Tolak Gabung Sumut Tuan Rumah Bersama PON XX/2020 BAND ACEH (Waspada): Aceh memutuskan menolak bergabung dan telah menutup diri terhadap tawaran Sumut untuk menjadi tuan rumah bersama PON XX/2020. Aceh merasa lebih siap maju menjadi tuan rumah tunggal. Hal tersebut disampaikan Kadispora Aceh, Bukhari Aks MM, dalam rapat panitia penyambutan Tim Verifikasi Penjaringan Calon Tuan Rumah PON XX/2020 di Kantor KONI Aceh, Rabu (5/2). Menurut Kadispora, kepastian maju menjadi tuan rumah tunggal tersebut diterima

langsung dari Gubernur Aceh, Zaini Abdullah, saat bertemu di pendopo untuk menyampaikan rencana kedatangan Tim Verifikasi Penjaringan Calon Tuan Rumah PON XX/2020 di Banda Aceh, 9-13 Februari. “Ketika itu, gubernur secara tegas mengatakan Aceh tidak ingin bergabung dengan Sumut dan harus lebih percaya diri untuk maju sendiri sebagai calon tuan rumah tunggal,” ungkap Bukhari. Karena itu, sebut Kadispora, gubernur meminta seluruh panitia bekerja ekstra keras meloloskan Aceh menjadi sa-

lah satu dari empat calon tuan rumah PON XX/2020 yang akan dibahas dalam Rapat Anggota KONI di Jakarta, Maret mendatang. “Jelasnya, mulai saat ini tidak ada lagi istilah tuan rumah bersama bagi Aceh,” tegas Bukhari menirukan gubernur. Selain itu, kata Bukhari, rapat kemarin juga masih membahas mengenai rencana penyambutan tim dari Jakarta, Minggu (9/2) yang disepakati dipindahkan dari Bandara Sultan Iskandar Muda (SIM) Blang Bintang ke Lanud SIM. Pengalungan bunga akan dilakukan

Kadispora bersama Ketua Umum KONI Aceh, Danlanud SIM, dan T Rayuan Sukma. Setelah itu, rombongan diantara ke Hotel Hermes Palace untuk beristirahat dan pada malam harinya dijamu makan malam di pendopo gubernuran sekaligus pertemuan dengan tokoh-tokoh masyarakat Aceh. Jamuan makan malam ini juga diisi dengan presentasi mengenai kesiapan Aceh untuk menjadi tuan rumah PON XX/2020. Pada Senin dan Selasa (1011/2), rombongan dibagi menjadi empat kelompok. (b04)

Sepakbola, Berkuda Meriahkan HUT Kute Takengen TAKENGEN (Waspada): Pertandingan dua cabang olahraga, yakni sepakbola dan berkuda menjadi skala prioritas untuk digelar dalam rangka memeriahkan HUT ke-437 Kute Takengen, Aceh Tengah

pada 17 Februari 2014. “Meski kami belum membentuk panitia besar untuk persiapan HUT Kute (kotared) Takengen, dua cabor tersebut sudah ditetapkan untuk digelar,” kata Kadisbudpar-

pora Aceh Tengah, Nasiruddin, Rabu (5/2). Dikatakan, anggaran dana untuk menggelar dua cabor tersebut diperkirakan mencapai ratusan juta rupiah. Rinciannya, untuk pacuan kuda

Persipura Lolos Terakhir GANDAPURA (Waspada): Tuan rumah Persipura Gandapura (Bireuen) menjadi tim terakhir lolos ke babak delapan besar Persipura Cup 2014, setelah mengungguli Putra Raja, Blang Pulo (Lhokseumawe) 51 di Lapangan Utama Gandapura, Bireuen, Rabu (5/2). Sukses Persipura sudah diprediksi sebelumnya, mengingat tim ini diperkuat sejumlah pemain berpengalaman seperti Azhar Umar (mantan pemain PSSB), Afrizal Abbas,

Iswadi Hasbi, Irwan Gandapura, dan Martunis Blang Asan. Persipura mencetak gol pembuka disumbangkan Arianto menit 17, setelah berhasil mempedaya kiper M Ali. Tidak lama berselang, giliran Irwan Gandapura menggandakan keunggulan tuan rumah dan skor 2-0 bertahan hingga turun minum. Menit-menit awal babak kedua, Persipura sudah unggul 3-0 berkat gol Martunis Blang

Problem Catur


Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8














Asan, sebelum akhirnya Putra Raja memangkas jarak lewat gol Saiful Ramadhan. Di waktu tersisa, Persipura menambah dua gol yang diborong Martunis, di mana satu gol melalui titik putih. Kamis (6/2) ini, dimulai laga putaran kedua atau babak delapan besar. Di laga pertama akan mempertemukan Payong Raja Aceh FC (Lhokseumawe) dengan PS Aatam (Aceh Tamiang). (cb02)



tradisional menghabiskan dana sekira Rp400 juta dan kompetesi sepakbola Rp200 juta. “Direncanakan, tradisi pacuan kuda akan digelar selama sepekan, yakni 18-23 Februari. Sedangkan cabor sepakbola digelar selama satu bulan, mulai 15 Februari,” ucapnya. Pertandingan sepakbola hanya melibatkan tim perwakilan kecamatan di seluruh Aceh Tengah. Sedang pacuan kuda tradisional diikuti kudakuda terbaik dari tiga kabupaten di Aceh, yakni Aceh Tengah, Gayo Lues, dan Bener Meriah. Ditanya mengapa sejumlah cabor lain tidak dilibatkan dalam kegiatan tahunan tersebut? Nasiruddin berkilah jika jadwal Pekan Olahraga Aceh 2014 sudah sangat dekat, sehingga dikhawatirkan mengganggu persiapan atlet.(cb09)


sih tetap bertahan. Hal ini mengingat para pemain itu dinilai masih tepat dan layak membela tim. “Untuk musim ini ada 14 pemain yang masih kita pertahankan. Hanya beberapa pe-

main saja tidak bergabung lagi, yakni Hermawan, Faris Bagus Dhinata, dan Girts Karlson. Sedangkan Abdul Majid Mony dan Saralim Sowahu masih kita tunggu,” ujar Handoyo, Rabu (5/2). Dikatakan, musim ini Pro Duta juga akan diperkuat delapan pemain muda yang berasal dari tim Pro Duta U-18, serta akademi-akademi di bawah binaan Pro Duta FC sendiri, termasuk Boca Junior Football School Indonesian. Sebelumnya, Pro Duta ju-

ga telah menggelar seleksi selama dua hari di Lapangan Boca Junior Indonesia di Lippo Karawaci dan Swiss German University BSD Tangerang. “Dari hasil seleksi tersebut, sudah kita dapatkan delapan pemain terpilih yang dipantau l a n g s u n g c o a c h A l f re d o Gomez. Pemain yang terpilih akan kita tingkatkan kualitasnya di Medan. Kalau berhasil, mereka akan bergabung dengan tim inti dan jika belum akan kita kembalikan ke tim junior,” tegasnya.

Dijelaskan, para pemain saat ini latihan intensif di Lapangan TGM Medan, sejak Senin (3/2) lalu. Latihan digelar setiap Senin hingga Jumat setiap pekannya mulai pukul 08.00 WIB. Sedangkan Sabtu dan Minggu pemain libur latihan. Kedelapan pemain hasil seleksi tim junior adalah Hendrajid Nahumary, M Iqbal, M Fadil Redian, Julkarnain, Arsyad Yusgiantoro, Aripin Wael, Michael Aditya Wijaya, dan Riskandi Lestaluhu. “ ucapnya. (cat)

Hatrik Misliandi Sukses PSKTP Piala Inalum 2014 TANJUNGGADING (Waspada): Tiga gol (hatrik) Misliandi membawa kemenangan bagi PSKTP Kuala Tanjung, saat menghadapi Persitara Tanah Tinggi dalam laga penyisihan Grup B Piala Inalum 2014, di Lapangan Utama Tanjunggading, Rabu (5/2). Dalam laga tersebut, PSKTP meraih kemenangan tipis 4-3. Dengan kekalahan itu, Persitara total sudah menelan dua kegagalan dan harus

tersingkir dari turnamen tersebut. Sedangkan PSKTP berhak melaju ke babak delapan besar. Meski kalah, perjuangan anak-anak Persitara patut diacungi jempor. Tertinggal 14, Persitara tetap tampil penuh semangat, meski akhirnya hanya mampu menambah dua gol balasan. Penampilan Persitara juga cukup menghibur para penonton.

PSKTP mencetak gol pembuka disumbangkan Misliandi. Selang satu menit, Misliandi menggandakan keunggulan timnya. Persitara memangkas jarak berkat gol yang dicetak Riki Handoko di menit 23. Babak kedua, Misliandi menunjukkan kelasnya dengan mencetak gol ketiga di menit 56, sebelum akhirnya M Rahmadani mencetak gol keempat PSTKP di menit 60. Tertinggal tiga gol, Persitara tak

patah semangat dengan terus tampil menyerang. Dua gol sukses dicetak Rudiansyah dan Nasrul Sani, meski tak mampu menghindarkan timnya dari kekalahan. Kamis (6/2) ini, Havea menghadapi PSTS Tanjung Seri. Havea yang sebelumnya kalah dari Persitas Talawi, wajib memenangkan laga jika ingin melaju ke babak berikutnya. (c05)

9 Cabor, IOF Asahan Dapat Kantor KISARAN ( Waspada): Sembilan pengurus cabang olahraga dan International Offroad Federation (IOF) Asahan, mendapatkan jatah kantor sekretariat di Kompleks GOR Serbaguna Kisaran. Fasilitas itu diharapkan dapat menunjang kinerja para pengurus cabang olahraga. Penyerahan kunci kantor sekretariat bagi sembilan cabor dimaksud, dilakukan langsung Bupati Asahan Drs H Taufan Gama Simatupang MAP, sebelum ekspose Informasi Laporan Penyelenggaraan Pemerintahan Daerah Asahan tahun 2013 dan program 2014, di GOR Serbaguna Kisaran, Rabu (5/2). Kesembilan cabor dimaksud adalah Ikatan Pencak Silat Indonesia (IPSI), Federasi Olahraga Karate-Do Indonesia (Forki), Taekwondo Indonesia (TI), Persatuan Gulat Seluruh Indonesia (PGSI), Persatuan Bola Voli Seluruh Indonesia (PBVSI). Selanjutnya, Persatuan Tenis Meja Seluruh Indonesia (PTMSI), Persatuan Sepak Takraw Indonesia (PSTI), Persatuan Angkat Berat-Besi-Binaraga Seluruh Indonesia (PABBSI), Federasi Panjat Tebing Indonesia (FPTI), dan Persa-

tuan Drum Band Indonesia. Perkantoran cabang-cabang olahraga yang berada di sisi Utara GOR Serbaguna Kisaran itu, dilengkapi satu kantor khusus untuk sekretariat event olahraga dan toilet, juga di sisi Selatan dilengkapi dengan fasilitas toilet. “Dengan adanya kantor



1. Singkatan Aji Santoso International Football Academy. 3. Asosiasi Sekolah Sepak Bola Indonesia. 6. Bola masuk gawang. 8. Forum Komunikasi Guru-guru Olahraga. 10. National Basketball Association. 11. Pin boling. 13. Alat pemukul bola dalam tenis dan bulu tangkis. 15. Kode negara Panama dari Komite Olimpiade Internasional (IOC). 17. Olahraga ada gaya kupu-kupu. 19. Penjaga gawang (Inggris, selain goalkeeper). 22. Kode negara Aljazair. 24. Kode negara Senegal. 25. Pakaian karateka. 28. Tenis (Inggris). 31. Pukulan dalam tinju. 32. Associated Press (kantor berita termasuk olahraga). 33. Putaran dalam balap. 35. Kode negara El Salvador. 36. International Olympic Committee. 37. Jumlah pukulan dan gol terbaik dalam golf. 38. Kode negara Inggris. 40. Komisi Tinju Indonesia. 42. Sistem rating catur. 44. Olahraga bergelut dan main impit. 45. Olahraga pimpinan Marzuki Alie, ketua DPR RI.

1. Olahraga bela diri menggunakan pedang. 2. Federation Internationale de Football Association. 4. Kode negara Suriname dari IOC. 5. Kode negara Irak. 6. Kendara terbang untuk olahraga terbang layang. 7. Liga (Inggris). 9. Kode negara Oman. 12. Kode negara Denmark. 14. Olahraga mengangkat halter (dua suku kata, tulis tanpa spasi). 15. Professional Golfers Association. 16. Kode negara Niger. 18. Benua partisipan Asian Games. 20. Negara adidaya gudang petinju. 21. Negara Persemakmuran gemar kriket. 23. Babak (dalam sepak bola). 25. Bukan Tandang. 26. Menyentuh bola dengan jari. 27. Panggilan akrab ketua IMI Sumut. 29. Kode negara Nikaragua. 30. Olahraga. 34. Kode negara Argentina. 36. Kode negara Irlandia. 37. Pesepak bola legendaris asal Brazil. 39. Raket pingpong. 41. Kode negara Tanzania. 43. Over Time.

Waspada/Nurkarim Nehe

BUPATI Asahan, Drs H Taufan Gama Simatupang MAP, menyerahkan kunci kantor kepada Ketua Umum Pengkab IPSI Asahan, Amir Hakim SP, Rabu (5/2). yang representatif, kita harapkan cabang-cabang olahraga semakin meningkatkan profesionalitas administrasi dan keorganisasian yang berujung pada operasional peningkatan prestasi,” ujar Bupati Asahan, Drs.H.Taufan Gama Simatupang MAP. Perkantoran cabang olah-

raga sebagai hasil rehab berat dan perubahan tata ruang GOR Serbaguna Kisaran tahun 2013 itu, bersumber dari dana Bantuan Daerah Bawahan (BDB). Di utaranya rehab berat Kompleks Tenis Lapangan juga rampung, termasuk Kantor KONI Asahan di kawasan Terminal Madya Kisaran. (a10)

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.


1 2 7 6 6 8 1 7 8 9 3 4 6 3 9 8 2 2 8 6 5 7 3 5 4 2 8 5 7 4 9 ****230


WASPADA Kamis 6 Februari 2014

A11 Wakil Klub Hanya Ketum, Sekum Rapat Bahas PT Pesemes

Waspada/Arianda Tanjung

PEMAIN PSMS Medan menjalani latihan hari kedua di Stadion Kebun Bunga, Medan, Rabu (5/2) sore. Sesi latihan tersebut sebagai persiapan untuk menghadapi kompetisi Divisi Utama Liga Indonesia musim ini.

Aceh Tolak Gabung Sumut Tuan Rumah Bersama PON 2020 BAND ACEH (Waspada): Aceh menolak bergabung dan telah menutup diri terhadap tawaran Sumatera Utara untuk menjadi tuan rumah bersama PON XX/2020. Aceh merasa lebih siap maju menjadi tuan rumah tunggal. Hal tersebut disampaikan Kadispora Aceh, Bukhari Aks MM, saat rapat panitia penyambutan Tim Verifikasi Penjaringan Calon Tuan Rumah PON XX/2020 di Kantor KONI Aceh, Rabu (5/2). Menurut Kadispora, kepastian maju menjadi tuan rumah tunggal diterima langsung dari Gubernur Aceh,

Zaini Abdullah, ketika bertemu di pendopo untuk menyampaikan rencana kedatangan Tim Verifikasi Penjaringan Calon Tuan Rumah PON 2020 di Banda Aceh, 9-13 Februari. “Ketika itu, gubernur secara tegas mengatakan Aceh tidak ingin bergabung dengan Sumut dan harus lebih percaya diri untuk maju sendiri

sebagai calon tuan rumah tunggal,” beber Bukhari. Karena itu, sebut Kadispora, gubernur meminta seluruh panitia bekerja ekstra keras meloloskan Aceh menjadi salah satu dari empat calon tuan rumah PON XX/2020 yang akan dibahas dalam Rapat Anggota KONI di Jakarta, Maret mendatang. “Jelasnya, mulai saat ini tidak ada lagi istilah tuan rumah bersama bagi Aceh,” tegas Bukhari menirukan gubernur. Selain itu, tambah Bukhari, rapat kemarin juga masih membahas mengenai rencana

penyambutan tim dari Jakarta, Minggu (9/2), yang disepakati dipindahkan dari Bandara Sultan Iskandar Muda (SIM) Blang Bintang ke Lanud SIM. Pengalungan bunga akan dilakukan Kadispora bersama Ketua Umum KONI Aceh, Danlanud SIM, dan T Rayuan Sukma. Setelah itu, rombongan diantar ke Hotel Hermes Palace untuk istirahat. Malam harinya dijamu makan di pendopo gubernuran sekaligus pertemuan dengan tokoh-tokoh masyarakat Aceh. Jamuan makan malam ini juga diisi presentasi

mengenai kesiapan Aceh untuk menjadi tuan rumah PON XX/2020. Pada Senin dan Selasa (1011/2), rombongan akan dibagi menjadi empat kelompok. Masing-masing kelompok meninjau sejumlah lokasi yang rencananya akan dijadikan venue PON di Banda Aceh, Aceh Besar, Pidie, dan Sabang. “Saya berharap seluruh panitia bisa bekerja maksimal meyakinkan tim dari pusat, bahwa Aceh benar-benar serius untuk menjadi tuan rumah PON XX/2020,” pungkas Bukhari. (b04)

MEDAN (Waspada): Sekum PSMS, Julius Raja SE, menegaskan setiap klub hanya bisa diwakili ketua dan sekretaris umum dalam pertemuan dengan klub-klub, guna membahas keberadaan PT Pesemes di Sekretariat Stadion Kebun Bunga Medan, Sabtu (8/2) nanti. “Di luar itu, tidak diizinkan berada dalam pertemuan, karena dikhawatirkan hanya akan menjadi provokator, sehingga bisa merusak agenda pertemuan,” ujar Julius Raja, Rabu (5/2). Raja mengaku sudah mendapat informasi jika yang berteriak-teriak mengisukan Direktur PT Pesemes, Syukriwardi, akan memonopoli saham dan menguasai PSMS, adalah orangorang yang tidak punya posisi apapun di klub. “Dia hanya mengaku-ngaku atas nama salah satu klub, lalu membuat sensasi. Sedangkan pemilik klub sendiri tidak begitu agresif. Pemilik klub anggota PSMS menyadari dan menguasai masalah, jika kita tetap membuka pintu menanamkan saham di PT Pesemes,” katanya.

Seperti diketahui, penanam saham di PT Pesemes adalah Ketum PSMS dr Muhammad Fauzi Nasution SpB, mantan Ketum PSMS Benny Sihotang, Sekum PSMS Julius Raja, Pelatih H Edi Sahputra, Saktiawan Sinaga, Direktur PT Pesemes Syukriwardi dan lainnya. “Terakhir yang menanamkan saham ke PT Pesemes adalah Pemko Medan yang diwakili Sekdako Syaiful Bahri,” kata Julius. Terpisah, Pelatih PSMS H Edi Sahputra, mengakui fisik beberapa pemain masih belum mencapai standar. Namun diyakininya kualitas fisik pemain masih bisa meningkat sesuai program latihan yang sudah disiapkan. “Dalam beberapa hari ini, diharapkan fisik pemain meningkat. Secara keseluruhan, 80 persen fisik pemain sudah baik. Kita bisa mengerti kondisi pemain saat ini ada sebagian yang kurang istirahat atau belum mempersiapkan diri mengikuti latihan,” kata Edi, didampingi asistennya Dasrul Bahri dan Syahril Nasution. (m17)

Satlak Tunggu Data Timnas U-23 JAKARTA (Waspada): Satlak Prima memastikan cabang sepakbola bakal diikutsertakan pada Asian Games 2014. Meski belum mendaftar, olahraga paling populer di Indonesia itu tetap akan ditunggu sampai siap. Menurut Ketua Satlak Prima, Suwarno, pihaknya memberi perlakuan khusus pada cabang sepakbola. Pasalnya, skuad yang akan dikirim menuju Asian Games belum ada. “Kami memahami bahwa memilih atlet bola tidak seperti menentukan atlet lainnya. Karena itu, kami menunggu mereka sampai siap,” ujar Suwarno, Rabu (5/2). Meski demikian, pihaknya tetap memberi kuota 30 orang untuk olahraga ini. Rinciannya, 23 pemain, enam pelatih, dan satu manajer. Saat ini, PSSI dan Badan Tim Nasional (BTN) belum menyerahkan tanggungjawab kepada tim pelatih menentukan skuad Timnas U-23. Dia mengutarakan, alasan pihaknya menyetujui sepakbola berangkat ke Asian Games karena olahraga ini menjadi salah satu idola masyarakat Indonesia. Apalagi, Timnas U-23 sukses meraih medali perak SEA Games 2013

di Myanmar. “Secara umum merupakan olahraga rakyat. Prestasi tim di cabang sepakbola juga masih mungkin berkembang,” tegasnya. Sekadar diketahui, Aji Santoso dipilih menukangi Timnas U-23 proyeksi Asian Games yang digelar 19 September-Oktober di Inchoen Korea Selatan. Dalam menjalankan tugas, Aji dibantu asisten M Alhadad dan Mustaqim. Namun, tim pelatih belum bisa menggelar seleksi pemain karena kompetisi Indonesian Super League (ISL) sedang berlangsung. Lebih lanjut, Suwarno mengemukakan bahwa cabang yang dikirim ke event empat tahunan itu sebanyak 19 cabang. Menurutnya, semua cabang ditenggat untuk mengirim data atlet, pelatih, dan ofisial paling lambat Kamis (6/2) ini. Namun khusus cabang sepakbola tidak bersamaan. Aji Santoso tak mempersoalkan pembatasan kuota 23 pemain untuk Asian Games. Namun pihaknya langsung mendaftarkan 23 nama ke Satlak Prima. Tim pelatih tetap berpedoman bakal melakukan seleksi. (yuslan)

IOF, 9 Cabor Asahan Dapat Kantor

Waspada/Arianda Tanjung

PEMAIN kunci Pro Duta FC di musim lalu, Ghozali, masih menjadi andalan skuad Kuda Pegasus pada kompetisi Divisi Utama musim ini.

Pro Duta Andalkan Wajah Lama MEDAN (Waspada): Dalam mengarungi kompetisi Divisi Utama Liga Indonesia musim ini, Pro Duta FC masih tetap mengandalkan sejumlah wajah lama. Setidaknya, ada 14 pemain yang dipertahankan, di antaranya pemain kunci Ghozali Muharam Siregar dan Rahmad Hidayat. Media Officer Pro Duta FC, Handoyo Subosito, mengatakan sebagian besar pemain Kuda Pegasus musim lalu masih tetap bertahan. Hal ini mengingat para pemain itu dinilai masih tepat dan layak membela tim. “Untuk musim ini ada 14 pemain yang masih kita pertahankan. Hanya beberapa pemain saja tidak bergabung lagi, yakni Hermawan, Faris Bagus

Dhinata, dan Girts Karlson. Sedangkan Abdul Majid Mony dan Saralim Sowahu masih kita tunggu,” ujar Handoyo, Rabu (5/2). Dikatakan, musim ini Pro Duta juga akan diperkuat delapan pemain muda yang berasal dari tim Pro Duta U-18, serta akademi-akademi di bawah binaan Pro Duta FC sendiri, termasuk Boca Junior Football School Indonesian. Sebelumnya, Pro Duta juga telah menggelar seleksi selama dua hari di Lapangan Boca Junior Indonesia di Lippo Karawaci dan Swiss German University BSD Tangerang. “Dari hasil seleksi tersebut, sudah kita dapatkan delapan pemain terpilih yang dipantau langsung coach Alfredo Go-


Problem Catur Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8














mez. Pemain yang terpilih akan kita tingkatkan kualitasnya di Medan. Kalau berhasil, mereka akan bergabung dengan tim inti dan jika belum akan kita kembalikan ke tim junior,” tegasnya. Dijelaskan, para pemain saat ini latihan intensif di Lapangan TGM Medan, sejak Senin (3/2) lalu. Latihan digelar setiap Senin hingga Jumat setiap pekannya mulai pukul 08.00 WIB. Sedangkan Sabtu dan Minggu libur latihan. Kedelapan pemain hasil seleksi tim junior adalah Hendrajid Nahumary, M Iqbal, M Fadil Redian, Julkarnain, Arsyad Yusgiantoro, Aripin Wael, Michael Aditya Wijaya, dan Riskandi Lestaluhu. “ ucapnya. (cat)



KISARAN ( Waspada): Sembilan pengurus cabang olahraga dan International Offroad Federation (IOF) Asahan, mendapatkan jatah kantor sekretariat di Kompleks GOR Serbaguna Kisaran. Fasilitas itu diharapkan dapat menunjang kinerja para pengurus cabang olahraga. Penyerahan kunci kantor sekretariat bagi sembilan cabor dimaksud, dilakukan langsung Bupati Asahan Drs H Taufan Gama Simatupang MAP, sebelum ekspose Informasi Laporan Penyelenggaraan Pemerintahan Daerah Asahan tahun 2013 dan program 2014, di GOR Serbaguna Kisaran, Rabu (5/2). Kesembilan cabor dimaksud adalah Ikatan Pencak Silat Indonesia (IPSI), Federasi Olahraga Karate-Do Indonesia (Forki), Taekwondo Indonesia (TI), Persatuan Gulat Seluruh Indonesia (PGSI), Persatuan Bola Voli Seluruh Indonesia (PBVSI). Selanjutnya, Persatuan Tenis Meja Seluruh Indonesia (PTMSI), Persatuan Sepak Takraw Indonesia (PSTI), Persatuan Angkat Berat-Besi-Bi-

naraga Seluruh Indonesia (PABBSI), Federasi Panjat Tebing Indonesia (FPTI), dan Persatuan Drum Band Indonesia (PDBI). Pe rkantoran cabangcabang olahraga yang berada di sisi Utara GOR Serbaguna Kisaran itu, dilengkapi satu kantor khusus untuk sekretariat event olahraga dan toilet, juga di sisi Selatan dilengkapi dengan fasilitas toilet. “Dengan adanya kantor yang representatif, kita harapkan cabang-cabang olahraga semakin meningkatkan profesionalitas administrasi dan keorganisasian yang berujung pada operasional peningkatan prestasi,” ujar Bupati Asahan, Drs.H.Taufan Gama Simatupang MAP. Perkantoran cabang olahraga sebagai hasil rehab berat dan perubahan tata ruang GOR Serbaguna Kisaran tahun 2013 itu, bersumber dari dana Bantuan Daerah Bawahan (BDB). Di utaranya rehab berat Kompleks Tenis Lapangan juga rampung, termasuk Kantor KONI Asahan di kawasan Terminal Madya Kisaran. (a10)

BUPATI Asahan Drs H Taufan Gama Simatupang MAP, menyerahkan kunci kantor kepada Ketua Umum Pengkab IPSI Asahan, Amir Hakim SP, Rabu (5/2). -Waspada/Nurkarim Nehe-

Sore Ini, PS Kwarta Jajal USU MEDAN ( Waspada): PS Kwarta Deliserdang terus mematangkan persiapan tim dalam menatap kompetisi Divisi Utama Liga Indonesia musim ini. Selain latihan intensif, juga melakukan sejumlah laga ujicoba dengan klub lokal di Sumut. Kamis (6/2) ini, klub berjuluk Burung Sumatera itu akan melakoni laga ujicoba dengan PS USU dan PS Klambir Lima pada Sabtu (8/2) nanti. Ujicoba tersebut dijadikan bahan evaluasi tim bagi pelatih. Pelatih PS Kwarta, Slamet


Riyadi, mengaku ujicoba juga dijadikan momentum mencari komposisi tim terbaik, serta menggenjot stamina pemain agar tetap bugar saat kompetisi berlangsung pada April mendatang. “Dalam laga ujicoba nanti, kami akan menurunkan skuad terbaik. Ujicoba kesempatan mengasah mematangkan strategi dan menjaga kekompakan tim. Saya berharap pemain menampilkan kemampuan terbaik,” jelas Slamet, Rabu (5/2). Dikatakan, saat ini tim su-

dah memliki 23 pemain (minus pemain asing) yang akan terus dimatangkan baik dari segi permainan maupun mental. PS Kwarta sendiri sudah menggelar latihan sejak beberapa pekan, ditambah sejumlah laga ujicoba. “Sedikit demi sedikit stamina dan kekompakan tim semakin baik. Pekan depan seluruh pemain akan mengikuti tes kesehatan dan Vo2 Max. Namun untuk tempat dan waktunya masih akan didiskusikan dengan manajemen tim,” ujarnya lagi. (cat)



1. Singkatan Aji Santoso International Football Academy. 3. Asosiasi Sekolah Sepak Bola Indonesia. 6. Bola masuk gawang. 8. Forum Komunikasi Guru-guru Olahraga. 10. National Basketball Association. 11. Pin boling. 13. Alat pemukul bola dalam tenis dan bulu tangkis. 15. Kode negara Panama dari Komite Olimpiade Internasional (IOC). 17. Olahraga ada gaya kupu-kupu. 19. Penjaga gawang (Inggris, selain goalkeeper). 22. Kode negara Aljazair. 24. Kode negara Senegal. 25. Pakaian karateka. 28. Tenis (Inggris). 31. Pukulan dalam tinju. 32. Associated Press (kantor berita termasuk olahraga). 33. Putaran dalam balap. 35. Kode negara El Salvador. 36. International Olympic Committee. 37. Jumlah pukulan dan gol terbaik dalam golf. 38. Kode negara Inggris. 40. Komisi Tinju Indonesia. 42. Sistem rating catur. 44. Olahraga bergelut dan main impit. 45. Olahraga pimpinan Marzuki Alie, ketua DPR RI.

1. Olahraga bela diri menggunakan pedang. 2. Federation Internationale de Football Association. 4. Kode negara Suriname dari IOC. 5. Kode negara Irak. 6. Kendara terbang untuk olahraga terbang layang. 7. Liga (Inggris). 9. Kode negara Oman. 12. Kode negara Denmark. 14. Olahraga mengangkat halter (dua suku kata, tulis tanpa spasi). 15. Professional Golfers Association. 16. Kode negara Niger. 18. Benua partisipan Asian Games. 20. Negara adidaya gudang petinju. 21. Negara Persemakmuran gemar kriket. 23. Babak (dalam sepak bola). 25. Bukan Tandang. 26. Menyentuh bola dengan jari. 27. Panggilan akrab ketua IMI Sumut. 29. Kode negara Nikaragua. 30. Olahraga. 34. Kode negara Argentina. 36. Kode negara Irlandia. 37. Pesepak bola legendaris asal Brazil. 39. Raket pingpong. 41. Kode negara Tanzania. 43. Over Time.

Hatrik Misliandi Menangkan PSKTP Piala Inalum 2014 TANJUNGGADING (Waspada): Tiga gol Misliandi membawa kemenangan bagi PSKTP Kuala Tanjung, saat menghadapi Persitara Tanah Tinggi dalam laga penyisihan Grup B Piala Inalum 2014, di Lapangan Utama Tanjunggading, Rabu (5/2). Dalam laga tersebut, PSKTP meraih kemenangan tipis 43. Dengan kekalahan itu, Persitara total sudah menelan dua kegagalan dan harus tersingkir dari turnamen tersebut. Sedangkan PSKTP berhak melaju ke babak delapan besar. Meski kalah, perjuangan anak-anak Persitara patut diacungi jempor. Tertinggal 1-4, Persitara tetap tampil penuh semangat, meski akhirnya hanya mampu menambah dua gol balasan. Penampilan Persitara juga cukup menghibur penonton. PSKTP mencetak gol pembuka disumbangkan Misliandi. Selang satu menit, Misliandi menggandakan keunggulan timnya. Persitara memangkas jarak berkat gol yang dicetak Riki Handoko di menit 23. Babak kedua, Misliandi menunjukkan kelasnya dengan mencetak gol ketiga di menit 56, sebelum akhirnya M Rahmadani mencetak gol keempat PSTKP di menit 60. Tertinggal tiga gol, Persitara tak patah semangat dengan terus tampil menyerang. Dua gol sukses dicetak Rudiansyah dan Nasrul Sani, meski tak mampu menghindarkan timnya dari kekalahan. Kamis (6/2) ini, Havea menghadapi PSTS Tanjung Seri. Havea yang sebelumnya kalah dari Persitas Talawi, wajib memenangkan laga jika ingin melaju ke babak berikutnya. (c05)

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan kurang dari 15 menit. Jawabannya di halaman A2 kolom 1.


1 2 7 6 6 8 1 7 8 9 3 4 6 3 9 8 2 2 8 6 5 7 3 5 4 2 8 5 7 4 9 ****230



WASPADA Kamis 6 Februari 2014

Marquez Lebih Rileks SEPANG, Malaysia (Waspada): Marc Marquez (foto) mengaku lebih rileks saat akan memasuki tahun keduanya bersama Honda di ajang MotoGP. Kondisi tersebut dirasakan juara dunia MotoGP 2013 itu kala melakoni sesi tes pramusim di sirkuit Sepang, Malaysia. Tes Sepang berlangsung tiga hari, 4-6 Februari. Pada hari

kedua Rabu (5/2), Marquez kembali menjadi yang terce-

pat. Dia membukukan waktu 1 menit 59,926 detik di depan rekan satu timnya Dani Pedrosa di urutan kedua dengan catatan waktu terpaut 0,410 detik. Catatan waktu Marquez ini mengatasi rekor resmi Sirkuit Sepang, yang juga dibuat Marquez tahun lalu dengan 2:0,011. Sebelumnya pada hari pertama, Marquez juga melesat meninggalkan para pebalap lainnya dengan catatan waktu 2:00,286. “Kami tak mencoba banyak hal (pada sesi tes). Kami berkendara dengan motor yang sama ketika menuntaskan tes terakhir (2013) di Valencia. Besok, kami akan mencoba beberapa hal baru, tapi saat ini saya merasa bagus, begitu pun treknya,” jelas

10 Besar Tes Rabu (5/2) 1. Marc Marquez (Spanyol/Repsol Honda) 2. Dani Pedrosa (Spanyol/Repsol Honda) 3. Stefan Bradl (Jerman/LCR Honda) 4. Valentino Rossi (Italia/Yamaha Factory) 5. Aleix Espargaro (Spanyol/FTR-M1) 6. Jorge Lorenzo (Spanyol/Yamaha Factory) 7. Bradley Smith (Inggris/Yamaha Tech 3) 8. Andrea Iannone (Italia/Pramac Ducati) 9. Alvaro Bautista (Spanyol/Honda Gresini) 10. Pol Espargaro (Spanyol/Yamaha Tech 3) Marquez. “Pada poin ini, tahun lalu saya merasa gugup, sedangkan saat ini lebih rileks. Pada balapan akhir pekan, saya akan merasakan tekanan lebih. Tapi, biasanya saya bekerja dengan baik saat tertekan,” lanjut pebalap

1:59,926 +0,410 0,413 0,538 0,621 0,647 0,677 0,929 0,971 1,135

asal Spanyol berusia 20 tahun tersebut. Mengenai catatan waktu yang ditorehkannya pada hari pertama, Marquez tak menyangka. Namun, dia yakin para pembalap lain akan meningkat secara signifikan pada hari ke-


dua dan ketiga, sehingga dia juga harus meningkatkan kecepatan saat melahap lap demi lap. “Hari ini, catatan waktu saya

sungguh cepat. Itu mengejutkan, tapi saya pikir, di Malaysia sangat bergantung pada kondisi trek. Kita bisa lihat, ba-nyak

pembalap cepat dan saya pikir besok serta lusa mereka akan terus menunjukkan peningkatan,” ujar Marquez. (crs/m47)

Lorenzo Masih Kesulitan Rossi Mulai Atasi Masalah


PEMAIN Minnesota Timberwolves, Kevin Love bersiap menembakkan bola ke ring saat timnya bertemu Los Angeles Lakers di lanjutan kompetisi NBA di Minneapolis, AS, Rabu (5/2).

Wolves Perpanjang Derita Lakers MINNEAPOLIS, AS (Waspada): Los Angeles Lakers belum bisa lepas dari tren negatif, usai ditumbangkan Minnesota Timberwolves 99-109 pada pertandingan lanjutan musim reguler NBA 2013/14 di Minneapolis, AS, Rabu (5/2), untuk memperpanjang derita Lakers yang harus kalah di tujuh pertandingan terakhir mereka. Pada pertandingan yang dihelat di Target Center tersebut, Lakers sebenarnya mampu mengimbangi permainan Wolves pada kuarter 1. Namun, kemudian mereka selalu tertinggal. Kuarter 1 pun berakhir 38-26 untuk Wolves. Memasuki kuarter 2, Wolves yang mendapat dukungan penuh penonton, terus memperlebar jarak. Free throw Dante Cunningham membuat Wolves menjauh 56-31, meskipun pada akhirnya Lakers mampu memperkecil ketertinggalan menjadi 52-68. Pertandingan berjalan ketat pada kuarter 3. Free throw Kevin Love langsung dibalas Nick Young dan membuat kedudukan menjadi 70-82. Dan,“alley oop” Johnson pun akhirnya menutup kuarter 3 dengan skor 78-89, masih untuk keunggulan Wolves. Pada kuarter pamungkas, Lakers masih coba mengejar perolehan poin Lakers. “Lay up” Harris membuat kedudukan menjadi 97-105. Namun,Wolves tak membiarkan Lakers mencapai 100 poin, karena laga akhirnya usai dalam kedudukan 99-109. “Pertandingan seperti ini tak akan mudah seperti yang diperkirakandanAndahanyaharusterusbertahan(untukmenang). Mereka (Lakers) adalah tim yang agresif, saya telah menyaksikan beberapa laga terakhir mereka,” kata pelatihWolves, Rick Adelman. Timberwolves kini masih tertahan di peringkat 4 klasemen Divisi Northwest Wilayah Barat dengan 24 kemenangan dan 24 kekalahan. Lakers juga masih menempati peringkat 4 klasemen Divisi Pacific Wilayah Barat dengan 16 kemenangan dan 32 kekalahan. (nbc/m47) Hasil Lengkap: LA Lakers - Minnesota Timberwolves Indiana Pacers - Atlanta Hawks Charlotte Bobcats - Golden State Warriors Phoenix Suns - Chicago Bulls

99 -109 89 - 85 91 - 75 92 - 101

SEPANG, Malaysia (Waspada): Juara dunia MotoGP 2010 dan 2012, Jorge Lorenzo, mengaku masih kesulitan menunggangi motor anyar Yamaha usai menjalani tes resmi MotoGP 2014 di Sirkuit Sepang, Malaysia, mulai Selasa (4/4). Lorenzo hanya menempati posisi keempat pada tes hari pertama tersebut. Sementara di hari kedua Rabu (5/2) dia malah melorot ke urutan ke enam. Lorenzo mengatakan perubahan regulasi MotoGP 2014 membuat motor Yamaha YZR-

M1 anyar sulit dikendalikan. Di bawah regulasi baru, tim Kelas Pabrikan hanya boleh menggunakan 20 liter bahan bakar, satu liter lebih sedikit dari musim lalu. Hal tersebut membuat Yamaha harus mengubah desain motor dan sistem elektronikYamaha YZR-M1. Dari 47 lap yang dilahap Lorenzo di Sepang pada tes hari pertama, pembalap asal Spanyol itu mencatatkan waktu terbaik 2 menit 1,08 detik. Lorenzo kalah 0,796 detik dari rider Repsol Honda, Marc Marquez, yang menguasai tes hari

pertama. “Regulasi baru 20 liter membuat hidup sedikit sulit, karena kami harus mengubah banyak hal di sistem elektronik. Motor cukupberubahdibandingmusim lalu,dantidakbekerjasepertiyang saya inginkan,” ujar Lorenzo. “Tidak sehalus sebelumnya. Lebih agresif dan lebih sulit dikendalikan. Saat ini, saya sedikit kesulitan saat melewati tikungan. Tapi, kami sedang bekerja keras untuk mengatasinya. Kami masih punya waktu sebelum seri pertama di Qatar,” sam-

Nadal Mulai Membaik BARCELONA, Spanyol (Waspada): Hasil pemeriksaan cedera yang dialami petenis putra nomor satu dunia, Rafael Nadal saat berlaga di Australian Open 2014 sudah keluar. Beruntung cederanya tidak serius. Nadal mengalami cedera punggung saat bertanding di final Australian Open, bulan lalu. Petenis nomor satu dunia itu harus menelan kekalahan dari Stanislas Wawrinka dalam pertandingan di Melbourne, sehingga gagal mendapatkan gelar Grand Slam ke-14 selama kariernya. Nadal sudah melanjutkan pemeriksaan cederanya di Barcelona. Hasilnya, dia sangat puas dan memperlihatkan adanya kemajuan. “Si pemain sudah mulai berlatih kebugaran hari ini dan akan membuat keputsuan kapan akan mulai berkompetisi lagi, itu semua tergantung pada adaptasinya di lapangan dalam beberapa hari mendatang,” de-


mikian pernyataan timnya. Seandainya sudah pulih benar, Nadal siap berlaga di turnamen Buenos Aires pada 10 Februari 2014. Setelah itu, petenis

Pacman Janji Agresif LOS ANGELES, AS (Waspada): Petinju kebanggaan Filipina, Manny Pacquiao sudah tidak sabaruntukmelakukanduelulang denganTimothy Bradley. Dirinya pun sudah menjanjikan bakal tampil beda guna mengalahkan Bradley. Petinju berjuluk Pacman itu akan dijadwalkan akan naik ring pada 12 April. Pertarunan sendiri bakal digelar di MGM Grand Arena di mana Bradley akan mem-

pertaruhkan gelar WBO-nya. “Saya memiliki kesempatan untuktandingulangdansayaakan tampil lebih agresif, saya akan mengembalikan kekuatan saya seperti yang saya lakukan dalam pertarungan terakhir kontra Rios. Saya akan meyakinkan Anda bahwa Anda akan melihat Pacquiao yang muda dan agresif. Itu semua karena anugerah Tuhan,” ungkap Pacquiao seperti dilansir GMA, Rabu (5/2).

kelahiran Spanyol akan mengikuti turnamen lapangan tanah liat di Rio de Janeiro, Brasil dan even berikutnya di Indian Wells dan Miami Masters. (abn/m47) Seperti diketahui, sabuk kelas welterWBOmilikPacquiaoberhasil direbut Bradley pada Juni 2012 silam.Duadaritigajuriyangmemberikanangkalebihbanyakuntuk Bradley(115-113)hinggaakhirnya ia menang angka dari Pacquiao 113-115, 115-113 dan 115-113. Tak ayal hal tersebut memancingkontroversi,pasalnyabanyak pihak yang menilai bahwa Pacquiao sangat mendominasi pertarungan yang berlangsung di MGM Grand Las Vegas itu. (gma/m47)


JORGE Lorenzo dan Valentino Rossi, pose bersama tim Yamaha jelang sesi tes di Sepang, Malaysia. bungnya. Sementara,Valentino Rossi, yang memiliki masalah dalam urusan pengereman pada musim 2013 lalu, melihat sudah adanya perubahan positif jelang bergulirnya musim 2014. Hal tersebut diutarakan Rossi usai melakoni sesi tes di sirkuit Sepang. Pada hari pertama, juara dunia sembilan kali itu berhasil menorehkan catatan waktu 2 menit 0,804 detik, atau kedua tercepat di bawah Marc Marquez. Sementara di hari kedua, Rabu (5/2) dia di posisi keempat, sebagai rider Yamaha tercepat. Menurutnya, apa yang dilakukan Yamaha telah membantunya. “Saya sudah mencoba motor 2014 di Valencia (akhir 2013), tapiYamaha bekerja keras untuk saya soal pengereman. Itu amat membantu, mengingat pengereman memang menjadi problem utama saya tahun lalu,” ujar Rossi. “Saya tengah merasa dalam kondisi bagus. Saya senang karena kami melakukannya dengan sangat cepat. Kami bekerja keras pada motor dan telah menemukan sesuatu (untuk dikembangkan),” lanjut pebalap berusia 34 tahun itu. Rossi juga berkomentar tentang Silvano Galbusera, kepala mekanik baru yang menggantikan Jerry Burgess. Meski belum sepenuhnya terbiasa, dalam beberapa hal Rossi merasakan adanya perubahan positif yang sangat membantunya. “Ini sedikit berbeda (bekerja dengan Silvano Galbusera), tapi saya memang butuh perubahan ini. Berbicara bahasa Italia lebih memudahkan, motivasi juga semakin baik. Segalanya baik, tapi ini baru awal,” ujar pebalap berujuk “The Doctor” itu. (aus/m47)

Alonso Akui Mobil F1 Lebih Lambat MARANELLO, Italia (Waspada): Beberapa pembalap termasuk Fernando Alonso (foto), menilai mobil Formula Satu (F1) tahun ini terasa lambat. Meski begitu, Alonso menyebut dia tetap menikmati mengendarai kendaraannya. Peraturan baru diterapkan F1 dengan menggunakan mesin berkekuatan mesin turbo V6. Para pembalap mendapatkan kesempatan untuk menjajal mesin ini di Sirkuit Jerez, dua pekan lalu. Hasilnya, pembalap tcercepat dalam tes itu dibukukan Kevin Magnussen dengan catatan 83,276 detik. Jelas, catatan waktu ini jauh lebih lambat delapan detik dari yang pernah dibuat oleh Michael Schumacher yakni 76,043 detik pada 2004 silam. Alonso sadar kecepatan mobil berbeda dengan musim-musim sebelumnya. “Secara kasat mata fisiknya tidak sama. Mobil lebih mudah dikendalikan ketimbang mobil Formula Satu sebelumnya. Kekuatan dan kecepatan lebih lambat saat tikungan, tapi di sisi lain ada parameter yang lebih banyak untuk dikendalikan, banyak tombol di setir mobil,” kata pembalap Ferrari itu. “Mobil terasa sangat berbeda sekali, lebih kritis dalam hal mengemudi dan memasuki tikungan dengan kecepatan tinggi,” lanjut pembalap asal Spanyol itu, Rabu (5/2). Alonso melanjutkan, meski lebih lambat dari musim sebelumnya, juara dua kali F1 itu masih menikmati mengendarai mobil jet darat super cepat ini. “Saya pernah mengendarai mobil karting yang lebih lambat setengah menit ketimbang F1 dan saya menikmati balapan. Selama Anda membalap melewati batas, membuat catatan waktu, tidak akan mengubah pandangan Anda secara emosional. Mobil ini masih menyenangkan untuk dikendarai,” sambungnya. (aus/m47)




WASPADA Kamis 6 Februari 2014

Marquez Belum Tersentuh SEPANG, Malaysia (Waspada): Pebalap Repsol Honda, Marc Marquez (foto), masih tak tertandingi pada hari kedua ujicoba MotoGP 2014 di Sirkuit Sepang, Malaysia, Rabu (5/2). Marquez mencatat waktu tercepat 1 menit 59,926 detik. Di hari pertama, rider asal Spanyol itu juga mencatat waktu tercepat. Hingga hari kedua, Marquez menjadi pebalap pertama dan satu-satunya yang berhasil mencatat waktu di bawah dua menit. Tak hanya itu, Repsol Honda juga mempertegas dominasinya di Sepang. Hal ini mengingat Dani Pedrosa berada di posisi kedua dengan waktu 2 menit 0,336 detik. Urutan

ketiga masih ditempati pebalap Honda, yakni Stefan Bradl. Pebalap Jerman yang membela panji LCR Honda ini terpaut 0,413 detik di belakang Marquez. Saat Honda meraih hasil positif dalam dua hari berurutan, Yamaha Factory masih mengalami kesulitan. Valentino Rossi, menjadi runner-up hari pertama, harus puas melorot ke peringkat empat.

10 Besar Ujicoba Rabu (5/2) Marc Marquez Dani Pedrosa Stefan Bradl Valentino Rossi Aleix Espargaro Jorge Lorenzo Bradley Smith Andrea Iannone Alvaro Bautista Pol Espargaro

Spanyol/Repsol Honda Spanyol/Repsol Honda Jerman/LCR Honda Italia/Yamaha Factory Spanyol/NGM Mobile Spanyol/Yamaha Factory Inggris/Yamaha Tech 3 Italia/Pramac Racing Spanyol/Honda Gresini Spanyol/Yamaha Tech 3

1:59.926 (65 lap) 2:00.336 (61) 2:00.339 (52) 2:00.464 (60) 2:00.547 (42) 2:00.573 (49) 2:00.603 (66) 2:00.855 (48) 2:00.897 (55) 2:01.061 (48)

Meski demikian, catatan waktu pebalap legendaris asal Italia ini masih lebih baik dibanding Jorge Lorenzo. Secara mengejutkan, Lorenzo hanya berada di posisi enam, kalah dari Aleix Espargaro (NGM Mobile Forward Racing) yang membalap dengan motor kategori terbuka. Usai ujicoba di bawah cuaca terik, Marquez sempat mengutarakan penilaiannya tentang hasil tesnya. Dikatakan, motor mengalami peningkatan namun juga terdapat beberapa hal yang masih perlu dibenahi. “Motor kami terkadang serasa goyang saat melakukan tikungan cepat. Saya tidak puas dengan hal ini, khususnya di tikungan-tikungan awal karena di situ Anda bisa memangkas waktu,” papar Marquez. “Kami juga sempat fokus pada settingan dan geometris berbeda, lalu terjadi pengembangan stabilitas pengereman. Namun, kami masih perlu perbaiki keseimbangan goncangan saat tikungan,” tutup juara bertahan MotoGP tersebut. (m33/mgp)


Lorenzo Tekad Lebih Sabar


SEPANG, Malaysia (Waspada): Jorge Lorenzo (foto) mengaku bakal lebih bersabar musim ini. Dia juga siap bersaing dengan pebalap lain, termasuk rekan setimnya yang juga tujuh kali juara dunia, Valentino Rossi. Menurut jagoan Yamaha asal Spanyol itu, perjalanan musim lalu memberikan suatu pelajaran bagi dirinya dalam balapan MotoGP. Dua kali terjatuh di seri Assen dan Sachsenring diakuinya memang memengaruhi penurunan performanya. “Harus dilihat dengan kepala dingin dan lebih sabar. Ini kompetisi yang semua pebalap dan timnya punya keinginan juara,” kata pebalap kelahiran 4 Mei 1987 itu, Rabu (5/2). The Spaniard pun menambahkan dirinya tidak bermasalah dengan Rossi. Loren-

zo menyebut bahwa The Doctor sebagai rekan terbaik, namun juga menyadari Rossi pastinya juga ingin jadi juara dunia lagi. “Setiap tim punya lebih dari satu pebalap. Mereka juga bersaing. Tapi, kami bersaing untuk tim agar menjadi terbaik,” sambungnya. Meski demikian, diakuinya untuk balapan MotoGP musim ini cukup berat. Selain para pebalap lebih siap, peraturan yang mengharuskan tunjangan bahan bakar hanya 20 liter harus disiasati dalam strategi balap. Peraturan baru ini membuat tim mengubah perangkat elektronik kontrol motor dan Lorenzo sendiri pun mesti beradaptasi. “Regulasi baru yang cuma mengizinkan bahan bakar 20 liter cukup menyulitkan karena kami harus cukup banyak memodifikasi perangkat elek-


tronik, sehingga motor tidak bekerja persis seperti yang sa-

ya inginkan. Tapi, saya yakin ada solusi dalam beberapa hari ke

depan,” sebut mantan juara dunia 250 cc itu. (m33/mgp)

Masalah Rossi Cuma Marquez

Kehadiran Nash Tak Berpengaruh

SEPANG, Malaysia (Waspada): Marc Marquez berhasil mengawali tahun 2014 dengan cukup baik, setelah menjadi pebalap tercepat di dua hari pertama ujicoba pramusim MotoGP di Sirkuit Sepang. Andalan Yamaha asal Italia, Valentino Rossi (foto), tak segan menyebut pebalap Honda itu sebagai sebuah masalah. Bersama motor YZR M1, Rossi berhasil menempati posisi kedua dengan waktu terbaik 2 menit 0.804 detik dari 61 lap di hari pertama. Pada Rabu (5/ 2), tujuh kali jawara dunia MotoGP tersebut melorot ke posisi empat. “Meski sempat turun, saya senang dan puas dengan hasil ujicoba. Cepat sepanjang hari dan selalu dalam empat di dua hari pertama. Saya merasa le-

MINNEAPOLIS, AS (Waspada): LA Lakers belum juga melepaskan diri dari tren negatif. Dalam lanjutan kompetisi NBA di Target Center, markas Minnesota Timberwolves, Lakers kalah dalam tujuh laga terakhirnya. Sebelumnya, Lakers mampu mengimbangi permainan Wolves. Jelang akhir kuarter pembuka, pimpinan skor direbut Wolves. Padahal, Lakers sudah diberi suntikan motivasi dengan comeback Steve Nash pascaabsen selama tiga bulan. Kembalinya point guard lincah asal Kanada itu ternyata tidak berpengaruh banyak bagi Lakers. Sebaliknya, Nash harus menerima kekalahan dalam laga perdananya tahun ini. Apalagi dukungan penonton Wolves memicu semangat Kevin Love cs terus memperlebar jarak. Perbedaan skor mencolok Lakers akhirnya sempat diperkecil oleh aksi Nick Young dan Wesley Johnson. Namun, tim tamu masih tertinggal 78-89. Pada kuarter pamungkas, Wolves tidak membiarkan Lakers mencapai angka 100.

bih nyaman dengan rem dan itu terpenting karena itu menjadi masalah besar tahun lalu,” ungkap Rossi. Marquez tak terbendung di hari pertama, bahkan rider Repsol Honda itu juga mendominasi hari kedua dengan catatan waktu di bawah dua menit. Tak ayal, Rossi menilai bahwa Marquez sebagai masalah terbesar ketimbang motornya. “Satu-satunya masalah saat ini untuk semua orang adalah Marquez! Dia sangat kuat, sangat cepat, dan sudah dengan waktu lap yang sangat baik. Terlepas itu, kami akan mencoba untuk pergi lebih dekat selama persiapan pramusim,” kata Rossi sembari tertawa. Rossi juga berkomentar

tentang Silvano Galbusera, kepala mekanik baru yang menggantikan Jerry Burgess. Meski belum sepenuhnya terbiasa, Rossi merasakan adanya perubahan positif yang sangat membantunya dalam beberapa hal. “Ini sedikit berbeda (bekerja dengan Silvano Galbusera), tapi saya memang butuh perubahan ini. Berbicara bahasa Italia lebih memudahkan, motivasi juga semakin baik. Segalanya baik, tapi ini baru awal,” ujar The Doctor. Sebaliknya, Jorge Lorenzo mengaku belum nyaman dengan penampilannya di Sepang. Setelah menjadi peringkat empat di hari pertama, Lorenzo justru menempati peringkat keenam di hari kedua. (m33/mgp)


Begitu buzzer berbunyi, Lakers menuai kekalahan 99-109. Wolves masih tertahan di peringkat 11 klasemen Wilayah Barat dengan 24 kemenangan dan 24 kekalahan. Lakers juga masih menempati posisi 13 klasemen wilayah yang sama dengan rekor 16-32. “Pertandingan seperti ini tak akan mudah seperti yang diperkirakan dan Anda hanya harus terus bertahan (untuk menang). Mereka (Lakers) adalah tim yang agresif, saya telah menyaksikan beberapa laga terakhir mereka,” kata pelatih Wolves, Rick Adelman. Di Phoenix, Chicago Bulls mampu membungkam tuan rumah Suns. Permainan impresif terus ditunjukkan oleh tim asuhan Tom Thibodeau. Dimotori DJ Augustin dan Carlos Boozer, Bulls menang 101-92. Pimpinan klasemen Wilayah Timur, Indiana Pacers, tak mau ketinggalan. Melawan Atlanta Hawks, Roy Hibbert cs mengungguli tim tuan rumah 89-95. David West menjadi bintang Pacers dengan total sumbangan 22 angka 10 rebound. (m33/ap)

Sumatera Utara

WASPADA Kamis 6 Februari 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:41 12:54 12:42 12:49 12:48 12:45 12:42 12:37 12:44 12:44

‘Ashar 16:03 16:16 16:04 16:11 16:10 16:07 16:03 15:59 16:06 16:05

Magrib 18:41 18:52 18:42 18:47 18:47 18:48 18:42 18:38 18:44 18:42



Shubuh Syuruq


19:52 20:03 19:52 19:58 19:58 19:59 19:53 19:49 19:55 19:53

05:12 05:27 05:13 05:21 05:20 05:13 05:12 05:07 05:15 05:16

05:22 05:37 05:23 05:31 05:30 05:23 05:22 05:17 05:25 05:26

L.Seumawe 12:47 L. Pakam 12:40 Sei Rampah12:39 Meulaboh 12:51 P.Sidimpuan12:38 P. Siantar 12:39 Balige 12:39 R. Prapat 12:36 Sabang 12:54 Pandan 12:40

06:39 06:54 06:40 06:49 06:48 06:40 06:39 06:35 06:42 06:43

Zhuhur ‘Ashar 16:09 16:02 16:01 16:13 16:00 16:01 16:01 15:58 16:16 16:02





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:45 18:40 18:39 18:50 18:41 18:40 18:41 18:38 18:51 18:42

19:56 19:51 19:50 20:01 19:52 19:51 19:52 19:49 20:02 19:53

05:20 05:11 05:10 05:23 05:07 05:10 05:09 05:05 05:27 05:09

05:30 05:21 05:20 05:33 05:17 05:20 05:19 05:15 05:37 05:19

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:40 12:42 12:52 12:44 12:41 12:48 12:36 12:47 12:40 12:39

18:42 18:43 18:49 18:46 18:41 18:47 18:37 18:47 18:42 18:39

19:53 19:54 20:00 19:57 19:52 19:58 19:48 19:58 19:52 19:50

05:09 05:12 05:25 05:14 05:13 05:20 05:07 05:17 05:09 05:10

05:19 05:22 05:35 05:24 05:23 05:30 05:17 05:27 05:19 05:20

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:37 12:44 12:42 12:38 12:40 12:37 12:37 12:46 12:40 12:35 12:37

15:59 16:06 16:04 16:00 16:02 15:59 15:58 16:08 16:02 15:57 15:59

18:40 18:48 18:43 18:38 18:41 18:39 18:40 18:45 18:42 18:37 18:38

19:51 19:59 19:54 19:49 19:52 19:50 19:50 19:55 19:53 19:48 19:49

05:05 05:12 05:12 05:08 05:10 05:05 05:05 05:19 05:10 05:04 05:07

05:15 05:22 05:22 05:18 05:20 05:15 05:15 05:29 05:20 05:14 05:17

06:47 06:38 06:37 06:50 06:34 06:37 06:36 06:32 06:55 06:36

16:02 16:04 16:13 16:06 16:03 16:10 15:58 16:09 16:02 16:01

06:36 06:39 06:52 06:41 06:40 06:47 06:34 06:44 06:36 06:37

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:32 06:39 06:39 06:35 06:37 06:33 06:32 06:46 06:37 06:31 06:34

Sampah Manyomak Warga Resah DELISERDANG (Waspada): Sejumlah warga mengeluhkan keberadaan sampah di Jalan Asrama simpang Jalan Lembaga Pemasyarakatan – kawasan yang dikabarkan perbatasan Medan-Deliserdang. Sampah ini setiap hari terus saja bertambah dan menyebarkan bau tak sedap.

Waspada/Khairul K Siregar

KETUA Tim TP PKK Kec. Percut Seituan Ny. Herawati Darwin Zein bersama unsur pengurus menyerahkan bantuan kepada korban pengungsi Gunung Sinabung diterima koordinator pengungsi Ali Rahman di Posko Pengungsi Masjid Agung Kabanjahe.

TP PKK Percut Seituan Bantu Pengungsi Sinabung PERCUT SEITUAN (Waspada): Tim Penggerak PKK Kec. Percut Seituan dipimpin ketua tim TP PKK Kecamatan Ny. Herawati Darwin Zein bersama unsur pengurus menyerahkan bantuan kepada pengungsi Sinabung, diterima koordinator pengungsi Ali Rahman di Posko Masjid Agung Kabanjahe, kemarin. Berbagai bantuan tersebut di antaranya 10 kodi kain sarung, makanan ringan, roti kering, makanan anak-anak, dan susu. Kepada pengungsi, Ny.Herawati Darwin Zein selaku pimpinan rombongan minta bersabar, serta tabah menerima musibah dan cobaan ini, karena semua ini sudah merupakan takdir dan kehendak dariYangMahaKuasayangtidakdiketahuikapandatangdanterjadinya. Dikatakan Herawati, bantuan ini hendaknya jangan dipandang dari nilainya, namun nilailah dari rasa kemanusiaan dan bentuk keikhlasan dari pengurus TP PKK Kecamatan Percut Seituan. Sementara Koordinator pengungsi Ali Rahman atas nama pengungsi mengucapkan terimakasih atas kepedulian dan bersedia datang melihat langsung keberadaan pengungsi. “Mudah-mudahan bantuan ini dapat dipergunakan sebaik-baiknya,” kata Ali.(crul)

‘’Kita sudah lapor ke Kepling, tapi sampai saat ini tidak mendapat tanggapan,’’ ujar Yenita Sembiring, salahseorang warga di Dusun Sukadono, Desa Tanjung Gusta, Kec. Sunggal, Kab. Deliserdang, kemarin. Dijelaskannya, dia tak tahu persis lokasi ini masuk kawasan Kota Medan atau Deliserdang, tapi yang jelas keberadaan sampah yang ditumpuk memanjang di pinggir jalan ini, semakin meresahkan masyarakat. Yenita mengungkapkan, keberadaan sampah di kawasan itu sudah ada sebulan terakhir. ‘’Kita tidak tahu siapa yang menumpuk sampah di situ. Kita

perkirakan dibuang orang pada malam hari,’’ ujarnya. Dia mengharapkan agar instansi terkait, apakah Pemko Medan atau Pemkab Deliserdang, segera mengangkut sampah dari kawasan itu, karena tidak saja merusak estetika, tapi juga rentan menyebarkan penyakit. ‘’Kita tidak peduli siapa yang mengangkutnya, instansi Pemko Medan atau Pemkab Deliserdang, karena memang sampah ini kabarnya berada di kawasan perbatasan. Tapi, tolonglah, jangan terus dibiarkan. Kasihan warga,’’ ujar Yenita Sembiring. (ihn)

Waspada/Irham H Nasution

SAMPAH di pinggir Jalan Asrama/Jalan Lembaga Pemasyarakatan, yang berada di perbatasan Kota Medan dan Kab. Deliserdang, meresahkan warga karena dibiarkan teronggok berbulan-bulan.

Amri Serahkan Perlengkapan Sekolah Dan Akte Kelahiran LUBUKPAKAM (Waspada): Bupati Deliserdang Drs H. Amri Tambunan menyerahkan akte kelahiran gratis kepada 100 anak, perlengkapan sekolah bagi anak didik dari warga kurang mampu, bibit ikan lele kepada sejumlah peternak, bibit pohon buah unggulan serta menandatangani prasasti peresmian kantor Kel. Cemara dan Syahmad Kec. Lubukpakam. Kegiatan tersebut dilakukan Bupati dalam rangkaian peringatan Maulid Nabi Besar MuhammadSAW yangdilaksanakanPemkabDeliserdang dilapanganSegitiga Lubuk Pakam, Selasa (4/2). Terlihat ribuan umat muslim yang umumnya kaum ibu dari beberapa wilayah mengikuti tausiyahdisampaikanUstadzHM IrfanYusuf. Hadir unsur Muspida, Wakil Ketua DPRD H. Dwi Andi Syahputra Lubis, Lc, Asisten I SetdakabH.Syafrullah,S.Sos,MAP, Ketua TP PKK Ny. Hj. Anita Amri

Tambunan, Ketua GOPTKI Ny. Hj. Asdiana Zainuddin, pimpinan SKPD jajaran Pemkab Deliserdang, Camat, PNS, LVRI, tokoh pemuka masyarakat serta Kades/ Lurah. Bupati menyampaikan terimakasihdanbanggamenyaksikan kebersamaan yang ditunjukkan pada peringatan Maulid Nabi pertanda adanya tekad dan semangat membangun diri, menatap masa depan kepada yang lebih baik. Sebagai umat beragama kita harus memiliki tujuan, pijakan mau pun langkah pasti, karena kita dihadapkan kepada dua kehidupan penting yang akan kita jalani, yaitu bagaimana tindakan kita di dunia dan bagaimana kehidupan di akhirat. Demikian juga dengan keberhasilan pembangunan yang dilaksanakan hampir di semua sektor lewat pola kebersamaan bersinerjinya kekuatan pemerintah didukung pihak

swasta dan partisipasi masyarakat. Ini juga menunjukkan, kita tidaklah termasuk golongan orang- orang yang berputus asa atau frustasi.Tetapi mampu menempatkanposisisejalan dengan lajunya perkembangan zaman. Sementara Ustadz HM Irfan Yusuf dalam tausiyahnya mengatakan semua umat manusia memiliki visi dan misi kehidupan, yaitu kebahagiaan di dunia dan akhirat yang tentu didapat dengan cara menjadikan hidup kita barokah.“Tunjukkan kesyukuranketikamendapatrezekidan tetap bersabar bila tertimpa musibah,” katanya. Sebelumnya, Bupati H. Amri Tambunan meletakkan batu pertama pembangunan Masjid Amal Islamiyah Lubuk Pakam Kel. Lubuk Pakam Pekan, sekaligus memberi infaq pribadi bagi mendukung pembangunan masjid tersebut sebanyak 1.000 zak semen.(a06)

Muhammadiyah Dan IPM Sergai Bantu Pengungsi Sinabung SEIRAMPAH (Waspada): Keluarga besar Pimpinan Daerah (PD) Muhammadiyah dan Ikatan Pelajar Muhammadiyah (IPM) Kab. Serdang Bedagai menyerahkan bantuan ke pengungsi korban erupsi gunung Sinabung di Kab. Karo, kemarin. Bantuan berupa 210 paket sembako, 120 paket dari PDM dan 90 paket dari IPM, serta pakaian layak pakai yang langsung diserahkan ke posko di kompleks masjidTaqwa Muhammadiyah di Desa Berhala, Kab. Karo, diterima penanggungjawab posko, Drs. H. Erwin Tanjung yang juga Ketua PD Muhammadiyah Kab. Karo. Rombongan PD Muhammadiyah Sergai dipimpin Ketuanya, H. Zubir Hamzah didampingi Sekretaris, H. Amiruddin Lubis, SPd, Bendahara, Drs. H. Pargino, MSi dan lainnya serta pengurus Aisyiyah. H. Zubir Hamzah mengatakan bantuan yang diberikan jangan dipandangdaribesarmaupunkecilnya,namunnilailahdarikeikhlasan dan kepedulian terhadap sesama, kiranya bantuan yang sedikit ini dapat bermanfaat. Sementara u Ketua Posko pengungsian, Drs. H. Erwin Tanjung mengucapkan terimakasih atas kepedulian warga Muhammadiyah Sergai dan pelajar Muhammadiyah yang memberi bantuan paket sembako yang memang sangat dibutuhkan pengungsi. Diakui Erwin Tanjung, Muhammadiyah Karo membuka dua posko pengungsian di kompleks MasjidTaqwa dan di komplek sekolah Muhammadiyah dengan pengungsi diperkirakan berjumlah 700 kepelakeluarga.Pihaknyajugamasihberharapbantuanpascabencana kelak yang diharapkan berbentuk uang. (c03)

Waspada/HM Husni Siregar

BUPATI Drs H. Amri Tambunan menyerahkan perlengkapan sekolah kepada salah seorang anak pada rangkaian peringatan Maulid Nabi Besar Muhammad SAW di Lapangan Segitiga Lubuk Pakam.

Aksi Perompakan Semakin Marak P.BRANDAN(Waspada):Aksi perompakan dan penyanderaan terhadap nelayan tradisional asal Pangkalansusu, Langkat di perairan Aceh Timur dan Aceh Tamiang membuktikan betapa lemahnya aparat Polair dan Kamlamenjagakeamanandilaut. Pernyataan ini disampaikan PresediumKesatuanNelayanTradisional Indonesia (KNTI) Region Sumatera, Tajrudin Hasibuan, Rabu (5/2) di P. Brandan. Ia kecewa melihat kinerja aparat terkait tak mampu melindungi keamanan nelayan. Diamengatakan,eskalasiaksi perompakan di laut yang dilakukangerombolanorangbersenjata api banyak memakan korban di pihak nelayan tradisional asal Langkat. “Aksi kejahatan ini berulangkali terjadi, namun komplotan OTK yang meresahkan tak

juga berhasil dibongkar,” ujarnya. Diamengakuprihatinmelihat nasib nelayan tradisional di Pangkalansusu yang terus menjadi sasaran kawanan perompak bersenjata di wilayah perairan Aceh. Hasibuan mengaku kecewa,kenapaaparatkeamanan tak mampu menumpas aksi kejahatan yang sudah sangat merajalela di laut. Aksi gerombolan perompak bersenjata ini, kataya, sudah pada tingkat sangat meresahkan. Karena itu ia mendesak aparat berkompeten meningkatkan keamanan dengan melakukan patroli rutin, khususnya di wilayah yang dianggap rawan. Menurut Presedium KNTI, kehidupan nelayan tradisional sudah sangat terjepit. Nelayan, katanya, tak hanya harus berhadapan dengan gangguan ke-

amanandarikelompokbersenjata di negeri sendiri, tapi juga selalu ditangkapaparatMalaysiakarena dituduh melanggar teritorial antar negara. Selain itu, lanjut Hasibuan, nelayan tradisional kerab berkonflik dengan nelayan modern. Ekspansi Pukat Trawl, Pukat GrandongdanPukatLayangyang menjangkau sampai ke zona tangkapan nelayan tradisional juga menjadi problem serius yang berpotensi memunculkan konflik horizontal. “Kehidupan nelayan tradisional di daerah ini sungguh sangat dilematis,” ujar Presedium KNTI seraya mendesak Bakorkamla menciptakan situasi keamanan di laut yang benarbenar kondusif, supaya nelayan tradisional nyaman dalam mencari nafkah.(a02)

Penderita Kanker Payudara Meningkat Setiap Tahun TEBINGTINGGI (Waspada): Kanker payudara diyakini akan menjadi pembunuh nomor wahid bagi wanita, selain kanker cervik (mulut rahim). Bahkan, jumlah penderita setiap tahun terus meningkat. Di kotaTebingtinggi misalnya, pada 2013 terdeteksi 65 penderita kanker payudara berdasarkan data dari empat rumah sakit. Hal itu terungkap dalam Seminar Deteksi Dini Kanker Payudara diselenggarakan Persatuan Perawat Nasional Indonesia (PPNI) Kota Tebingtinggi, dalam rangkamemperingatiHariKanker se DuniaTahun 2014, Selasa (4/2), di gedung Hj. Sawiyah Nasution. Seminar sehari dibuka Wali Kota Tebingtinggi Ir. H Umar Zunaidi Hasibuan, MM diwakili Wawako H. Irham Taufik, SH, MAP, menghadirkan narasumber Dr Kamal Basri Siregar, Sp.B (K) Onk Finacs, Ketua Yayasan Payudara Sehat Sumut, Drg Hj. Liswati Harahap, Kakan PPAKB Tebingtinggi Drg Dina Kamarina, Ketua PPNI Ernawaty Lubis, S.Pd, M.Kes, Ketua IDI, PDGI serta kepala rumah sakit umum dan swasta se Kota Tebingtinggi. WalikotaTebingtinggimelalui

Wawako H Irham Taufik, SH memberi apresiasi kepada PPNI selaku penyelenggara seminar. Dikatakan penyakit ini ranking ke 4 di seluruh dunia. “Mari kita tingkatkkan kualitas kesehatan karenapekerjaaninisangatmulia, diharapkan para ibu mensosialisasi kepada keluarga dan masyarakattentangbagaimanabahayanya kanker dan bagaimana pencegahannya,” kata Irham Taufik. Ketua PPNI Tebingtinggi sekaligus panitia penyelenggara seminar Ernawaty Lubis, M.Kes mengatakan, di Indonesia penyakit kanker payudara sangat berbahaya dan pembunuh wanitasetelahkankerservik.Sejak 2004 sebagaimana dikutip dari profil kesehatan di Indonesia, terdapat5.207kasus,ditahun2005 meningkat 7.850 kasus, tahun 2006 meningkat 8.328 kasus, dan 2007 jumlahnya menurun 8.277 kasus. MenurutWHO, pada 2030 akan terjadi lonjakan penderita di Indonesia hingga 7 kali lipat. “Di Tebingtinggi ada empat rumah sakit yang saat ini menangani penyakit kanker masingmasing RS Umum 33 orang, RS Herna 14 orang, RS Sri Pamela 13 orang, RS Bhayangkari 5 orang

dengan jumlah keseluruhan 65 orang.Bagipenderitakankerharus tetap bersemangat untuk sembuh,” imbuhnya. KetuaYayasan Payudara Sehat Sumut Drg Hj. Liswati Harahap mengatakan, penderita kanker payudara semakin hari makin meningkat dan kebanyakan meninggal dunia. “Kami ingin membuka jaringandidaerahmasing-masing karena angka kematian akibat penyakit ini sangat tinggi. Sebenarnyakankerinitidakberbahaya, yayasan kami berharap agar dalam sehari-hari membuat pola hidup sehat. Penderita kebanyakanwanitaberumur35tahun, diimbau agar sekali setahun memeriksa ke ahlinya dan kami harap ibu-ibu memperhatikan anak-anak perempuannya masing-masing,” imbaunya. Sedangkan narasumber, Dr Kamal Basri Siregar memaparkan,kankeradalahpertumbuhan sel tidak terkenali dan dapat tumbuhdimana-mana,kankerpayudara pertama kali ditemukan di Mesir pada 3.500 tahun sebelum masehi, penyebabnya adalah kelainanbawaan,lingkungandan gaya hidup. (a09)

Mitra Dan Pekerjanya Sebagai Aset PARMAKSIAN (Waspada): Suatu waktu pada tahun 2003, seorang pengusaha lokal di Porsea yang menjadi mitrausaha TobaPulp untuk menangani pekerjaan pemeliharaan (maintenance) jalan menghubungkan Sirait Uruk dengan pabrik, berujar, “pekerjaan ini pasti beres!”. Si pengusaha merasa perlu ’menegaskan’ hal itu, karena nilai pekerjaannya melampaui Rp1,5 miliar. Pada hal perusahaannya –bila mengacu pada penggolongan di instansi Pekerjaan Umum— hanya level “C.” Di pemerintahan, kontrak di atas Rp1 miliar menjadi porsi kelas “A.” Uraian di atas hanya ilustrasi bagaimana motto, “Siapa pun pada dasarnya dapat melakukan pekerjaan apa pun,” sepanjang memenuhi kualifikasi. Tinggi-rendah kualifikasi seseorang tergantung pada kesungguhan meraihnya. Tidak ada halangan bagi perusahaan bermodal “pas-pasan” untuk meraih grade lebih tinggi, sepanjang ia mampu menunjukkan bahwa ia layak untuk itu.

Dan, itulah yang terjadi ketika si level-C di atas menangani pekerjaan level-A, dan nyatanya kemudian: Sukses! TobaPulp, sejak 2003 memang berkomitmen membuka peluang bagi para rekanan lokal di sekitar daerah kerjanya untuk menjadi mitra-usaha atas dasar saling membutuhkan dan saling menguntungkan. Daerah kerja itu meliputi seputaran pabrik di Parmaksian (Tobasamosir), serta konsesi HTI (hutan tanaman industri) di sektorsektor Aeknauli (Simalungun), Habinsaran ( Tobasamosir, Tapanuli Utara), Tele (Humbang Hasundutan, Samosir, Dairi, Pakpak Bharat), Aekraja (Tapanuli Utara, Humbang Hasundutan), Sidimpuan (Tapanuli Selatan, Padanglawas Utara, kota Sidimpuan). Jenis-jenis pekerjaan yang diserahkan kepada para mitra beragam, meliputi: house keeping, pekerjaan sipil, pembersihan lahan tanam (land clearing), penanaman, perawatan, pemanenan, serta pengangkutan (bahan baku dari HTI ke

pabrik dan produksi dari pabrik ke pelabuhan). Jumlah mitra berfluktuasi. Dipengaruhi volume pekerjaan pada setiap periode. Tetapi per Desember 2013 jumlahnya mencapai 315 perusahaan. Mereka mempekerjakan sekitar 5.000 orang, hampir seluruhnya tenaga setempat-setempat. Nilai transaksi 2003 hingga 2012 mencapai Rp1,3 triliun, atau rata-rata Rp110,8 miliar per tahun. Angka ini, cukup spektakuler. Sebagaimana lazimnya perikatan, kontrak pasti memuat sejumlah persyaratan untuk menjadi mitra. Dua hal penting diantaranya ialah, perusahaan mitra mesti bersedia menaati semua ketentuan hukum tentang usaha, serta bersedia mendaftarkan para pekerjanya sebagai peserta Jamsostek (jaminan sosial tenaga kerja). Bagi TobaPulp ini prinsip. Sebab, para mitra dan juga pekerjanya merupakan aset, bukan sekedar faktor produksi. Karena itu para rekanan harus

berani tumbuh dan berkembang bersama iklim yang sehat (indikatornya pemupukan aset dan skill manajemen). Para pekerjanya pun harus diberi kesempatan untuk memperoleh seluruh hak dasarnya sebagai pekerja. Ada banyak kisah sukses para mitra. Beberapa diantaranya perusahaan komanditer (CV) Luhut Jaya (rekanan bidang angkutan), Tonggi Buana (jasa borongan), Marpaung Margana (sipil dan mekanik), Mulia Utama (pekerjaan umum),Widia Tama Coy (manpower), Kartini di nursery, Tekun Jaya (jasa borongan), dan Kaliber (pengaspalan). Contoh pengusaha yang tidak menjadi rekanan, tetapi secara jeli menangkap peluang usaha atas kehadiran perusahaan, ialah Lijon Situmorang, 45. Ia suskses menjadi pemasok barangbarang elektronik, air minum isi-ulang, dan ayam potong sebagai sumber protein hewani. Lijon–kinisudahmenjadijutawan lokal—menyebut 50% konsumennya “warga” TobaPulp.(*)


PARLINDUNGAN Marpaung (CV Marpaung Margana) mengawasi pekerjaan las pesanan TobaPulp, yang sejak 10 tahun terakhir menjalin kerjasama kemitraan.

B2 Sumatera Utara Tak Mau Disuruh Makan, Suami Babakbelurkan Istri PEMATANGSIANTAR (Waspada): Hanya garagara tidak mau disuruh makan, seorang suami diduga menganiaya istrinya, korban Evi Susanti Purba, 40, wiraswasta warga Jalan Asrama Martoba, Kel. Nagapitu, Kec. Siantar Martoba, Kota Pematangsiantar, hingga babak belur. Informasi dihimpun dan sesuaipengaduankorbandiPolres Pematangsiantar, Selasa (4/2), korbandidugadianiayasuaminya, Re, 54, kuli bangunan di dalam rumah mereka di Jalan Asrama Martoba, Minggu (2/2). Menurutpengaduankorban, penganiayaan yang dilakukan suaminya terhadapnya sudah

berulang-ulang dan yang terakhir membuat korban tidak bisa menahan sabar lagi dan akhirnya mengadukan suaminya ke polisi sesudah berembuk dengan pihak keluarganya. Peristiwa ini diawali pertengkaran ketika korban meminta uang belanja kepada suaminya dan tidak diberikan. Ketika

Rapidin Simbolon Wabup Samosir SAMOSIR (Waspada): Melalui Sidang Paripurna DPRD Samosir, Rapidin Simbolon unggul dari saingannya Juang Sinaga untuk memenangkan pemilihan kursi Wakil Bupati Samosir di Gedung DPRD Samosir Komplek Parbaba Pangururan, Selasa (4/2). Kemenangan Rapidin yang memperoleh 15 suara DPRD dari jumlah 25 DPRD Kab Samosir selanjutnya akan mendampingi Bupati Samosir Ir Mangindar Simbolon periode 2010-2015. Wakil Bupati periode 2010-2015 Mangadap Sinaga meninggal dunia 2012. Sebelum pemilihan dilakukan, para calon wakil Bupati menyampaikanvisidanmisinyadihadapan25anggotaDPRDSamosir dan para undangan serta masyarakat Samosir. Visi dan misi kedua calon menitikberatkan pada potensi Kab. Samosir sebagai Daerah Tujuan Wisata (DTW) yang harus terus digalidandikembangkansertadukunganpenuhdariPemkabSamosir. Kemudian pemilihan Wakil Bupati Samosir melalui hak suara DPRD Samosir dilakukan di bilik suara. (c11)

KPUD Humbahas Siapkan Logistik DOLOKSANGGUL (Waspada): Menjelang pemilihan legislatif DPR, DPD, DPRD Provinsi dan DPRD Kab/kota 9 April 2014, Komisi Pemilihan Umum Daerah (KPUD) Humbang Hasundutan (Humbahas) menyiapkan logistik pemilu. Logistik tersebut yakni kotak suara, bilik suara dan kertas suara dan lainnya. Hal itu dikemukakan Ketua KPUD Humbahas, Eviasi Manalu, SPd melalui Sekertaris KPU Tagor Manullang, SmHk saat ditemui wartawan di kantornya, kemarin. Tagormengatakan,sesuaidengankebutuhanPileg,sementarapihak KPUhanyamenyiapkan222kotaksuara,235biliksuara,15.000amplop dan16.410sampul.“Secarakeseluruhanlogistikpilegbelummemenuhi kebutuhan.Untukitu,sebelumhari-HpelaksanaanPilegsemualogistik sudah harus terpenuhi demi kelancaran Pemilu,” jelas Tagor. Untuk menyukseskan pemilu legislatif, tambahTagor, pihak KPU setempat telah merekrut 25 tim relawan. Perekrutan tim relawan itu sesuaisuratedaranKPUpusat.Timrelawantersebutditugaskanmembantu KPU mensosialisasikan pemilu dan menekan angka golput. Sesuai daftar caleg tetap (DCT) sebelumnya, jumlah caleg DPRD Humbahas mengalami perubahan dari 230 orang menjadi 229 orang. Perubahan jumlah caleg tersebut dikarenakan satu orang caleg dari Partai Demokrat dapil satu meninggal dunia. (a21)

pertengkaran mereda, suami korban menyuruhnya makan, namun korban tidak mau, sehingga suami korban menjadi emosi dan menyiramkan air minum dari gelas yang dipegangnya ke wajah korban. Tidak cukup sampai di situ, suami korban yang terlihat memuncak emosinya, segera mendekati korban dan melayangkan bogem mentah dua kali ke wajah korban hingga wajah korban mengalami luka biram. Korban yang tidak mau lagi menjadi bulan-bulanan pukulan suaminya,akhirnyamemilihpergi dari rumahnya dan menemui pihak keluarganya, sehingga akhirnya diputuskan mengadukan suami korban ke Polres pada Selasa (4/2). Sesudah menerima pengaduan korban, pihak kepolisian

segera bertindak mencari suami korban dan menemukannya. Namun, sesudah dibawa ke Mapolres, suami korban meminta agar jangan diproses dan meminta maaf kepada korban. Namun, korban tidak mau memaafkan suaminya, sehingga suaminya dijebloskan ke dalam ruang tahanan Mapolres. Secara terpisah, seorang pria, JS,40,sopir,wargaDolokBaringin, Pematangsiantar diduga menganiaya korban KemanTarigan, 43, wiraswasta, warga Jalan Farel Pasaribu, Gang Prima, Kel. Pardamean, Kec. SiantarTimur, Pematangsiantar di satu kedai tuak di JalanFarelPasaribu,GangCempedak, Kelurahan Pardamean pada Selasa (4/2) pukul 18:30. Penganiayaan diduga dilakukan JS dengan menumbuk wajah korban satu kali hingga

mengalami luka memar, akibat terjadi kesalahpahaman. Tidak menerima penganiayaan yang dialaminya,korbanmengadukan JS ke Polres. Kapolres Pematangsiantar AKBP Slamet Loesiono, SIK saat dikonfirmasi melalui Kasubbag Humas AKP Nuriaman Ray Rangkuti dan Kasat Reskrim AKP Hasoloan Sinambela, Rabu (5/ 2) menyebutkan pengaduan korban Evi Susanti Purba sedang diproses dan suaminya diduga melakukan tindak pidana kekerasan dalam rumah tangga (KDRT) dan melanggar Pasal 44 UU RI nomor 23 tahun 2004 tentang Penghapusan KDRT serta pengaduan KemanTarigan juga masih dalam proses dan JS diduga melakukan tindak pidana penganiayaan dan melanggar Pasal 351 KUH Pidana. (a30)

Diminta Peran Pemuda Gali Potensi Daerah DOLOK SANGGUL (Waspada):Untukmenggalidanmemanfaatkan potensi daerah, peran sertapemudasangatdibutuhkan. Beberapa potensi dimaksud, bidang olahraga, seni, pertanian dan banyak hal-hal yang lain. Demikian disampaikan Sekdakab Humbang Hasundutan (Humbahas) Saul Situmorang, SE MSi saat menjamu audensi Ikatan Pemuda Indonesia (IPI) cabang Humbahas di Sekretariat kantor bupati, Bukit Inspirasi, Dolok Sanggul, baru-baru ini. Dikatakan Saul, banyak kesenianataupunolahragadaerah yang belum dikembangkan, padahal potensi manusianya cukup tersedia. Dalam bidang seni, masyarakat Humbang Hasundutan memiliki potensi seniman yang tinggi. Begitu juga bidang pertanian, perkebunan danpelestarianlingkunganmasih

butuh perhatian pemuda. “Sangatlahmenjanjikanjikapemuda menggalisemuaitudemimendukung program dan visi-misi Pemkab Humbahas,” terangya. Katanya,PemkabHumbahas menyambut baik kehadiran IPI di Humbahas dan mengharapkan agar IPI tampil beda dengan segala kepeduliannya terhadap pemerintah, masyarakat plus lingkungan. Sebagai organisasi pemuda, hendaknya memiliki prinsip menjaga ketertiban, keamanan bersama-sama dengan pemerintah. “Kita harus memiliki hubungan yang sinergis dan penuh kerjasama” kata putra Parlilitan Humbahas itu. Christopel Simamora SE Ketua IPI cabang Humbahas sangat mengapresiasi sambutan Pemkab Humbahas. Katanya, IPI sudah punya program kerja antara lainpelestarianlingkungan,perta-

nian, kebersihan kota termasuk mendukung program pemerintah dalam pembangunan. Program jangka pendek membersihkan daerah Dolok Sanggul dari sampah sebagai ibukota Kab. Humbahas. Karena kondisi perkembangan jumlah penduduk di kota Dolok Sanggul berpengaruh terhadap sampah yang membludak. Maka IPI siap bekerjasama dengan pemerintah setempat demi pembangunan di Kab. Humbahas yang masih 10tahunterbentuk.Itusebagaisuatu tindakan kepedulian IPI sekaligus menunjukkankeinginantampilbeda dengan organisasi lain. Selain dihadiri pengurus IPI, hadirdalampertemuanituKakan Kesbang Tibum Drs Houtman Sinaga SH, Kakan Pora DrsWilfrid Siahaan, Kabag Humas Pemkab Humbahas Osborn Siahaan BA, Ketua PAC IPI Lintongnihuta Juandi Sihombing. (a21)

WASPADA Kamis 6 Februari 2014

Waspada/Ahmad Cerem Meha

JALAN By Pass Padangsidimpuan kupak-kapik.

Jalinsum By Pass P. Sidimpuan Kupak-kapik P. SIDIMPUN (Waspada): Masyarakat Kota Padangsidimpuan yang sering melintasi Jalan By Pass (Jalan Jend Abdul Haris Nasution) kecewa karena jalan ini kupak-kapik. “Kita kecewa melihat kondisi Jalan By Pass ini, mulai tahun 2013 lalu hingga 2014 belum dibenahi pihak terkait. Apa memang tak ada biaya rutin perbaikan jalan ini,”sebut warga setempat, Khairul Pulungan, 36.

Amatan Waspada, jalinsum ini berlobanglobang di sejumlah titik, yaitu di Kel. Pudun hingga ke Kel. Paolpat Pijorkoling sekira 2 Km. Jika turun hujan lobang jalan ini digenangi air, lebar lobang rata-rata 3 meter. Anggota DPRD Kota Padangsidimpuan dari dapem ini, Sopian Harahap meminta pihak Dinas Bina Marga mengatasi masalah yang sangat meresahkan masyarakat ini. (c13)

44 PNS Humbahas Gagal Pensiun DOLOKSANGGUL (Waspada): Sesuai surat edaranBKNnomor:K.26-30/V.7-3/99 ,44pegawai negeri sipil (PNS) usia 56 tahun yang bekerja di lingkungan Pemkab Humbahas gagal pensiun. Gagal pensiun bagi para PNS tersebut merujuk terbitnya UU No. 5 tahun 2014 tentang Aparatur Sipil Negara (ASN) dengan batas maksimal usia pensiun PNS 58 tahun. Demikian Kepala BKD Humbahas Drs Laurencius Sibarani melalui Sekertaris BKD Suhut Silaban, kepada wartawan, kemarin. Dikatakan, kententuan perpanjangan masa pensiun hanya berlaku bagi pegawai negeri sipil yang menduduki jabatan eselon III (pejabat administrasi) ke bawah. Namun untuk PNS yang menjabat sebagai pejabat pimpinan tinggi atau setingkat eselon I dan II, usia pensiunnya diperpanjang menjadi 60 tahun tanpa melalui mekanisme perpanjangan oleh pejabat pembina kepegawaian. Suhut menjelaskan, apabila SK keputusan

pemberhentiannya telah ditetapkan, baik sudah diterima ataupun yang belum diterima oleh yang bersangkutan tetapi tidak bersedia lagi melaksanakan tugas, maka yang bersangkutan boleh mengajukan surat pernyataan tidak bersedia lagi melaksanakan tugas secara tertulis dan bermateraikepadapejabatpembinakepegawaian, dan keputusan pemberhentian serta pemberian kenaikan pangkat pengabdiannya yang sudah ditetapkan dan diterima yang bersangkutan tetap berlaku. Kabag Humas Setdakab Humbahas, Osborn Siahaan saat dikonfirmasi wartawan, mengatakan bahwa perpanjangan abdi Negara dari umur 56 tahun menjadi 58 tahun adalah suatu kabar gembira bagi PNS. Demikian juga pejabat eselon II yang diperpanjang hingga batas usia 60 tahun. “Perpanjangan batas pensiun bagi para abdi negara, kita pandang dari sudut positifnya saja. PNSyangseharusnyasudahpurnabaktidiharapkan bekerja lebih giat,”ujarnya. (a21)

Sumatera Utara

WASPADA Kamis 6 Februari 2014


Jalan Panyabungan-Muarasipongi Berlubang Dan Abrasi PANYABUNGAN (Waspada): Jalan negara lintas Sumatera Panyabungan-Muarasipongi, Kec. Kotanopan, Kab. Mandailing Natal (Madina), berlubang dan abrasi. Kondisi ini dianggap sangat membahayakan dan sudah berlangsung beberapa bulan terakhir. Kalau tidak ada antisipasi dari pihak terkait, dikhawatirkan akan memakan korban jiwa. Pantauan Waspada di lapangan, Rabu (5/2), jalan negara yang berlubang ini ada di beberapatitik,mulaidariSimpang Muara Mais Kec. Tambangan, di

Desa Muara Tagor Kec. Kotanopan, di Desa Muara Kumpulan Kec. Muara Siongi. Besarnya lubang yang terdapat di badan jalan ini cukup menganggu pengguna kendaraan. Bahkan, di daerah Muara Kumpulan, badan jalan sudah berubah menjadi aliran sungai. Selainitu,dibeberapatempat, ada juga jalan yang abrasi, seperti

Sosialisasi Pengelolaan Dana BOS 2014 SOSA (Waspada): Untuk menghindari penyimpangan ataupun kontaminasi unsur korupsi, kolusi, dan nepotisme (KKN), seluruh kepala sekolah (kepsek) dan bendahara jajaran Pememerintah Kabupaten Padanglawas mengikuti sosialisasi pengelolaan dana Operasi Sekolah (BOS) 2014 di SDN Desa Aek Tinga, Kec. Sosa. Kepala Dinas Pendidikan Kabupaten Padang Lawas, Drs. H. Khoiruddin Harahap didampingi maneger BOS, Mulyadi Hasibuan, S.Pd, Selasa (4/2), mengatakan, untuk menghindari penyimpangan dan unsur KKN demi tercapainya pengelolaan keuangan dana BOS yang baik dan sesuai aturan, sehingga tepat sasaran.. ‘’Maka kita menggelar acara sosialisasi dan diikuti seluruh kepsek dan SD dan SMP di wilayah Kecamatan Sosa, Batang Lubu Sutam dan Hutaraja Tinggi,’’ katanya seraya mengatakan, dalam kegiatan ini dihadirkan sejumlah narasumber. Kegiatan sosialisasi ini berlangsung Selasa (4/2). Mulyadi menyebutkan, peserta berjumlah 66 orang termasuk kepala sekolah dan bendahara. Dimana sebanyak 59 berasal dari sekolah tingkat SD dan sekolah negeri yaitu 56 SD dan tujuh SMP. Kadis Pendidikan berharap agar para peserta yang terlibat langsung dengan pengelolaan dan BOS bisa bekerja dengan baik sesuai aturan. (a33)

Waspada/ Ist

di daerah Maga, Kec. Lembah Sorik Marapi, tepatnya di dekat Simpang Pangkat. Jalan yang abrasi di daerah ini juga cukup menganggu pengguna jalan, sebab selain posisinya di turunan jalan juga berada di tikungan. Kalau dari kejauhan, jalan yang abrasiinitidakterlihatsamasekali. Begitu juga di daerah Desa Lumban Pasir Kec. Tambangan, badan jalan di daerah ini turun mencapai30cm.Bagipengemudi yang dari luar kota disarankan lebih berhati-hati, sebab amblasnya jalan ini cukup panjang men-

capai 100 meter. Kondisi semakin rawan kecelakaan karena di daerahinitidakdilengkapiramburambu, padahal ambalasnya jalan inisudahberlangsungcukup lama, sudah bertahun-tahun. M. Sanusi Nasution, 45, salahseorang sopir angkot yang setiap hari lewat di jalur ini mengatakan, rusak jalan negara inisudahcukuplama,sampaisaat inisepertinyatidakadaperrhatian dari pihak terkait. Begitu juga dengan jalan yang ambalas di daerah Lumban Pasir juga sudah bertahun-tahun.“Palingmemba-

hayakan pengguna jalan adalah jalanyangamblasdanyangabrasi di daerah Maga,’’ ucapnya. Dikatakan, mengingat jalan ini jalan lintas Sumatera sampai Sumatera Barat, pemerintah seharusnya sudah memperbaiki ini. Ratusan pengguna jalan menggunakanjalurinisetiaphari. Kalau tidak diperbaiki dikhawatirkan akan menggundang korban jiwa. Pemerintah pusat sebagai penanggungjawab jalan ini harus mengupayakan perbaikan dan pembangunannya,” katanya. (c15)

4 Kandungan Logam Limbah Cair PT AR Nyaris Tak Terdeteksi BATANGTORU (Waspada): Komitmen PT Agincourt Resources (AR) agar air sisa proses (limbah cair) Tambang Emas Martabe tidak merusak air dan ekosistem sekitar Sungai Batangtoru,Kab.TapanuliSelatan, mulai terbukti. Berdasarkan hasil uji laboratorium PT Intertek (lab bersertifikat dan diakui negara) terhadap sampel limbah cair yang diambil Tim Terpadu Pemantau Kualitas Air Limbah Tambang Emas Martabe.Semuajeniskandungan logam yang diteliti berada jauh di bawah ambang baku mutu Keputusan Menteri Lingkungan Hidup No.202 tahun 2004. “Bahkan 4 dari 11 kandungan logam limbah cair PT AR yang diuji lab PT Intertek, nyaris tidak terdeteksi alat lab,” kata Ketua Tim Terpadu Pemantau Kualitas AirjugaWakilBupatiTapsel,Aldinz Rapolo Siregar, Selasa (4/2), usai pembukaan amplop hasil uji lab PT Intertek di camp Tambang Emas Martabe. Hasil uji lab ini merupakan hasil pengujian terhadap sampel air sungai dan air sisa proses yang dilakukan 12 Januari kemarin. Pengambilannya melibatkan 13 anggota Divisi Pengambilan

Contoh Uji Tim Terpadu.Termasuk masyarakat Kec. Batangtoru dan Kec. Muara Batangtoru, dipimpin Kaban LH Tapsel, Ali Syahruddin SH. Lokasi pengambilan sampel air dilakukan di pangkal (inlet) dan ujung (outlet) pipa pembuangan air sisa proses. Kemudian di Sungai Batangtoru pada 500 meter sebelum titik pelepasan air, di 500 meter, 1.000 M, 2.000 M,dan3.000Mtitikpercampuran air limbah denga air sungai. Sampel air dari semua titik dimasukkankekotakyangdisegel dan dibawa ke lab PT Intertek di Jakarta. Hasil uji laboratorium diselesaikan 14 hari. Hasil ini kemudian disampaikan kepada Divisi Evaluasi Tim Terpadu Pemantau Kualitas Air dan Ketua Tim Terpadu Pemantau Kualitas Air, untuk dibuka dan diumumkan ke khalayak ramai. Sampel air diambil dari 8 titik sebelum dan sesudah pipa pembuangan limbah cair Tambang Emas Martabe ke Sungai Batangtoru. Selain Tim Terpadu yang mengambil dan menguji sampel setiap tiga bulan, secara internal PT AR juga melakukannya setiap bulan. Adapun11kandunganlogam

yang diuji pada sampel air sisa proses tambang itu terdiri dari, tingkat keasaman air (pH), kekeruhan air (TSS), kadmium (Cd), kromium (Cr), merkuri (Hg),nikel(Ni),sianida(CN),arsen (As), tembaga (Cu), timbal (Pb) dan seng (ZN). Berdasarkan Kepmen LingkunganHidupNo.202tahun2004, batas ambang baku kandungan logam yang tidak berbahaya bagi ekosistem air dan penggunanya adalah, pH 6-9 sementara pada limbah cair PT AR hanya 7,67. TSS ambang bakunya 200 mg/L di PT AR saat ini hanya 46 mg/L. Untuk Cd 0,1 mg/L (<0,0001), Cr 1 mg/L (0,001), Hg 0,005 mg/L (0,00005), Ni 0,5 mg/ L (0,001), CN 0,5 mg/L (0,005), As 0,5 mg/L (0,002), Cu 2 mg/ L (0,005), Pb 1 mg/L (0,001), ZN 5 mg/L (0,005). “4 kandungan logam yang nyaris tak terdeksi alat uji lab yang menggunakan sinar x-ray (mirip ronsen) itu adalah, Cd <0,0001, Cr 0,001, Cn 0,005, dan Pb 0,001,” kata Aldinz didampingi Government Relation Manager PT AR, Septamto Inkriwang, Environmental Manager PT AR, Candra Nugraha, dan 13 tokoh masyarakat lingkar tambang. (a27)

SRI Masanah Ginting membesuk M. Rizki di kediamannya.

Caleg Bantu Masyarakat Memperoleh Kesehatan

Waspada/Sukri Falah Harahap

KETUA Tim Terpadu juga Wabup Tapsel, Aldinz Rapolo Siregar, menyaksikan warga yang menandatangani berita acara pembukaan amplop dan pembacaan hasil uji lab PT Intertek atas limbah cair Tambang Emas Martabe, Selasa (4/2).

Koramil Padangbolak Gotongroyong

SUGIANTO korban bentrokan antar pekerja yang terjadi di Desa Sumber Mulyo Dusun 6 PT SHJ, Rabu (5/2).

Bentrok Antar Pekerja Di Desa Sumber Mulyo RANTAUPRAPAT(Waspada): Bentrokan terjadi antara Serikat Buruh Sejahtera Indonesia (SBSI) dengan Serikat Pekerja Seluruh Indonesia (SPSI) di Desa Sumber Mulyo Dusun 6, lokasi PT Serba Huta Jaya (SHJ), Kec. Marbau, Kab. Labuhanbatu Utara (Labura), Rabu (5/2) sekitar pukul 09.40 Wib. Bentrokan terjadi sekita pukul 09.40Wib antara 40 orang anggota SPSI dengan 10 orang anggota SBSI di Desa Sumber Mulyo. “Perselisihan berawal dua bulan yang lalu antara kedua organisasi di lokasi PT SHJ Desa Sumber Mulyo, pihak kami yang semulanya mendirikan orgaisasi Serikat Pekerja Jaya Mandiri (SPJM) yang sudah berjalan satu tahun,” ujar Wakil Ketua SBSI, Solehuddin Hasibuan didampingi Sekertaris Joko Sudarwo kepada Waspada Rabu (5/ 2) di Rantauprapat, ketika membawa korban bentrokan, Sugianto yang mengalami memar akibat bentrokan tersebut di visum di Rumah Sakit Umum Daerah (RSUD) Rantauprapat. (c07)

GUNUNGTUA (Waspada): Puluhan anggota TNI yang tergabung dalam personil Karya Bhakti Komando Rayon Militer (Koramil) 05 Padangbolak melaksanakan gotongroyong yang dipusatkan di pertapakan pembangunan Masjid Raya Gunungtua Tonga, Kecamatan Padangbolak,Rabu(5/2).Kegiataninimendapat dukungan dari warga masyarakat Desa GunungtuaTonga. Aparat pemerintah desa, aparat kecamatan, dengan melibatkan anggota TNI Kompi SenapanC123Gunungtua,unsur Muspika, petugas Dinas Kebersihan, Pertamanan dan Kebakaran Paluta, perwakilan instansi terkait, dan pengurus BPD Desa Gunungtua Tonga. Danramil 05 Padang Bolak Kapten INF Himsar Harahap,

terjun langsung dan berbaur dalam kegiatan gotong royong tersebut. Himsar mengajak masyarakat dan para peserta kegiatanuntukbergotongroyongmembersihkan pertapakan pembangunan masjid Raya Gunungtua Tongadansekitarnyahinggajalan di sekitar kompleks Kantor Kelurahan Gunungtua Tonga. Selain membersihkan pertapakan masjid raya, mereka juga membersihkan saluran air yang sudahmengalamipendangkalan, hingga air dapat mengalir dengan lancar. Hampir seluruh personil TNI dan warga melibatkan diri dalamkegiatantersebut,sehingga gotongroyong di wilayah tersebut dapat diselesaikan dengan cepat. Komandan Rayon Militer (Danramil) 05 Padang Bolak Kapten INF Himsar Harahap

ditemui usai kegiatan mengungkapkan,kegiatanbertujuanuntuk meningkatkan kemanunggalan TNI dengan rakyat dalam wadah kegiatan gotongroyong. Di samping juga secara tidak langsung membantu warga mempercepat proses pembangunan Masjid Raya Gunungtua Tonga. Tokoh masyarakat Tongku Banua Desa Harahap menyampaikan ucapan terima kasih kepadaDanramil05PadangBolak dan seluruh jajaran yang terlibat atas dilaksanakannya kegiatan KaryaBhaktidipertapakanMasjid Raya Gunungtua Tonga. Turut hadir dalam kegiatan tersebut, unsurpimpinanMuspika Padangbolak, perangkat Desa GunungtuaTonga, anggota Koramil05Padangbolak,sertapuluhan masyarakat setempat. (a35)

Dewi Kordinator PNPM Tunggurono BINJAI (Waspada): Rapiah Dewi terpilih menjadi Kordinator PNPM Mandiri Kel. Tunggurono, Kec. Binjai Timur periode 20142017.PemilihanKordinatorPNPMMandiridihadiri relawanlingkungan se Kel. Tunggurono, Lurah Surahman, SP yang sekaligus melantik Rapiah Dewi di aula Kelurahan, Selasa (4/2). Pemilihan Kordinator PNPM Mandiri dihadiri tokoh masyarakat, agama, Ketua Karang Teruna, Suherman, S. Sos, Ketua LPM Sahala Ginting. Lurah Tunggurono Surahman berharap kordinator terpilih mampu berkordinasi dengan masyarakat dan elemen di Kel. Tunggurno, sehingga aspirasi masyarakat untuk pembangunan benar-benar bermanfaat. Rapiah Dewi mengemukakan, selaku kordinator ia akan menjalin kerjasama dengan unit PNPM, LKM, UPUP, Dewan pengawas dan masyarakat, sehingga program yang dilaksanakan sesuai aspirasi masyarakat. (a04)

FPPKP MAN 2 P. Sidimpuan Kecewa Keputusan RDP P.SIDIMPUAN(Waspada) : Forum Peduli Pendidik dan Kebijakan Pendidikan (FPPKP) Madarasah Aliyah Negeri 2 Padangsidimpuan kecewa terhadap Rapat Dengar Pendapat dengan Komisi III DPRD P.Sidimpuan, Senin (27/1). Putusan rapat di Ketua Komisi I dan III, , menyimpulkan, keluhan para guru kepada Kepala MAN2PadangsidimpuandiserahkankeKemenag Kota Padangsidimpuan untuk ditindaklanjuti. Ketua FPPKP Mahran Alfian Siregar, S.Ag, M.Si didamping Sekretaris, Mahyuddin Harahap, S.Ag,M.Simengatakan,KepalaMAN2P.Sidimpuan Dra. Wasliah Lubis, S.Pd, MA melanggar PP No. 17 tahun 2010 di ubah PP No. 66 tahun 2010 pasal 205 ayat 1 tentang hasil pengawasan komite dilaporkan kepada rapat orangtua wali dihadiri kepala sekolah. “Bertentangan dengan PP No. 66 pasal 205 ayat 2 dimana hasil pengawasan komite sekolah dilaporkan kepada orangtua murid dan dihadiri kepala sekolah serta dewan guru,” kata Alfian di Kantor Harian Waspada Perwakilan Tapanuli, Kec. Sidimpuan Selatan, Selasa (4/2). Dikatakan, tidak transparan dalam Rencana Anggaran Pendapatan dan Belanja Madrasah (RAPBM) tahun 2013/2014, hal tersebut berbeda jauh dengan UU No.14 tahun 2008 tentang Keterbukaan Informasi Publik Hal serupa tentang tidak transparan dalam pengelolahan hasil sewa sarana MAN 2 P.Sidim-

puan, kata dia, hal tersebut jelas melanggar UU No.14tahun2008mengenaiketerbukaaninformasi publik. “Sarana yang disewakan seperti penyewaan aula, wisma, kantin dan tempat fotocopy, pengelolaan dananya tidak ada dibeberkan ke publik,sehinggadanatersebuttidaktahudigunakan kemana,’’ pungkas Alfian. Hal senada dikatakan Mahyuddin tentang pindahtugaskepadaduagurudanpemberhentian tugas tambahan kepada empat wali kelas, tanpa alas an jelas, sehingga dapat dikenakan sanksi sesuai pasal 212 ayat 6 dan PP No 17 tahun 2010 dan pasal 175 di antaranya teguran tertulis sampai pemberhentian secara tidak hormat. Lanjutnya, adanya intimidasi terhadap para guru yang berdelegasi ke Kantor Kementrian Agama Kota Padangsidimpuan, sehingga para gunu yang berdelegasi dihantui sanksi pemutasian oleh kepala sekolah. ”Sebagai pimpinan, seharusnyaKepsekmelindungiparaguruselakubawahannya, bukan malah diintimidasi. Hal ini dapat dikenakan sanksi sesuai UU No. 145 tahun 2005 tentang guru dan dosen Pasal 39 ayat 3 tentang perlindungan hukum,” ujarnya. Sementara itu, Kepala Sekolah MAN 2 P.Sidimpuan, Dra.Wasliah, S. Pd, MA, saat di konfirmasi via seluler, mengatakan, tidak bisa memberikan jawaban karena sedang mengajar. “Maaf, saya masih mengajar,” ucapnya. (a26)

Peringatan Maulid Nabi Di Pantai Bosur Kalangan

BINJAI (Waspada): Calon legislatif (Caleg) Partai Nasdem Dapil II Binjai Utara, Sri Masanah Ginting, S.Sos membantu masyarakat memperoleh kesehatan, terutama warga Binjai Utara yang sakit. Ketika menjenguk M. Rizki, 3, setelah menjalani 4 kali operasi di RS Adam Malik Medan, Rabu (5/2) di Jalan Randu, Kel. Jati Utomo, Kec.BinjaiUtara,SriMasanahyangsebelumnyaaktifsebagaiwartawan di Binjai, lulusan STIK Pembangunan Medan, selama ini senang membantu mengurus kesehatan warga sampai ke RS Adam Malik, Pirngadi dan RS Batesda Medan. “Pengorbanan membantu masyarakat yang sakit bukan hanya dilakukan karena faktor caleg,” akunya. Seperti Rizki, 3, putra pasangan keempat dari pasangan Edi Setiawan dan Puji Ayu Lestari, yang sempat putus asa dengan penderitaan anaknya yang harus menjalani operasi akibat tidak bisa buang air besar. Pada Desember 2013, ada beberapa warga dibantu Sri Masanah, selain Rizki yang kini sudah sehat dan normal buang air besar.(a04)

Waspada/Budi Surya Hasibuan

Waspada/Alpin Lubis

BADAN Jalan Negara Panyabungan Muarasipongi, tepatnya di daerah Muara Kumpulan Kec. Muarasipongi Kab.Madina hancur dan berlobang.

Waspada/Sori Parlah Harahap

PERSONIL Koramil 05 Padangbolak bersama anggota TNI Kompi Senapan C 123 Gunungtua, dan unsur Muspika, melaksanakan gotong royong di pertapakan pembangunan Masjid Raya Gunungtua Tonga, Kec, Padangbolak, Paluta.

TAPTENG (Waspada): Pemkab bersama Kementerian Agama Tapanuli Tengah (Tapteng) menggelar peringatan Maulid Nabi Muhammad SAW bersama masyarakat, Ormas Islam, OKP dan unsur MuspidaTapteng. Hal ini disampaikan Kakankemenag Tapteng Drs. H. Sarmadan Nur Siregar, MPd, Selasa (4/2). Sarmadan menyebutkan, kegiatan berlangsung di Pantai Bosur Kalangan, Kec. Pandan. Dikatakan, begitu pentingnya meneladani akhlaq Nabi Muhammad SAW yaitu: shiddiq, amanah, tabligh dan fathonah dalam setiap kehidupan kita serta menjadikan insan yang profesional dan integritas dan amanah, insya Allah akan melahirkan insan g profesional dan integritas untukmewujudkanTaptengmenjadinegeriwisata sejuta pesona. “Kepada seluruh aparatur Pemkab Tapteng dan Kemenag agar membina dan membangun kekeluargaan dan silaturahmi di masyarakat serta menumbuhkan kecintaan masyarakat sehingga kita dapat hidup rukun dalam kedamaian dan damai dalam kerukunan,” ucapnya. Sarmadanjugamenyebutkan BupatiTapanuli Tengah, Raja Bonaran Situmeang, SH, M.Hum dalamsambutanyamengatakan,acaraperingatan Maulid Nabi Besar Muhammad SAW ini hendaknya janganlah sebagai acara seremonial belaka, marila kita sebagai umat beragama meningkatkan iman kita kepada TuhanYang Maha Esa, sebagai aplikasi hidup rukun dan toleransi antar umat seagama, antar umat beragama dan antar umat beragama dengan pemerintah. Bupati bersyukur, karena kerukunan umat beragama di Tapanuli Tengah ini cukup terjalin

dengan baik, sehingga program Pemerintah Tapanuli Tengah untuk mewujudkan Tapanuli TengahmenjadiNegeriWisataSejutaPesonadapat diwujudkan dengan baik. Kegiatan diwarnai dengan festival marhaban untuk menggairahkan kembali semangat seni marhaban yang belakangan ini cenderung kurang diminati pemuda/I, bahkan dalam setiap peringatan Maulid jarang sekali seni Marhaban ini ditampilkan, sehingga marhaban menjadi kesenian langka bagi pemuda/i Islam. Jadi, untuk menggairahkan semangat marhaban,panitiamengadakanfestivalmarhaban .Juara I Kecamatan Badiri; Juara II Kecamatan Pandan; Juara III Kecamatan Barus Utara dan Juara IV Kecamatan Sorkam. (m37/rel)


KAKANKEMENAG Tapteng Drs.H.Sarmadan Nur, MPd saat kegiatan Maulid Nabi Muhammad SAW dilaksanakan Pemkab dan Kemenag Tapteng belum lama ini.

Gubsu Diminta Tertibkan BTS Di Tanjungbalai TANJUNGBALAI (Waspada): Gubernur Sumut (Gubsu) Gatot Pujo Nugroho diminta menertibkan menara Base Tranceiver Station (BTS) atau menara telekomunikasi yang melanggar Perda Provinsi Sumut Nomor 15 Tahun 2009 tentang Pembangunan dan Penataan Menara Telekomunikasi Bersama. Permintaan itu berdasarkan Bab IV Pasal 11 Ayat (1) ditegaskan bahwa untuk mendirikan menara di daerah wajib mendapat Surat Izin Mendirikan Bangunan dari Pemerintah Kab/ Kota setempat setelah adanya rekomendasi dari Gubernur. Sementara, keberadaan BTS di Tanjungbalai, seperti di Jl. Kartini dan HOS Cokroaminoto, belum mendapat rekomendasi dari Gubsu, sedangkan izin gangguan (HO) telah diterbitkan, dan bangunannya pun diperkirakan telah mencapai 50 persen. “ Kita minta Gubsu menertibkan BTS atau menara telekomunikasi yang melanggar Perda Provsu,” tukas anggota DPRD KotaTanjungbalai, Hakim Tjoa Kian Lie, Rabu (5/2), terkait penolakan warga atas keberadaan BTS di Lk II, Kel. Pantai Burung, Kec. Tanjungbalai Selatan. Belum adanya rekomendasi dari Gubsu untuk pembangunan BTS di lokasi itu, dibenarkan oleh Kakan Pelayanan Perizinan Terpadu Tanjungbalai, Rasyidin.“Rekomendasi dari Gubsu memang belum ada, dan IMB juga belum diterbitkan, hanya HO saja yang sudah dike-

luarkan,” ujar Rasyidin. Ditanya tentang Perda No. 15 Tahun 2009 Provsu tentang pembangunan dan penataan menara telekomunikasi bersama, pemahaman Rasyidin, rekomendasi Gubsu diminta hanya untuk pembangunan BTS di kawasan bandara atau pelabuhan. “Itu pemahaman saya, apalagi di daerah lain seperti di Asahan, tidak ada meminta rekomendasi Gubernur. Begitupun nanti saya teliti dan analisa kembali,” ujar Rasyidin. Lebih lanjut dikatakan Rasyidin, hasil pertemuan bersama antara DPRD, warga dan instansi terkait, pihak legislatif menyarankan agar bangunan BTS dibongkar. Hanya saja, menurut Rasyidin,pihaknyamasihmempertimbangkannya dengan alasan pihak pengusaha masih bermusyawarah dengan warga sekitar. Sementara, Kadis Tata Kota dan Pertamanan Ahmad Solihin mengakui adanya masyarakat yang keberatan atas keberadaan BTS itu. Hanya saja, kata Solihin, selagi prosedur secara teknis dipenuhi, sah-sah saja dikeluarkan izin pembangunan BTS. Akan tetapi, lanjut Solihin, karena ada masalah, makanya IMB belum diterbitkan. Sebelumnya, puluhan warga di Jl. Kartini dan HOC Cokroaminoto, Lk II, Kel. Pantai Burung, Kec. Tanjungbalai Selatan, mendatangi kantor DPRD terkait penolakan pembangunan tower di daerah mereka, Senin (3/2). (a14)

Sumatera Utara

B4 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H. Akmal AZ. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Semua wartawan WASPADA dilengkapi kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Kemala Bhayangkari Pusat Kunker Ke L.Batu RANTAUPRAPAT (Waspada): Rombongan pengurus pusat dan pengurus daerahYayasan Kemala Bhayangkari melakukan kunjungan kerja (kunker) keYayasan Kemala Bhayangkari, Labuhanbatu, Selasa (4/2). Ketua Pengurus Pusat Yayasan Kemala Bhayangkari Ny Tine Anton Bachrul Alam dan Ketua Pengurus Daerah Sumatera Utara, Ny Susi Syarief Gunawan tampak memimpin rombongan tersebut. Ny Tine Anton Bachrul Alam, dalam sambutannya mengatakan, pihaknya bersama rombongan datang ke L. Batu dalam rangka melakukan kunker ke Yayasan Kemala Bhayangkari L. Batu. “Kunjungan kerja ini merupakan agenda rutin kami setiap tahun, di mana tahun ini kami melakukan kunjungan kerja diYayasan Kemala Bhayangkari Kota Medan dan L. Batu,” kata Ny Tine. Dia menjelaskan, tujuan kunjungan kerja itu adalah untuk mensinergikanYayasanKemalaBhayangkaribaikdarisegiadministrasi, sarana maupun prasarana dan untuk menciptakanYayasan Kemala Bhayangkari yang lebih baik lagi. “Kondisi objektif yayasan kita pantau dan hasil pantauan ini akan disampaikan kepada pembina Yayasan Kemala Bhayangkari Pusat yakni Bapak Kapolri, agar dibahas di dalam rapat pengurus pusat Yayasan Kemala Bhayangkari,” katanya. Pada kesempatan itu,Yayasan Kemala Bhayangkari Pusat turut menyerahkan bantuan kepadaYayasan Kemala Bhayangkari L.Batu berupa satu unit tv, satu keyboard dan infokus. KetuaYayasan Kemala Bhayangkari Ny Irene Fauzi Dalimunthe mengatakan, pihaknya menyambut positif kedatangan ketua pusat Yayasan Kemala Bhayangkari. “Kita telah sampaikan kepada ketua kondisi objektif yayasan, dan hasil kunjungannya kita nilai sangat positif. Semoga Yayasan Kemala Bhayangkari L.Batu dapat lebih baik lagi,” katanya. (a18)

WASPADA Kamis 6 Februari 2014

Asahan Prioritas Perbaikan Sarana Jalan APBD Rp 1,14 T KISARAN (Waspada): Anggaran Pendapatan Belanja Daerah (APBD ) Kabupaten Asahan 2014 mencapai Rp 1,144 Triliun, dan untuk skala prioritas dituangkan untuk saran perbaikan jalan. Hal itu diungkapkan Bupati Asahan Drs.H. Taufan Gama Simatupang,didampingiWakilnya H. Surya. BSC, saat berbincang dengan Waspada, Rabu (5/2) di sela-sela Ekspose Informasi Laporan Penyelenggaraan Pemerintah Daerah Kabupaten Asahan 2013. Dia mengatakan, bahwa untuk 2014, Pemkab banyak sarana dan prasarana yang harus dilengkapi, namun yang menjadi sekala prioritas adalah infrastruktur jalan. Karena dengan jalan,rodaperekonomianmasyarakatakanterusbergerak,dankehidupan mereka akan lebih baik. “Untuk tahun ini kita utamakanperbaikanjalan,karenamasih ada jala yang masih perlu diperbaiki,” jelas Taufan. Taufan menjelaskan dalam eksposenya, bahwa selama 20112013, penanganan jalan rusak mencapai 228,90 Km, dan yang rusak berat mencapai 88,70 Km. Maka, jika bandingkan kondisi

jalan 2013 dengan 2012, panjang jalan dalam kondisi baik meningkat 23,20 %. Sedangkan panjang jalan dalam kondisi sedang meningkat13,01%,panjang jalan dalam kondisi rusak menurun 15,85 %, dan panjang jalan dalam kondisi rusak berat menurun 55,55 %. “Kegiatan itu akan terus kita tingkatkan, sehingga jalan-jalan di Kab. Asahan akan terus membaik, dan transportasi dan berputaran ekonomi masyarakat bisa lebih baik,” jelas Taufan. Sementara untuk tingkat pertanian, lanjut Taufan, pemerintah akan mengusahakan pembangunan irigasi di wilayah pertanian yang ada di Asahan sehingga hasil pertanian dan hasil petaniakanterusmeningkat. “Kita akan terus berusaha mengusahakan pembangunan, baik itu infrastruktur,sehinggakehidupan masyarakat bisa merangkak lebih baik,” jelas Taufan. Sedangkan untuk kesehatan,

pihaknya telah membangun ruangan inap kelas III dan VIP, dan tidak hanya itu melengkapi sarana dan prasarana medis. UntuksaatiniRSUDKisarantelah memiliki alat pencuci darah, dan CT Scan 16 Slice (untuk mengetahui detail anatomi dan kelainan organ), dan alat lainnya. Sehingga pasien tidak perlu dirujuk ke RS di Medan, untuk mendapatkan perawatan. “Walaupun secara berlahan, sarana dan prasarana medis akan kita lengkapi, sehingga masyarakat tidak perlu ke RS Medan, karena RSUD Kisaran telah memilikinya,” jelas Taufan. Sekolah Unggulan Taufan juga mengatakan, bahwa dirinya berkeinginan dan itu harus terwujud bawah setiap kecamatan yang ada di Asahan mempunyai SD, SMP, dan SMA unggulan. Sehingga anak-anak yang ada di wilayah pelosok tidak perlu ke kota untuk sekolah karena ingin menikmati fasilitas pendidikan yang cukup. “Bersama Dinas Pendidikan, cita-cita ini akan kita wujudkan, sehingga Asahanyangreligius,cerdas,sehat dan mandiri bisa terwujud,” jelas Taufan. (a15)

Wali Kota Ajukan RAPBD Tanjungbalai Rp 553 M TANJUNGBALAI (Waspada): Wali Kota Dr.H.Thamrin Munthe mengajukan Rancangan Anggaran Pendapatan Belanja Daerah (RAPBD) Kota Tanjungbalai TA 2014 senilai Rp 553.794.189.871. Rancangan yang diajukan dalam paripurna DPRD Kota Tanjungbalai Selasa (4/2) itu, mengalami penurunan Rp 7.627.395.797 atau 1,36% dibanding APBD Tahun 2013 setelah perubahan yakni Rp 561. 421.585.668. Paripurna beragendakan penyampaian Rancangan Peraturan Daerah terkait R-APBDTahun 2014 itu, dihadiri Ketua DPRD Kota Tanjung Balai, Romay Noor dan 17 Anggota DPRD lainnya. Wali Kota mengatakan, R.APBDyangdiajukanitu,berasal dari Pendapatan Asli Daerah (PAD) Rp 32.836.351.345, dana Perimbangan Rp434.170.020.018 dan lain lain pendapatan yang sah Rp86.787.818.508. Kemudian, pertambahan pendapatan antara lain yaitu bagian pendapatan asli daerah terdiri dari pos pajak daerah Rp 8.583.418.400 yang bertambah sebesar Rp 1,5 miliar atau 17,48 % dibanding TA 2013 setelah perubahansebesarRp7.083.418.400.

“Pertambahan ini karena pengalihan pajak bumi dan bangunan perdesaan dan perkotaan, sesuai denganUUNo28Thn2009tentang pajak daerah,” kata Wali Kota. Untuk Pos Retrebusi daerah sebesar Rp 12.915.581.600, Pos Pengelolaan Kekayaan daerah yang dipisahkan sebesar Rp5,4 miliar, sedangkan pendapatan lain lain yang sah sebesar Rp5.937.351.345 mengalami penurunansebesarRp1.198.648.655 atau 20,19 % dari APBD TA 2013 setelahperubahan Rp7.136.000.000. Sementara, Dana Perimbangandenganrinciandanahasil pajak dan bukan hasil pajak sebesar Rp 12.883.645.018, mengalami penurunan Rp3.540.202.686 atau 27,48 % dibanding setelah perubahan APBD TA 2013 Rp16.423.847.704. “Ini dipengaruhi pengalihan PBB pedesaan dan perkotaan dari Pemerintah Pusat,” ujarWali Kota. Selanjutnya, DAU sebesar Rp387.259.055.000 bertambah Rp18.012.479.000 atau 4,65 % dibanding TA 2013 sebesar Rp369.246.576.000. Dana ini, menurutWaliKota,diprioritaskan untuk pembayaran gaji 1 Tahun Anggaran, serta kenaikan gaji

pokok 2014 yang diperkirakan sebesar 7 % dan pembayaran gaji ke 13. Sisanya, lanjut Wali Kota, untukbelanjapembangunanatau rutin, dan DAK nilainya Rp34.027.320.000,- bertambah sebesar Rp 5.636.280.000 atau 16,56 % dibanding TA 2013 sebesar Rp Rp 28.391.040.000. Kemudian, lain lain pendapatan yang sah dengan rincian Pos bagi hasil pajak dari Provinsi dan Pemerintah Daerah sebesar Rp mengalami peningkatan Rp14.639756.496 atau 72,88 % dibanding TA 2013 sebesar Rp5.448.391.000. Untuk BDB dari ProvsuTA 2014 sebesar Rp25.652.156.012, mengalami penurunanRp51.125.307.613atau 199,30%setelahperubahanAPBD TA 2013 Rp76.777.463.625. “Pagu Rp25.652.156.012yang dituangkan dalam buku R-APBD TA 2014 adalah kurang bayar Pemprovsu BDB Tahun 2013 kepada Pemko Tanjungbalai,” kata Wali Kota sambil menambahkan, pendapatan lain yang sah sebesar Rp 41.047.515.000,mengalami peningkatan sebesar Rp8.448.247.661 atau 20,58 % dibanding TA 2013 sebesar Rp32.599.267.339. (a14)

Bawang Merah Diduga Ilegal Beredar di Pasar Gelugur RANTAUPRAPAT (Waspada): Sejumlah pedagang bawang merah mengeluh karena bawang merah diduga ilegal (selundupan), beredar di Pasar Gelugur Rantauprapat. Pasalnya, bawang merah itu dijual dengan harga jauh lebih murah di bawah harga pasaran, hingga menyebabkan pedagang yang membeli bawang lokal merugi. Salah seorang pedagang bawang merah, Alung, 38, mengaku telah mengalami kerugian sejak sepekan terakhir. Sebab, omset penjualannya drastis menurun diakibatkan munculnya bawang merah diduga ilegal yang dijual dengan harga Rp 12 ribu per kg. “Harga bawang merah yang kita jual Rp 18 ribu per kg. Dengan harga segitu otomatis bawangkitanggaklaku,rugilahkita,” kata Alung, Selasa (4/2) di Pasar

Gelugur, Rantauprapat. Alung menjelaskan, bawang merah yang dijual dengan harga Rp 12 ribu per kg itu sudah beredar di Pasar Gelugur sejak sepekan terakhir. Ia pun meyakini jika bawang dengan harga murah itumerupakanbawangseludupan dariluarnegeriyangtelahdipasok ke sejumlah pedagang. “Saya yakin itu bawang selundupan. Karena saya juga sempat ditawari untuk main bawang itu, tapi saya tolak karena saya nggak mau ambil resiko,” ucapnya. Selain harga yang lebih murah, tambah Alung, kualitas dari bawang diduga selundupan itu tampak lebih baik. “Jadi mana mampu kita bersaing, harga lebih murah dan kualitas tampak lebih baik.Wajar lah bawang kita nggak laku,” tandasnya.

Untuk itu, Alung berharap kepada pihak berwenang dapat bertindak dengan melakukan razia pasar. “Gawat lah lah kami kalauterus-terusanbegini,”harap Alung. Sementara Kapolres Labuhanbatu AKBP Achmad Fauzi Dalimunthe SIK melalui Kasubag Humas MT Aritonang mengatakan, pihaknya meminta kepada warga ataupun pedagang untuk dapat memberikan informasi ataupun laporan terkait beredarnya bawang merah diduga ilegal itu kepada pihak kepolisian. “Karena kita baru dapat info ini, kita harap warga beri info ke kita agar dapat kita tindak lanjuti,” ucapnya seraya menambahkan, pihaknya segera menindaklanjuti adanya informasi terkait dugaan beredarnya bawang merah ilegal itu. (a18)

Warga Minta Tambah Pangkalan Elpiji BATUBARA (Waspada):Warga pedesaan di Kab. Batubara, minta Pemkab Batubara menetapkanhargaecerantertinggi(HET) gas elpiji 3 kg, serta menambah pangkalan elpiji untuk menghindarkan praktek manipulasi harga. “Kasihankita,wargapemakai elpiji 3 kg menjadi korban permainan agen, harganya sampai

di desa Rp18 ribu/tabung,” tukas Samsul P, Ketua LP2 Migas Batubara, Rabu (5/2). Karena itu, menurut Samsul, sebaiknya Pemkab Batubara menetapkan HET gas elpiji 3 kg, dan menambah pangkalan di desa-desa untuk memudahkan masyarakat. Selama ini, para agen hanya

melayani beberapa pangkalan, kemudian pangkalan langsung mengantar/mengisi elpiji ke kioskios pedesaan. Akibatnya, harga dipangkalandandikiosjadimahal “Kalau HET Rp12.750/tabung, ternyata sampai di pangkalan jadi Rp13 .500,dan berlanjut eceran di kios-kios menjadi Rp17 -Rp18 ribu,” ujarnya. (a12)

Waspada/Iwan Has

KAPAL kayu ‘’Wahyu 99 ‘’ memuat getah jadi yang tertutup terpal di perairan Batubara, sedang sandar di tangkahan salah satu gudang di Sungai Batubara, Tanjungtiram.

Praktek Pengambilan BMKT ‘Melenggang’ Puluhan Ton Getah Sudah Diangkat TG TIRAM (Waspada): Sampai sekarang, pihak pekerja terus melangsir getah jadi bagian Muatan Kapal Tenggelam (BMKT) dari kapal kayu ‘’Wahyu 99'’ diperkirakan berbobot 20 GT, yang bersandar di salah satu tangkahan gudang Sungai Batubara, Jalan Nelayan, Tanjungtiram, Kab. Batubara. ‘’Sampai sekarang aksi bongkar muat getah jadi bagian dari BMKT di perairan Batubara ‘melenggang’ tanpa pengawasan dari berkompeten,’’ tukas sejumlah tokoh pemuda Tanjungtiram,yangmengamatibongkarmuatbahanBMKT yang dilakukan para pekerja, Rabu (5/2). Kamaruddin, didampingi Ucok Kodam, dan Hamzah mengaku, tidak mengetahui perusahaan yang dihunjuk maupun instansi selaku badan

koordinasidalamupayamengambilhartakekayaan negarayangmempunyainilaisejarahtersebut. ‘’Ini membingungkankitakarenatidakmengetahuisecara jelas perusahaan yang melakukan,’’ ujarnya. Diperkirakan mencapai puluhan ton getah jadi dan barang berharga mempunyai nilai sejarah bagian dari muatan BMKT itu sudah berhasil diangkat dan dibawa kegudang, untuk selanjutnya dilelang. Walau pengerjaan di lapangan tanpa melibatkan tim pengawas yang berkompeten. ‘’Jika benar kekayaan negara itu dilelang, harus dibawa ke balai lelang negara dengan melibatkan tim pengawas dan tidak sepihak dilakukan,’’ kata Kamaruddin sembari meminta pengambilan BMKT di perairan Batubara tersebut ditinjau kembali. (a13)

Pemkab L. Batu Programkan ‘Tahun Bekerja’ Di 2014 RANTAUPRAPAT (Waspada): Pemkab Labuhanbatu telah memprogramkanTahun 2014 merupakan “Tahun Bekerja” sebagai salah satu upaya pencapaian Labuhanbatu Mandiri 2015 Menuju Labuhanbatu Sejahtera 2020. Tentunya kita harus cerdas dan bekerja keras untuk mengapresiasi program ini sehingga tingkat keberhasilannya dapat terukur dengan baik. Demikian dijelaskan Bupati Labuhanbatu dr. H. Tigor Panusunan Siregar, SpPD dalam pidato tertulisnya yang dibacakan Asisten Pemerintahan Setdakab Labuhanbatu Drs. H. Sarbaini pada Apel Gabungan Kelompok I dan II di Lingkungan Pemkab Labuhanbatu, Senin (3/2) di Lapangan Gedung Diklat BKD. Katanya, apabila kita me-review ke Tahun 2013 yang diprogramkan sebagai“Tahun Prestasi”, secara pribadi dinilai program tersebut cukup

berhasil, artinya pada tahun tersebut ada sejumlah prestasi yang diraih oleh Pemkab Labuhanbatu. Oleh karena itu, diharapkan pada Tahun 2014 ini keberhasilan-keberhasilan yang sudah dicapai dapat dipertahankan atau ditingkatkan lagi. Bupatijugamengingatkankepadapesertaapel gabungan, bahwaTahun 2014 ini juga merupakan “Tahun Politik”, karena ada sejumlah agenda politik yangakandigelarpadatahunini,yaituPemiluLegislatif. Bupati kembali mengingatkan, masih dalam rangkaian Tahun 2014 sebagai “Tahun Bekerja”, khusus di bidang pelayanan publik yang langsung bersentuhan dengan masyarakat, para PNS agar benar-benar bekerja dalam melayani masyarakat berdasarkan Standar Operasional Prosedur (SOP). “Karena di bidang layanan public sangat sensitif dipengaruhiataudimanfaatkanolehkepentingankepentingan politik praktis,” jelasnya. (c07)

MUI Imbau Masyarakat Tidak Terprovokasi Aliran Menyimpang LIMAPULUH (Waspada): Kerawanan sosial pasca mencuatnya masalah ajaran yang dibawa oleh guru - guru dari Bengkulu di kawasan Desa Ujung Kubu - Lima Laras, Kec. Tanjungtiram dan sekitarnya perlu diwaspadai semua kalangan, janganadayangterprovokasidanbertindakanarki. Demikian disampaikan Ketua DP Majelis Ulama Indonesia (MUI) Kab. Batubara H. Ghazali Yusuf,Lc kepada Waspada, Selasa (4/2) menyikapi perkembangan terkini di daerah terkait masalah aliran dengan buku “Sirah Buya”. Menurutnya, MUI sudah tiga kali melakukan muzakarah dengan pimpinan ajaran itu.Terakhir kali, malah guru besar dari guru - guru yang datang dari Bengkulu itu bermuzakarah dengan MUI Batubara, tepatnya Sabtu (1/2) malam lalu. “Ada beberapa hal dari aliran itu yang bertentangan dengan Alquran, untuk itu MUI melalui komisi fatwa sedang merumuskan fatwa tentang aliran

ini. Sesuai dengan muzakarah MUI dengan pimpinan ajaran mereka itu,” kata Ghazali. Ia juga menyayangkan pihak-pihak yang secara langsung atau tidak telah memprovokasi masyarakat dengan hal - hal yang anarkis. Dalam kondisi ini diharapkannya masyarakat awam tidak boleh terlalu larut dalam masalah, sehingga menimbulkan fanatisme buta. “Hendaknya pihak - pihak yang mengerti agama membawakan air ke tengah - tengah masyarakat, sehingga situasi akan semakin sejuk dan keputusan atau fatwa yang akan dikeluarkan MUI mencerahkan semua pihak. Biarlah masalah ini diselesaikan ulama saja dan masyarakat mengacu pada yang telah ditetapkan Allah dan Rasulnya hanya melalui Alquran dan Hadis saja. MUI juga dalam mengeluarkan fatwa semata - mata mengacu pada dua sumber itu,” kata Ghazali. (c05)

Lagi, Polsekta Kotapinang Ringkus Pengedar Sabu KOTAPINANG (Waspada): Unit Reserse KriminalPolsektaKotapinang,Kab.Labusel,Selasa (4/2) pagi, kembali meringkus seorang pengedar narkoba jenis sabu-sabu yakni, SS alias M, 38 warga Dusun Padangrie, Desa Simatahari, Kec. Kotapinang. Kanit Reskrim Polsekta Kotapinang, AKP P Tambunan mengatakan, penangkapan SS yang sejak lama menjadi target operasi pihaknya itu berkat informasi dari masyarakat. “Berkat partisipasi masyarakat kita berhasil meringkus tersangka,” katanya. Dijelaskan, pagi itu pihaknya menerima laporan warga bahwa tersangka terlihat sedang menggunakan sabu-sabu di sebuah gubuk yang terletak di Dusun Mampang, Desa Mampang, Kec. Kotapinang. “Saat kita grebek tersangka

tertangkap tangan sedang menggunkan sabusabu,” katanya. Dalampenangkapanitu,petugasmenemukan sejumlahalatbuktiberupaalathisap(bong),mancis, kantong plastik kemasan yang masih terdapat sisa sabu-sabu yang digunakan tersangka. Petugas kemudian menggeledah seluruh tubuh tersangka dan menemukan satu paket sabu-sabu seberat 1,39 gram yang diselipkan tersangka di lubang dubur (anus)-nya. Di kantor polisi tersangka mengaku memperoleh pasokan sabu-sabu dari seorang pria berinisial A di Kota Rantauprapat.“Tersangka ini sudah lama menjadiTO. Kita masih melakukan pengembangan. Sejauh ini tersangka selalu memberikan keterangan berbelit-belit,” kata Tambunan. (c18)

Bupati Labusel Lantik Sekda

Waspada/Helmy Has

SALAH satu pangkalan elpiji 3 kg yang hanya melayani kios-kios.

KOTAPINANG (Waspada): Bupati Kab. Labusel, Wildan Aswan Tanjung, Rabu (5/2) melantik Zulkifli sebagai Sekretaris Daerah (Sekda) definitif. Zulkifli dilantik setelah beberapa bulan menjabat sebagai Pelaksana Tugas (Plt) menggantikan Rusman Syahnan yang memasuki masa pensiun. Pada kesempatan itu Wildan mengatakan, penunjukan Zulkifli sebagai Sekda berdasarkan Keputusan Gubernur Sumut No. 821.23/430/ 2014.Wildan berpesan, agar Sekda mampu mengemban amanah karena akan dipertanggungjawabkan kepada masyarakat, bangsa, negara, dan agama. Pada kesempatan itu, Bupati juga menekankan agar Sekda yang baru, dapat memberikan motivasi kepada seluruh PNS di jajaran Pemkab Labusel agar senantiasa meningkatkan semangat

kerja dan pengabdaian, baik selaku aparatur negara maupun abdi masyarakat. Menurutnya, seorang Sekda memiliki tugas dan tanggung jawab semakin besar, karenanya diharapkan Sekda harus bekerja keras, cerdas dan tuntas. “Sangatlah penting pemahaman yang baik atas suatu peraturan perundang-undangan. Dengan meningkatnya kemampuan serta profesionalisme aparatur, maka tingkat responsibilitas terhadap harapan yang berkembang di tengah masyarakat juga akan meningkat, sehingga hasil hasil pembangunan akan memberi dampak positif terhadap peningkatan kualitas hidup masyarakat,” katanya. Hadir di acara pelantikan, Wakil Bupati Maslin Pulungan, Anggota DPRD, Kacabjari Kotapinang Iwan Ginting SH, Kapolsekta Kotapinang Kompol J Panjaitan, dan undangan lainnya. (c18)


WASPADA Kamis 6 Februari 2014

Ketua Pemuda Muslimin Indonesia Sumut Zaharuddin, SE:

SUARA AKADEMIK Cara UMSU Memelihara Komunitas Tidak ada yang dapat membantah bahwa UMSU (Universitas Muhammadiyah Sumatera Utara) saat ini merupakan satusatunya perguruan tinggi swasta (PTS) di Sumatera Utara yang tumbuh dan berkembang. Jumlah mahasiswanya rata-rata jauh lebih banyak dibanding PTS lain, begitu juga jumlah kampus termasuk tenaga pengajar. Berbagai program studi telah dibuka plus program dokter bahkan kini UMSU sedang membangun kampus baru pasca sarjana di Jalan Denai Medan. Memang, secara empiris suburnya pertumbuhan UMSU terjadi pada pasca pecahnya konflik UISU (Universitas Islam Sumatera Utara) yang hingga kini tidak selesai. Para calon mahasiswa sepertinya tidak punya pilihan lain jika ingin memilih kampus perspektif agama yang aman dan berkualitas di Sumatera Utara adalah UMSU. Namun, pertumbuhan itu tidak semata faktor kesempatan atau seperti kata pepatah menimbah di air keruh, tetapi karena pengelolaannya yang profesional. Satu hal yang menjadikan kita salut dan bangga adalah bagaimana cara UMSU memelihara komunitas. Seperti dalam rekrutmen tenaga dosen, UMSU tidak sembarangan, tetapi melakukan seleksi yang cukup ketat dan mengutamakan komunitas. Kalaupun ada di luar komunitas, itu adalah pengecualian. Dalam hal ini, UMSU sepertinya merujuk ayat Alquran (at Tahrim-6) “Hai orang beriman, peliharalah diri mu dan keluarga mu dari api neraka”. Ayat ini adalah bentuk fiil amar, artinya perintah dan wajib dilaksanakan, karenanya bagi UMSU memilihara diri dan keluarga hukumnya wajib. Merujuk ayat Alquran itu, sepanjang masih ada sumber daya dalam komunitas, harus didahulukan dan kebijakkan ini jangan disangka merupakan bentuk nepotisme, tapi adalah pengamalan ajaran agama.Wajar saja kalau kesempatan dosen di luar komunitas yang ingin berkiprah di UMSU harus berlapang dada, karena seperti masuk ke ‘lobang jarum’. Kecuali bagi mereka yang sudah beralih kartu anggota. Memang, ketika menerima mahasiswa baru, UMSU tidak pernah menyeleksi apakah komunitas atau non komunitas dan hal itu tidak pernah pula dipersoalkan oleh wali mahasiswa. Jika dipersentasekan, pasti lebih banyak mahasiswa non komunitas. Para wali kini sudah berfikir rasional dan terbuka, tidak lagi bicara bahkan pernah mepersoalkan tentang kelompok atau komunitas, karena pola berfikir seperti itu adalah warisan penjajah. Penting, bagaimana anak mereka bisa menjadi sarjana yang baik dengan kelulusan yang baik pula. Sebagai mahasiswa mayoritas, harus pula diakui dan tidak dapat dibantah bawah kontribusi mahasiswa non komunitaslah yang paling banyak memajukan dan menjadikan UMSU tumbuh dan berkembang seperti saat ini. Bagi kita UMSU bukan lagi hanya milik komunitas UMSU tapi adalah asset masyarakat Sumatera Utara dan oleh karena itu kita tidak melihat komunitas dan non komunitas, tapi ikut merasa memiliki dan mempunyai tanggung jawab moral untuk bagaimana melindungi dan membesarkan UMSU. Kita juga berharap UMSU akan menjadi model pemersatu di Sumatera Utara. Besarnya UMSU akan semakin besar pula nama pengikut Muhammad Saw di Sumatera Utara dan mungkin dengan pertimbangan itu pula UMSU membuka diri untuk menerima dosen luar komunitas. Semoga.

Dr. Arifinsyah: Membangun Kebersamaan Sosok pria kelahiran Desa Medang, Kabupaten Batubara, 9 September 1967 ini terlihat porposional dan profesional ketika menyampaikan paparan tentang kebangsaan dalam berbagai pertemuan. Apalagi jika judul itu dikaitan dengan agama, ayat-ayat Alquran dan Hadis tentang kebangsaan dan perbedaan mewarnai ucapannya. Jika berdiskusi tentang kebangsaan, kerukunan umat beragama dan pluralis, Dr. Arifinsyah selalu saja serius dan bisa mengahabiskan waktu berjam-jam. Karena itu, laki-laki berkulit sawo matang ini sering diundang sebagai pemakala. Aayah empat anak ini telah menyelesaikan pendidikan dasar dan menengah di tanah kelahirannya serta melanjutkan pendidikan S.1 di Fkultas Ushuluddin IAIN (Institut Agama Islam Negeri) Sumatera Utara dan S.2 tentang Pemikiran Islam di PPs kampus yang sama, selalu ingin membangun kebersamaan baik internal maupun eksternal umat beragama. Sebagai cucu Syekh Haji Majin Tasyak, ulama tersohor di Batubara, Arifinsyah belum puas dan melanjutkan pendidikan pada jenjang S.3 pada ksentrasi Agama dan Filsafat Islam. Berbekal keilmuan, ayah empat anak ini, selain sebagai dosen tetap di Fakultas Ushuluddin IAIN Sumatera Utara, juga aktif diberbagai organisasi seperti di FKUB (Forum Kerukunan Umat Beragama) Sumatera Utara, Sekretaris Umum FPK (Forum Pembauran Kebangsaan) Sumatera Utara, MUI Sumatera Utara, Sekretaris ICBA (Ikatan Cendikiawan Batubara) dan KetuaYayasan Perguruan Islamiyah (YPIS) Kabupaten Batubara. Lebih dari itu, pria yang hampir tidak pernah melepas peci ini juga pernah mendapat kepercayaan menjadi Ketua Laboratorium Managemen Keagamaan, Sekretaris Jurusan Perbandingan Agama, Pembantu Dekan II. Laki-laki yang mudah bergaul dan terbuka kepada siapa saja ini juga sudah banyak menulis buku-buku ilmiah antara lain; Perbandingan Agama dalam Alquran dan Bibel, Pemikiran M. Arsyad Thalib Lubis Tentang Pluralitas Agama,Wacana Pluralisme Agama Kontemporer. Editor, Ensiklopedi Kerukunan Antar Umat Beragama, Pedoman Puasa Meraih Takwa, Tema Pokok Ajaran Agama, Perbandingan Alquran dan Bibel. Kini, sosok suami dari Dra. Nur’aidah ini tak pernah lupa mengingat tanah leluhur, sedang dalam proses untuk mendapatkan guru besar. Jika berhasil, Arifinsyah putra pertama Batubara guru besar bidang agama Islam, amin. (m26)

Parpol Belum Maksimal Beri Pendidikan Politik Masyarakat MEDAN (Waspada): Ketua Pemuda Muslimin Indonesia Sumut Zaharuddin, SE menegaskan, partai politik (parpol) belum maksimal memberikan pendidikan politik kepada masyarakat untuk menjadi pemilih cerdas dalam menentukan siap pada pemilihan anggota legislatif dan Presiden. “Parpol punya tanggung jawab mencerdaskan sikap politik masyarakat untuk membangun demokrasi yang baik dan benar,” tegas tegas Zaharuddin (foto) didampingi Wakil

Ketua PMI Sumut Ali Natar Siregar dan sekretaris Drs. Jhoni Koto di Medan, Rabu (29/1) menyusul keinginan Gubsu H. Gatot Pujo Nugroho meningkatan partisipasi pemilih dari 41 persen menjadi 75 persen. Menurut Zaharuddin, kalau pun ada itu hanya sebatas kepentingan bagaimana memenangkan partai bersangkutan, sehingga yang terbangun adalah politik belah bambu yakni sebelah diangkat dan sebelah dipijak. Padahal kecerdasan politik masyarakat juga berkaitan dengan meningkat atau menurunnya partisipasi pemilu. Kunci sukses meningkatkan partisipasi pemilih pada pimi-

lihan anggota legislatif 9 April 2014, lanjut Zaharuddin, signifikan tergantung sejauh mana sosok caleg (calon legislatif) mampu meyakini para pemilih. “Meningkatkan partisipasi pemilih

MEDAN (Waspada): Koordinator Kopertais Wilayah IX Sumatera Utara melalui sekretarisnya Dr. H. Ansari Yamama, MA di dampingi Kasubag bidang Akreditasi dan Evaluasi Kopertais wilayah IX sumut, menerima berkas penyempurnaan pendaftaran berdirinya Sekolah Tinggi Agama Islam (STAI) Batu Bara di ruangan kerjanya, Senin (27/1). Penyerahan penyempurnaan berkas dilakukan Ketua Yayasan Pendidikan Islam Batu Bara Sejahtera Dr. H. Sulaiman M. Amir, LC, MA, didampingi Ketua Pembina Yayasan Pendidikan Islam Batu Bara Sejahtera, Syufri Basrah, S. Ag, MAP didampingi pembina lainnya Syakdun S.Pd.I, MAP, ketua STAI Batu Bara Dr. H. Abdul Hadi, Lc, MA, Junaidi Arsyad, MA, Ahmad Jaiz, MA dan Rosyidin Hafiz, S.HI, tokoh masyarakat Batu

bara di Medan dan para aktifis. Menurut Ketua Pembina Yayasan Pendidikan Islam Batu Bara Sejahtera, Syufri Basrah, S. Ag, MAP bahwa pada Juli 2013 telah didaftarkan dan ini iadalah penyempurnaan. Kopertais wilayah IX Sumut melalui Kasubag Bidang Akreditasi dan Evaluasi telah memeriksa berkas- berkas kelengkapan dan meninjau ke lokasi perencanaan tempat perkuliahan tersebut. Dalam pertemuan tersebut, Sekretaris Kopertais menyambut baik berdirinya STAI Batu Bara mengingat Kabupaten Batu Bara belum memiliki perguruan tinggi ditambah studi kelayakannya sudah sangat layak. Setelah menerima berkas dan meninjau lokasi perkuliahan STAI Batu Bara pada juli 2013 yang lalu, Ansari menyatakan, bahwa berkas penyempurnaan permohonan sudah leng-

rakat terkesan hanya dijadikan seperti rakit yang tugasnya mengantar penumpang untuk menyeberang sungai setelah sampai rakit diterjang dan hanyut mengikuti arus air tanpa mendapat perhatian. Ironisnya, setiap keputusan politik di parlemen oleh para wakil rakyat sama sekali hapir tidak ada yang memihak kepada kepentingan masyarakat. “Kepentingan masyarakat pemilih diabaikan,” tegas Zaharuddin. Jadi, lanjut Zaharuddin, yang menciptakan masyarakat pemilih untuk tidak menggunakan hak suaranya akibat prilaku para anggota legislatif yang

tidak memenuhi janji-janjinya pada kampanye pimilihan umum. Menjawab pertanyaan lupanya para caleg kepada masyarakat pemilih setelah menjadi anggota dewan perwakilan rakyat, Zaharuddin menegaskan, karena masih lemahnya sistem rekrutmen oleh partai politik. Menyinggung keterlibatan 30 persen gender untuk caleg, menurut Jhoni Koto, keberadaan itu harus mampu mendongkrak tingkat partisipasi pemilih dan menekan sekecil mungkin golput. Di samping caleg gender harus mengedepankan visi misinya pada kepentingan gender.(m26)

kap sesuai ketentuan pendirian sebuah perguruan tinggi, dan dalam waktu dekat kopertais segera mempelajari tambahan perbaikan proposal tersebut untuk selanjutnya akan dikeluarkan rekomendasi pendirian ini untuk diteruskan ke Dirjen Pendis Kementerian Agama Republik Indonesia, ungkap Ansari. Syufri Basrah juga menyampaikan bahwa dukungan pendirian STAI Batu Bara ini dari berbagai instansi terkait, mengingat Kabupaten Batu Bara pada masa lalu dikenal dengan gudangnya para ulama. Dr. Abd. Hadi, LC, MA ketua STAI Batu Bara tersebut menyatakan dengan menyempurnakan proposal pendirian STAI di Kabupaten Batu Bara ini, membuktikan bahwa keseriusan putra daerah dalam membangun Kabupaten Batu Bara pada bidang pendidikan.(m26)

Mhd Asaad Rektor UISU Yang Sah MEDAN (Waspada): :Status Dr Ir Mhd Asaad, MSi sebagai Rektor Universitas Islam SumateraUtara(UISU)Medan dinyatakan sah sesuai Surat Keputusan Pengurus Yayasan No 03 Tahun 2011 tentang Pengangkatan Dr Ir Mhd Asaad, MSi sebagai Rektor UISU masa bakti 2011-2015. Rektor UISU melalui Kepala Humas UISU Drs H Almatsyah, Rabu (5/2) menjelaskan bahwa sesuai hasil rapat senat UISU tanggal 29 Nopember 2012, yang memutuskan “menolak surat keputusan pengurus yayasan UISU No 75 Tahun 2012 tanggal 21 Nopember 2012 tentang pemberhentian Dr Ir Mhd Asaad, MSi sebagai Rektor UISU masa bakti 2011-2015. Perintah Senat terhadap SK PimpinanYayasan UISU Nomor 75 tersebut karena inskonsitusional melanggar pasal 22 ayat 5 Statuta UISU tahun 2013 dimana pengangkatan dan pemberhentian Rektor merupakan hak dan wewenang dari Dewan Pimpinan Yayasan atau sekarang disebut Pembina.

Pembina Yayasan Nomor 79/Pem-Yas/A-1/IX/2013, Ketua Pembina Yayasan UISU T Hamdy Osman Delikhan Al Hajj telah menyurati Kopertis Wilayah I Sumut-NAD prihal status Rektor UISU. Dalam surat tertanggal 13 Septeber 2013 ditegaskan, sesuai dengan rapat PembinaYayasan UISU tanggal 27 Juli 2013 menyatakan, kebijakan pemberhentian Asaad sebagai Rektor UISU masa bakti 2011-2015 dinyatakan tidak berlaku dan tidak mengikat. Kedudukan Mhd Asaad, katanya, dipertegas lagi dengan SK Pengurus Yayasan UISU

nomor 05 Tahun 2014 tentang penegasan status Rektor UISU. SK tertanggal 15 Januari 2014 ditandatangani Ketua Yayasan UISU Prof. Dr. Zainuddin dan Sekretaris Muhammad Idris SH, MH itu memutuskan, meninjau kembali SK Pengurus Yayasan UISU No 75 Tahun 2012 tanggal 21 Nopember 2012 tentang pemberhentian Mhd. Dengan demikian disimpulkan bahwa kedudukan Dr Ir Mhd Asaad adalah sah untuk melakukan tindakan hukum mengatasnamakan Rektor UISU, tegas Almatsyah menjawab adanya upaya pihak tertentu memutarbalikkan fakta tentang keabsahan Mhd Asaad sebagai Rektor UISU Medan. Sedang konflik akademik UISU sudah hampir rampung ditandai terdaftarnya seluruh mahasiswa UISU Kampus Jalan SM Raja termasuk mahasiswa Fakultas Kedokteran UISU Jalan SM Raja Medan ke data EPSBED/ Pusat Data Perguruan Tinggi (PDPT) UISU Medan di Dirjen Pendidikan Tinggi.(m26)

Sri Elviani Siap Jadi Saksi Soal Penggelapan Dana UISU Rp 17,6 Juta MEDAN (Waspada): Sri Elviani, Staf Biro Rektor UISU (Universitas Islam Sumatera Utara) menyatakan siap memberi keterangan di Polresta Medan sekaitan adanya tudingan terhadap Rektor Dr Ir Mhd Asaad, MSi melakukan penggelapan keuangan kampus Rp 17 .630.622 yang telah dilaporkan Dra Fauziah Dangoran ke pihak kepolisian. Selama dua kali panggilan pihak Polresta Medan, Sri Elviani tidak dapat hadir sebagai saksi karena dalam keadaan cuti ber-

salin. Untuk selanjutnya pemeriksaan Sri Elviani sebagai saksi dapat dipanggil kembali setelah selesai cuti bersalin, kata Kepala Humas UISU Medan Drs H Almatsyah, MAP, Rabu (5/2) mengutip surat yang dikeluarkan Kantor Pengacara/Penasehat Hukum Edy Hanafi, SH & Assiciates. Kantor pengacara ini juga telah mengirim surat kepada Polresta Medan, Wakasat Reskrim Kepolisian Resort Kota Medan, dan AKP Azharuddin SH. cq AIPDA Adek Rusli Sinaga,

-By Ayu Nadira Wulandari Mahasiswa semester 7 Fakultas Ilmu Sosial dan Ilmu Politik Jurusan Ilmu Komunikasi UMSU

kaum intelektual yang beruntung karena dapat menikmati masa perkuliahaan yang tidak bisa dirasakan semua orang. Karena nya mahasiswa merupakan kaum intelektual yang berada di kaum minoritas. Karena mayoritas penduduk Indonesia adalah orang-orang yang belum mampu menikmati kesem-

sepenuhnya ada di tingan caleg, bukan pada KPU dan Panwaslu serta pemda/kota,” tegasnya. Penyebab pertama semakin menurunnya tingkat partisipasi pemilih pada pemilihan umum legislatif beberapa tahun terakhir, karena semakin terkikisnya kepercayaan masyarakat terhadap sosok caleg yang tampil. Kesan yang muncul di tengah masyarakat bahwa para caleg hanya piawai dalam beretorika, akan tetapi tidak pandai bertindak dan berbuat serta memihak pada kepentingan rakyat ketika sudah terpilih menjadi anggota parlemen. Dalam konteks ini, masya-

Kopertais IX Sumut Terima Berkas Pendirian STAI Batubara

SH Unit Tipiter Sat Reskrim Polresta Medan, tentang hal penundaan pemeriksaan. Surat yang dikeluarkan Kantor Pengacara/Penasehat Hukum Edy Hanafi SH & Associates ditandatangani Edy Hanafi,SH, Ainul Yaqin, SH, Afri Sani Putra Phonna, SH selaku kuasa/wakilnya inisehubungandenganSurat Panggilan Nomor : S.Pgl/6339/ XI/2013/Reskrim tanggal 13 November 2013 Jo S. Pgl/6839-a/XI/ 2013/Reskrimtang-gal27November 2013 terhadap Sri Elviani. (m26)

Rendahnya Kesadaran Mahasiswa Mahasiswa yang selalu dikaitkan dengan agent of change ini seperti kehilangan motivasi dalam hal memperbaiki keterpurukan bangsa yang semakin jelas terlihat. Banyak mahasiswa yang masih belum mengerti tentang perannya sebagai intelektual. Dimana mahasiswa selalu diharapkan dapat membawa bangsa ini menuju perubahan yang lebih baik. Berbagai macam fenomena banyak terjadi dikalangan mahasiswa. Dari mahasiswa yang hanya menjadikan kampus sebagai ajang perbandingan fashion, ajang adu kepintaran, bahkan ajang adu kekayaan. Banyak dari mereka yang lupa bahwa kampus adalah sarana untuk melakukan kegiatan pembelajaran, terus berfikir dan memahami persoalan-persoalan yang ada. Mahasiswa merupakan


patan mengenyam pendidikan lebih dikarenakan faktor ekonomi yang buruk. Sangat disayangkan jika mahasiswa yang merupakan kaum minoritas ini tidak memikirkan nasib mereka yang tidak beruntung dan hanya memikirkan diri sendiri. Rendahnya kesadaran menjadikan mahasiswa hanya merasa perlu mengikuti perkuliahan seperti yang sudah ditetapkan. Bahkan sebagian dari mereka berfikir bahwa kuliah tidak jauh berbeda dengan masa sekolah, yang mana mahasiswa hanya harus belajar dengan sungguhsungguh. Hal ini tidak sepenuhnya salah, tetapi dibalik itu harus dipahami bahwa mahasiswa bukan lagi hanya sekedar seorang pelajar yang dituntut un-

tuk belajar sebaik-baiknya. Karena mahasiswa menyandang kata maha yang berarti besar dan dihormati, yang dalam pengertiannya mahasiswa berarti pelajar yang berada pada tingkatan paling besar dan tinggi. Atau orang yang selalu berpikir berdasarkan ilmu pengetahuan yang kemudian dapat diaplikasikan dalam menghadapi persoalan-persoalan yang terjadi saat ini sehingga dapat bermanfaat bagi orang lain. Mahasiswa yang hanya berburu nilai untuk prestasi nya dalam bidang akademis tanpa menerapkannya pada kehidupan nyata, sesungguhnya bukan lah seorang mahasiswa. Ia hanya seorang pelajar yang tak jauh berbeda dengan siswa sekolah menengah yang selalu

mengejar nilai dan absen selama masa perkuliahan. Mahasiswa diharuskan memiliki kesadaran tentang apa tujuannya selama ini menuntut ilmu. Agar tidak menjadi seorang pelajar yang hanya mementingkan dirinya sendiri. Rendahnya kesadaran hanya akan menjadikan bangsa ini tak pernah maju, karena nya penting bagi mahasiswa untuk membuka wawasan nya se luas mungkin agar dapat menjadi agent of change yang berpotensi memberi kemajuan besar pada bangsa dan negara. Mahasiswa diharapkan dapat menempah dirinya sedini mungkin agar memiliki kesadaran terhadap pem-bangunan bangsa ini. Karena jika bukan yang muda yang memulai pergerakan, kapan lagi bangsa akan bangkit dari keterpurukan.


KETUA Yayasan Pendidikan Islam Batu Bara Sejahtera Dr. H. Sulaiman M. Amir, LC, MA, didampingi Ketua PembinaYayasan Pendidikan Islam Batu Bara Sejahtera, Syufri Basrah, S. Ag, MAP menyerahkan berkas pendirian yayasan, Senin (27/1).

Prof. Dr. Usman Pelly, MA: Jadikan Rumah Sebagai Pustaka Guru Besar Emiritus Universitas Negeri Medan (Unimed) Prof Dr. Usman Pelly, MA, menjadikan rumahnya sebagai perpustakaan dengan nama ‘Casa MESRA Library’ yang dalam bahasa Spanyol, Casa berarti rumah dan MESRA adalah singkatan dari nama kelima orang anaknya Mutia, Embun, Sri, Ratih, Andalusia. Casa MESRA Library menyimpan sebanyak 14.000 judul buku koleksi pribadi antropolog Unimed itu, yang mulai dikumpulkannya sejak tahun 1956 dari berbagai negara seperti Amerika, Belanda dan Jerman. Buku-buku tersebut terdiri dari Bahasa Indonesia, Inggris, Arab dan Belanda yang meliputi buku antropologi, sosiologi, psikologi, politik, ekonomi, hukum dan humaniora serta beberapa tesis, disertasi, jurnal dan kompilasi seminar dalam negeri dan luar negeri. Selain itu, perpustakaan yang dibuka untuk umum itu juga berisi sebanyak 40 macam ensiklopedi tentang sosial budaya, agama dan pendidikan. Bagi Prof. Usman Pelly, Casa MESRA Library, bukan hanya sekedar tempat menyimpan buku maupun membaca buku, tetapi juga sebagai tempat untuk menulis karya-karyanya dalam membuat buku, serta dijadikan sebagai tempat perkuliahan para mahasiswanya baik S2 maupun S3. “Mengapa kuliah S2 dan S3 di sini, karena setelah baca satu buku mahasiswa bisa mendiskusikannya,” kata Prof. Usman Pelly saat ditemui

di perpustakaannya di Kompleks Griya Unimed, Jl. Pelajar Timur, Medan Area, Selasa (4/2). Menurutnya, untuk apa menghabiskan waktu meresumekan kembali buku-buku yang sudah dibaca, paling penting adalah apa yang harus didiskusikan dari buku tersebut, baik teori, metodologinya, penemuan baru, atau buku yang relevan bisa digunakan untuk disertasi atau tesis. Prof. Usman Pelly mengatakan, dari pengalamannya membuat perpustakaan di dalam rumahnya, ingin mendorong anak-anak memiliki perpustakaan sekaligus mencintai dan menggemari buku. “Pengalaman saya dengan lima anak, saya buat perpustakaan atas nama anak saya Mutia, Embun, Sri, Ratih, Andalusia (MESRA). Mereka sering mengajak teman-temannya bermain di rumah sekaligus membaca dan membahas bukubuku. Itu yang menyebabkan mereka mencintai buku,” ujarnya. Guru Besar Emiritus Pascasarjana Antropologi Unimed ini mengatakan, sebenarnya banyak orang mengatakan membaca buku itu bisa menyehatkan tubuh. Seperti di Amerika semua orang gemar membaca, bahkan di mana pun berada baik di tempat umum maupun angkutan umum. “Makanya, saya selalu sosialisasikan kepada keluarga saya, istri dan anak-anak untuk gemar membaca, termasuk mahasiswa,” ujarnya. (m41)


PROF. DR. USMAN Pelly, MA saat membuka buku di dalam perpustakaan miliknya yang bernama Casa MESRA Library di Kompleks Griya Unimed, Jalan Pelajar Timur, Medan Area.



WASPADA Kamis 6 Februari 2014


Dilema Thailand Pasca Pemilu


asca Pemilu Thailand Minggu 2 Februari 2014 negeri gajah putih itu tetap dalam bayang-bayang kerusuhan walaupun pesta demokrasi sudah dipercepat untuk mengatasi krisis politik berkepanjangan. Tidak ada pertumpahan darah sebagaimana digembar-gemborkan kelompok oposisi di hari pencoblosan itu walau dilaporkan sembilan provinsi di wilayah selatan tidak bisa melakukan pemilihan umum. Laporan mengenai adanya hadangan dilakukan oleh massa anti-pemerintah mengemuka namun hanya kendala-kendala kecil di hari-H. Secara umum pemilu Thailand berjalan aman dan lancar. Siapa pemenang pemilu Thailand? Pihak Partai Peu Thai mengklaim memenangkan pemilu. Tetapi partai tempat Perdana MenteriYingluck Shinawatra bernaung pun sudah pasti di atas angin walau tetap dihadapkan pada kelanjutan krisis pemerintahan mengingat sulit baginya untuk membentuk pemerintahan baru yang kuat sejak dilanda krisis kepercayaan karena berupaya membuat UU baru terkait amnesti. Tak pelak lagi konflik yang terjadi telah membelah dukungan rakyat hingga menjadi dua kubu. Kubu “Kaus Merah” mendukung Perdana Menteri Yingluck Shinawatra dan kubu“Kaus Kuning” yang mendesak agar Yingluck lengser dari jabatannya. Adanya kelompok oposisi yang kuat sebenarnya Intisari: bagus untuk mengontrol pemerintahan yang merupakan dinasti ‘JikaYingluck menang dan Yingluck HYPERLINK “http://profil.merdetetap berkuasa sementara Shinawatra. Namun kerusuhan meluas pada nawatra/” tujuan oposisi sebenarnya bukan untuk akhirnya militer dan kera- mengontrol pemerintahan saja tapi ingin menjatuhkannya dan berkuasa. Tentu jaan turun tangan’ rakyat Thailand tidak terima, sementara militer berupaya tidak berpihak, kecuali kondisinya semakin memanas dan kerusuhan meluas pasca pemilu kemarin. Hemat kita, demo anti pemerintahan Yingluck membesar setelah adik mantan PM HYPERLINK “ ” Thaksin Shinawatra itu –Thaksin terguling dalam demo hampir sama tahun tahun 2006— mengusulkan pembuatan Undang-Undang Amnesti . Pihak militer dan oposisi beserta kelompok menengah di Thailand menolak keras wacana amnesti itu karena sudah jelas terbaca jika UU Amnesti sampai disahkan maka abangYingluck (HYPERLINK “” Thaksin Shinawatra) akan memperoleh ampunan dan bisa kembali ke negaranya menjalankan aktivitas bisnis maupun politik sementara kasus korupsinya terabaikan. YingluckShinawatramengatakandiapuasdenganpelaksanaanpemiluinidanberterima kasih kepada para pejabat dan rakyat yang mengikuti pemilu. Pemilu adalah titik awal untuk memecahkan kebuntuan dan masalah melalui proses demokrasi.Yingluck menolak mundur tapi memberi solusi mengatasi krisis politik di negerinya atas maraknya aksi demo anti-pemerintah oleh Komite Reformasi Rakyat Demokratis (PDRC) sejak tahun lalu. PDRC menginginkanYingluck turun tanpa harus lewat pemilu.Tentu saja pendukung pemerintah menolak keras, apalagi dukungan rakyat pada dinasti Taksin itu masih sangat kuat, terutama di kalangan akar rumput. Tentu tidak sulit buat partai dukungan pemerintah untuk memenangkan pemilu walau pemungutan suara hanya berlangsung di 89 persen dari 93.952 tempat pemungutan suara (TPS) di seluruh negeri.Tidak semua provinsi mampu ambil bagian dalam pemilihan umum, terutama yang berada di Thailand selatan. Di kawasan berpenduduk mayoritas Muslim ini pemerintahanYingluck kurang mendapat tempat, Komisi Pemilihan Umum Thailand membatalkan pemungutan suara di sembilan dari 14 provinsi di Thailand selatan. Di provinsi Songkhla, Trang, Phatthalung, Phuket, Surat Thani, Ranong, Krabi, Phangnga, dan Chumphon, tak ada suara sama sekali. Bahkan banyak TPS tidak buka dan tidak ada pemilihnya sehingga bakalan mengganggu pemerintahan baru karena dukungannya berkurang. Diperkirakan tidak seluruh kursi parlemen akan terisi. Dengan kondisi tersebut, politik di Thailand akan terus dalam dilema kekacauan dalam beberapa bulan ke depan karena pihak mana pun yang memenangkan pemilu, tidak bisa membentuk pemerintahan yang kuat. Oleh karena itu, pasca pemilu Thailand tetap dilema alias akan tetap bergolak, malah bisa semakin serius bila aksi demo semakin meluas, tidak hanya di kota-kota besar dan mengganggu pusat pemerintahan jika partai pemerintah memenangkan pemilu. Klaim partai oposisi pasti kemenangan pemilu ditengarai lewat permainan curang sehingga legitimasi kemenangan partainya Yingluck dinilai rendah. Hasil resmi pemilu yang diperkirakan didominasi partai pemerintah baru setelah seluruhsuaradihitung,termasukpemungutansuaraberikutnya.Pemilulanjutandijadwalkan 23 Februari. Kita tunggu dan amati dilema gejolak politik di Thailand ini bakal berlanjut. Kalau Yingluck tetap berkuasa, sementara kerusuhan meluas, pada akhirnya militer dan kerajaan turun tangan.+


Faks 061 4510025

Facebook Smswaspada

Kelemahan Sebuah Bangsa Oleh M Ridwan Lubis Sekalipun dalam berpolitik menggunakan kata demokrasi tetapi wujudnya perasaan super ego sehingga yang tampil adalah kompetisi pada tataran horizontal bukan merumuskan ide-ide yang universal.


riteria sebuah bangsa sering dijadikan acuan jumlah populasi penduduk, luas wilayah, ragam penduduk serta sumber daya alam. Tetapi kenyataannya jumlah populasi yang begitu besar tidak jarang menjadi beban pembangunan. Lihat misalnya tingginya angka pengangguran yang sebagian disebabkan arus urbanisasi yang tidak terkendali—justru melahirkan berbagai penyimpangan perilaku sosial. Luas wilayah yang tidak terurus akan menimbulkan kesan diskriminatif pada sebagian wilayah terutama yang jauh dari pusat kekuasaan. Ragam penduduk baik agama maupun budaya yang tidak bisa dikelola baik akan menjadi potensi konflik karena akan ada kesan dominasi satu kelompok terhadapkelompoklaindandemikiansebaliknya. Sumber daya alam yang melimpah akan menjadi percuma manakala tidak ada upaya memanfaatkannya secara optimal melalui cara dan pendekatan yang lebih profesional. Faktor kelemahaman sebuah bangsa dapat ditelusuri sebagai berikut. Pertama, inti kelemahan adalah tidak jelasnya visi dan misi kehidupan berbangsa karena lebih didominasi tujuan dan pertimbangan jangka pendek yaitu pragmatis dan hedonis. Hal ini tentu akan membangkitkan egoisme baik pribadi maupun kelompok. Padahal perjua-

+6283194817681 UNTUNG SAJA JOURNALISTWA SPADA DIKALA MENG -UP DATE SITUASI DAN KONDISI GUNUNG SI NABUNG , tidak ada semburan a wan panas dari mulut Bulang (Ki ) Sinabung , seperti kemarin . Journalist =War tawan & Pengun jung meregang nyawa ashbab a wan panas di se mburkan oleh Si nabung pada sa’ at itu . Kaki di la ngkahkan dari habitat mereka masing-masing menuju keSinab ung untuk meng antar nyawa..... Kullu Nafsin dza ‘iqot ul mawti !# ng # +6281263191734 Assalamu’alaikum.W.W. Pemerintah Pusat, Gubsu dan aparat terkait di Provinsi Sumatera Utara Seharusnya “CEPAT” menyelesaikan Pengerjaan Jalan arteri utama ke Bandara Kualanamu yang “SUDAH” Lebih 4 Tahun lebih terbengkalai & tak kunjung selesai, seharusnya : 1. Pemerintah “SEGERA membayar GANTI RUGI” sebaga arah ke bandara yang menyempit, 2. Pemerintah Jangan membiarkan lama-lama Kasus Ganti Rugi pembebasan tanah warga untuk kepentingan umum, segera di bake Medan tempo hari diarahkan naik kereta api, 5. LEBAR nya sebagian “MEDIAN” jalan membuat jalan UTAMA ke bandara KNIA ini jadi MENGECIL, sepertinya Pelsatu mobil saja jalan utama ke KNIA ini menjadi sempit, 7. SEHARUSNYA lebar Median jalan ke Bandara ini di samakan dengan LEBAR MEDIAN jalan dari awal arah masuk ke bandara (dari Kayu Besar Tjg. Morawa) sehingga jalan menjadi “LEBAR dan INDAH” dipandang. Medan. Wassalam +6281263191734 Assalamu’alaikum.W.W. Kepada Walikota Medan, DPRD Tingkt II dan Pihak terkait dikota Medan, untuk segera “MENABALKAN” nama dua Tokoh Proklamasi Kemerdekaan Republik Indonesia dan Pahlawan Nasional “Bapak Ir.Sukarno dan Drs.Muhammad Hatta”, untuk nama JALAN NASIONAL/JALAN UTAMA dikota Medan, dengan nama jaenabalkan nama kedua Tokoh Nasional ini menjadi nama jalan utam dikota Medan, 2. Kota Binjai sudah lama mengapreasiasikan & menabalkan nama kedua tokoh Nasional tersebut pada satu ruas jalan utama Binjai-Medan, 3. Ironisnya, entah apa jasanya terhadap kota Medan, buru-buru Walikota & pihak terkait cepat-cepat menabalkan namanya jadi nama jalan walaupun jalannya singkat, 4. Sebaiknya nama Ir.Sukarno-Drs. M. Hatta tokoh Proklamator & Pahlawan Nasional ini dt yang strategis untuk mengabadikan nama kedua tokoh nasional kita, 5. Jasa keduanya tak ternilai bagi seluruh rakyat Indonesia, tetapi mengapa diabaikan. Wassalam +6283194817681 BINGKISAN HA RI RAYA IMLEK dari Aparat keamanan R.R.C. un tuk Aparat Pemberantas Korru psi R.I. berupa Benda Hidup bernama ANGGORO yang berleha-leha di Guangzhou dan di Tsenzen R.R.C. lalu diam bil Aparat untuk di bingkiskan ke pada Aparat R.I. yang bertugas di KPK # pengamat tawke-taw ke ~ kr.sikame ng # +6283194817681 Info Resmi dari PT.MKIOS!!!no Anda mendptkan HADIAH 1 Mobil HONDA JAZZ PIN Anda 477BFG7S U/Info klik ~~~ Pesan singkatdiatasdikirimolehlanangpenipuyangoptimisakanberjayamenipusasarantembak ny a . Penipu ini be rSMS via+6282231461614 # calo n qorbannya di kr.sikameng #

samaan yang kemudian berdampak pada menjamurnya sikap egoisme baik pribadi maupun kelompok. Semangat kebersamaan yang rendah ini akan dapat menjalar kepada berbagai sektor. Pada sektor politik misalnya akan muncul egoisme yang melihat bahwa kemenangan perjuangan politik itu hanya milikkelompoknyadansedikitsekalimemberi peluang kelompok lain kesempatan berpartisipasi (zero sum game). Sekalipun dalam kehidupan berpolitik tetap menggunakan kata demokrasi akan tetapi wujudnya tidak lebih dari perasaan super ego sehingga yang tampil adalah kompetisi berlangsung pada tataran horizontal bukan merumuskan ide-ide yang universal. Pemahaman sebagian masyarakat kita tentang otonomi daerah masih lebih didominasi cara pandang untuk memperkaya diri atau kelompok. Padahal mestinya, begitu seseorangditetapkansebagaiseorangpemimpin masyarakat baik pada level rendah sampai tinggi maka hal itu berarti ia telah bersedia menggadaikan dirinya sebagai milik bangsa bukan lagi milik kelompok atau partainya— guna menghindari pemahaman berpolitik yang lebih didominasi rasa kebencian karena selalu mencari kelemahan orang lain. Sikap yang lahir dari etika keberagamaan adalah membiasakan memandang positif terhadap orang lain sekalipun ia menjadi saingan dalam perjuangan politik. Sebaliknya, sikap yang terbiasa memandang negatif terhadap lawan politik maka sesungguhnya ia telah membuka peluang memelihara penyakit dalam dirinya.

Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Tantangan Caleg 2014

+6282273001323 kembali kesisinya. Selamat jalan sahabat ku Thomas Milala(KALA GONDANG) semoga engkau tenang dsana. +6282167170674 Di Era Bapak Presiden Suharto Masih Menjabat Tarian Barongsai Dan Sejenisnya Sangat Dilarang Di Tanah Air Indonesia Agar Bangsa Ini Tidak Menghormati Tarian Lain SelainTradisional Adalah Menjadi Kenyataan Sekarang Ini.Saat IniTarian Tradisional Dari Suku Asli IndonesiaTidak Lagi Di Sukai Oleh Bangsa NySangatTakut Kepada Bangsanya Agar Jangan Meninggalkan Tarian Tradisionalnya Dan Tidak Mencintainya Saat Ini Menjadi Kenyataan.

ngan kemerdekaan sebuah bangsa hanya dapat tercapai melalui komitmen kebersamaan. Atas dasar itu, maka perlu dihidupkan kembali makna dan tujuan hidup berbangsa. Komitmenyangmelandasiseluruhkomponen bangsa hendaklah berangkat pada adanya keyakinan dan tekad berKetuhanan Yang Maha Esa. Pengertian berketuhanan tidak hanya bersifat identitas sehingga makna ketuhanan hanya sekedar pengakuan terhadap nilainilai normatif yang tidak kelihatan segi pragmatisnya dalam kehidupan sehari-hari. Keberagamaan yang berhenti sekedar sebagai simboltidakakanmemberikanmaknakecuali sikap ekstrim memandang kelompok atau aliran lain. Pengertian berketuhanan mencakup makna pokok yaitu kesadaran bahwa Tuhan menciptakan manusia dengan dibekali motif kemauan (masyi-ah) dan kemampuan (istitha’ah). Hal ini kemudian membentuk sikap masyarakat yang dinamis, kreatif dan inovatif. Maknnya, hendaklah disadari bahwa untuk menujukepadamaksudTuhandalampenciptaan maka tentulah manusia harus melaksanakan kehidupan sesuai arah dan pedoman (syari’ah). Hal itulah yang akan membuat manusiadapatmelaksanakanfungsikhalifah. Atas dasar itu, manusia memiliki lima opsi dalam melakukan sebuah tindakan yaitu

kemestian (wajib), terlarang (haram), anjuran mengerjakan (nadb), anjuran meninggalkan (karahah) dan kebebasan manusia memilih (ibahah). Makna selanjutnya adalah bahwa setiap orang harus didorong untuk mengikuti kata hatinya karena kata hati tidak pernah berbohong dan informasi kata hati selalu muncul dari dorongan kebenaran (fitrah). Kebohongan hanya terjadi manakala manusia dikendalikan oleh motif kebuasan (nafs sabu’iyah) sehinggatidakbisamembedakanyangpantut dengan tidak patut. Kedua, kelemahan sebuah bangsa terjadi manakala mereka didominasi oleh pertimbangan yang bersifat deterministik padahal Tuhanmembukapeluangbagisetiapmanusia untuk memanfaatkan potensi kemuan dan kekuatan pada dirinya. Takdir tidak layak dijadikan dalih untuk bermalas-malasan. Tuhan memudahkan bagi setiap orang untuk sampai kepada takdir yang ditentukanNya. Bangsa yang maju pada umumnya selalu menjadikan kerja menjadi bagian dari hidupnya.Keadaantidakbekerjatanpaadahalangan yang prinsip adalah merupakan pengingkaran terhadap nilai-nilai kemanusiaan. Rendahnya motivasi bekerja dapat terjadi karena dua sebab utama yaitu latar belakang persepsikeberagamaanataukarenaketiadaan pendidikan yang dapat mengarahkannya untuk menjadikan prestasi sebagai cita-cita dalamkehidupan.Bangsayangmajubiasanya memiliki perasaan malu apabila tidak menggunakan potensi dirinya untuk bekerja dan oleh karena itu, keinginan untuk berprestasi (need for achievement) menjadi dambaan bagi setiap warga masyarakat. Ketiga, faktor kelemahan sebuah bangsa adalahrendahnyakomitmensemangatkeber-

Oleh Riza Fakhrumi Tahir Rakyat tak bisa disalahkan jika menuntut terlalu banyak kepada pemerintah dan legislatif, karena rakyat merasa dirinya sebagai pemegang kedaulatan yang sah.


utaan pasang mata rakyat Indonesia tertuju ke gedung DPR, Jakarta, Selasa (18/6/13), meskipun hanya perantara televisi. Di kantorkantor, warung, plaza, super market, rumah dan tempat keramaian lain, tua-muda, kayamiskin, laki-laki maupun perempuan, dengan sabar menunggu saat DPR – RI menerima atau menolak RAPBN-P 2013—salah satu pasal penting dan krusialnya adalah soal pengurangan subsidi bahan bakar minyak (BBM) atau istilah umumnya, kenaikan harga BBM. Di berbagai kota di Indonesia, elemen rakyat dan mahasiswa, berdemonstrasi dan “berteriak” mengatasnamakan rakyat menuntut DPR menolak kenaikan harga BBM. Berhari-hari, siang dan malam mereka melakukan hal itu, dan acap kali harus berhadapan dengan aparat keamanan. Ada yang luka karena digebuki dan salah tembak, ada juga yang ditangkapkarenadidugaanarkisdandestruktif. Caci maki dan sumpah serapah tidak hanyatertujukepadapemerintah,tapijugakepada wakil rakyat yang bersidang.Tuduhan wakil rakyat yang tidak berpihak kepada rakyat, tidak asing terdengar. Karena kesal dan kecewa, isu yang diangkat para pengunjukrasa bercambur baur. Mulai soal harga BBM, korupsi,menuntutSBYturun,sampaisoalkinerja DPR, mafia anggaran, dan lain-lain. Fokus dan target gerakan rakyat dan mahasiswa cuma tiga, pemerintah berkuasa, Parpol pendukung pemerintah dan anggota DPR yang berasal dari Parpol pendukung pemerintah. Ketiga elemen ini, pun akhirnya babakbelurdihajarorasidanopiniparaaktivis, serta pemberitaan media massa. Citra Yang Terakumulasi Setidaknya 10 tahun terakhir, lembaga legislatif dan partai politik, baik pusat maupun daerah, menghadapi badai kemerosotan citra yang maha dahsyat. Ini terkait banyaknya anggota legislatif yang ditangkap dan divonis melakukankejahatankorupsi,pencucianuang bahkan skandal perempuan. Citra buruk anggota legislatif karena kasus hukum dan moral, makin diperparah kinerja mereka di legislative. Mereka dianggap tidak sensitif atas penderitaan dan kesulitan rakyat, tidak berpihak pada kepentingan rakyat dan lain-lain.

Kecurigaan, prasangka dan tuduhan yang dilontarkan rakyat, tak bisa lagi dibendung, ditutup dan diputarbalikkan untuk memperbaiki citra anggota legislatif. Pokoknya, dalampandanganrakyat,anggotaDPR/DPRD dan partai politik yang mencalonkan mereka, adalah sosok yang jelek, buruk, hina dan nista. Citra jelek lembaga legislatif dan Parpol kian terakumulasi ketika rakyat menyaksikan lembaga-lembaga itu menyetujui kenaikan harga BBM. Rakyat meneriakkan slogan, “wakil rakyat, bukan suara rakyat.” Slogan itu akan terus menggelinding dan terakumulasi hingga rakyat benar-benar tidak memercayai (distrust) legislatif dan Parpol. Dalam situasi sensitif seperti itu, rakyat tak bisa disalahkan jika menuntut terlalu banyak kepada pemerintah dan legislatif, karena rakyat merasa dirinya sebagai pemegang kedaulatanyangsah.Merekalahyangmemilih secara langsung presiden, wakil presiden dan para anggota legislatif. Rakyat tidak mau lagi aspirasinya dimobilisasi sekali dalam lima tahun, saat Pemilu. Bagi rakyat, partisipasi politik dan mobilisasi aspirasi mereka hanya pada saat diperlukan (Pemilu misalnya), merupakan perilaku politik yang manipulatif dan pembodohan. Secara umum, partisipasi politik ditafsirkan sebagai keterlibatan aktif rakyat dalam proses politik. Mulai dari penilaian hingga pengawasan terhadap orang-orang yang dianggap bisa mewakili mereka di lembaga pemerintah dan legislatif, atau keterlibatan dalam pengambilan keputusan, mulai dari perencanaan hingga pengawasan. Partisipasi ini bisa secara sendiri-sendiri, bisa juga secara kolektif melalui kelompok strategis maupun interest group. Pada tingkat pemahaman seperti ini, rakyat terdidik tidak mau lagi sekedar menjadi “penonton” dan “epigon”. Mereka merasa berhakuntukmenyusunrencanadanmengawasinya.Jikadiperlukanperubahankebijakan, rakyat juga merasa perlu terlibat. Pada gilirannya, muncul-lah kelompok masyarakat yang sensitif, kritis, pesimis dan apatis. Mereka bermetamorfosa dari kelompok kepentingan (interest group) menjadi kelompok penekan (pressure group). Dalam sejarah Pemilu Indonesia di era Reformasi, jumlah mereka memang sedikit, namun mampu memenga-

ruhi rakyat untuk tidak menggunakan hak pilihnya (golongan putih/Golput) mencapai 30-40 persen. Menuju 2014 BagaimanaParpoldanparacalonanggota legislatif (Caleg) menghadapi Pemilu 2014, ketikalembagalegislatifdanParpolmengalami distrust? Suka atau tidak suka, situasi sekarang memang tidak menguntungkan Parpol dan para Caleg, apalagi para kader partai yang belum pernah menjadi anggota legislatif. Mereka terkena imbas arus opini publik yang makin tak percaya kepada Parpol, legislatif danpemerintahanyangdikuasaiParpol.Sebagai salah satu pilar demokrasi, bagaimanapun situasinya, Parpol harus mengambil keputusan untuk mengisi kursi legislatif dengan mengajukan kadernya menjadi Caleg. RibuanCaleg2014,beradaditengahsituasi seperti itu. Saya menangkap suasana kebatinan dan merasakan kerisauan mereka. Betapa beratnya menghadapi keadaan yang tidakbersahabat,tekanandantantanganyang terus terakumulasi dari hari ke hari. Apalagi, sebagian besar anggota legislatif produk Pemilu 2009, yang selama ini dinilai tidak mewakili aspirasi rakyat, mencalonkan kembali di Pemilu 2014. Kebencian kepada para wakil rakyat, akhirnya juga menyentuh para Caleg lainnya. Para Caleg yang berpengalaman sebagai pimpinan Parpol dan beberapa periode menjadi anggota DPRD, relatif lebih mampu menyiasati keadaan dan tantangan itu.Tapi, bagi para politisi pemula, yang baru pertama menjadi Caleg, tentu ereka shock menghadapi tekanan rakyat yang luar biasa. Belum lagi logistik yang harus mereka sediakan guna memenuhi “syarat-syarat” agar rakyat memilih mereka. Istilah “ada uang ada suara,” semakin memberatkan pada politisi pemula. SemuaberpulangkepadaParpoldanpara Caleg. Parpol harus punya komitmen yang jelas dan tegas mencalonkan kadernya yang berkualitas, sesuai kebutuhan rakyat. Saya tidak tahu Parpol sudah atau belum memenuhi standar kebutuhan rakyat ketika mencalonkan kadernya sebagai anggota legislatif. Saya percaya, waktu yang akan memahaminya.Nantiakanketahuan,diharipenghitungan suara, dan tampak dari perolehan suara Parpol dan Calegnya. Parpoljugaharussecaraintensif“menjual” para Calegnya ke publik. Sayangnya, strategi komunikasi Parpol dalam “menjual” para Calegnya sangat minim. Parpol menyerahkan sepenuhnya pada kemampuan dan ketrampilan para Caleg, termasuk dalam urusan mendongkrak elektabilitas Parpol. Sedangkan

di kalangan Caleg sendiri, jangankan untuk kepentingan Parpol, untuk dirinya sendiri banyak yang tidak tahu harus melakukan apa, bagaimana, kenapa, dimana dan kapan. Hari “H” pemungutan suara tidak sampai dua bulan lagi. Masih cukup waktu untuk membangun komunikasi, mengembalikan kepercayaan publik, dan meningkatkan elektabilitas.Kita,rakyatpemilih,jugamasihpunya waktu untuk mengevaluasi itikad Parpol dan kapasitas para Calegnya. Bukan hanya Parpol dan para Caleg, tapi kemampuan dan intensitas rakyat mengawasi dan mengevaluasi mereka, juga menentukan nasib bangsa dan masa depan demokrasi di negeri tercinta ini. Penulis adalah Sekretaris Pengurus Daerah Kolektif (PDK) KOSGORO 1957 Sumut (2010-2015), Wakil Sekretaris DPD Partai GOLKAR Sumut (1999-2012).

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Krisis listrik, DPRDSU minta usut pimpinan PLN - Sekalian bikin efek jera * BupatiTobasa dipaksa warga ikut demo - Biar berpengalaman menjadi pendemo * Bupati Langkat santap bersama pengungsi Sinabung - Mejuah-juah! o ak D W



WASPADA Kamis 6 Februari 2014


Pinjam Pakai Sekolah Negeri Semua gedung sekolah negeri milik rakyat, karena dibangun dengan uang rakyat. Gedung tersebut dipercayakan kepada guru pegawai negeri menggunakannya demi pendidikan rakyat. Tetapi hanya pegawai negeri yang diperkenankan memakainya. Jika ada pihak ketiga di luar pegawai negeri ingin memakainya, maka harus minta izin kembali kepada rakyat sebagai empunya gedung. Lalu bagaimana dengan banyaknya gedung sekolah negeri yang dipakai oleh sewasta. Apakah mereka sudah minta izin kepada rakyat? Pemakaian gedung negeri oleh swasta jelas melanggar aturan, namun yang memakai adalah pejabat setempat atau ‘orang hebat’, maka tak ada yang berani melawan. Akhirnya kolusi berkembang sampai puluhan tahun lamanya. Jikapun ada lembaga swadaya masyarakat atau pers yang keberatan, biasanya diselesaikan ‘damai di tempat’. Jika mereka sangat ngotot, maka siap-siap berhadapan dengan pejabat dan orang hebat. Biasanya satu-satu mereka mundur teratur. Pada dasarnya pemakaian gedung sekolah negeri sore hari oleh swasta sangat mengusik kegiatan belajar mengajar sekolah negeri yang pagi. Karena beberapa fasilitas negeri akan terpakai rusak, aus, hilang dan lain lain. Karena gedung dipakai sore hari, maka siswa pagi kesulitan melaksanakan pelajaran ekstrakulikuler sore hari. Padahal ekstra kulikuler ini sangat diperlukan guna menciptakan siswa yang berkompetensi. Beberapa sekolah SMP dan SMA Negeri terpaksa meniadakan kegiatan ekstrakulikuler. Hal ini jelas menghambat pencerdasan anak sekolah negeri. Pemakaian gedung negeri ini pernah diperkenankan oleh pemerintah pada tahun 80-an. Ada dua alasan diperbolehkan pada saat itu, pertama, atas permintaan dari guru negeri sendiri. Karena ingin menambah penghasilan gaji guru yang tak seberapa pada masa itu, maka guru negeri mengajukan membuka sekolah swasta sore hari. Biasanya permintaan ini diperkenankan oleh dinas pendidikan pada masa itu. Kedua, karena langka-nya sekolah swasta saat itu. Bagi siswa yang tak lulus sekolah negeri maka harus sekolah swasta yang sangat jauh dari rumah. Melihat ini beberapa guru saat itu memohon pemakaian gedung pada salah satu sekolah negeri. Dengan berbagai alasan dan pendekatan maka sekolah dan dinas pendidikan memberikan izin. Seiring waktu, perlahan gaji guru mengalami peningkatan yang disempurnakan adanya tunjangan gaji sertifikasi. Guru negeri mulai cukup finansial, mereka tak mau mengajar tambahan di sore hari. Sekolah yang didirikan atas dasar menambah penghasilan kini mulai ditinggalkan, digantikan guru honor swasta. Sekarang guru negeri yang mengajar di sekolah yang menumpang tersebut hanya tinggal dua tiga orang, sebagai kepala sekolah dan wakilnya. Pada sisi lain, sekolah swasta tumbuh bagai cendawan di musim hujan. Setiap kampung ada sekolah. Berdasarkan fakta tersebut seharusnya sekolah yang menumpang di gedung negeri ini mulai introspeksi diri. Seharusnya ada upaya untuk mendirikan gedung sendiri. Jangan berlama-lama memakai fasilitas negara, karena sudah tak sesuai aturan. Terkesan mempertontonkan penyalahgunaan. Menjadi pendidikan buruk buat masarakat. Akibatnya keberadaan sekolah justru tak mendidik. Pemakaian gedung negeri ahirnya berlanjut sampai 30 tahun lamanya. Disinyalir menjadi ladang penyalahgunaan pihak tertentu. Kita tak tau lagi manajemen administrasi sekolah swasta yang menumpang tersebut. Kemana keuntungan uang komite dari anak sekolah sewasta tersebut? Laba sekolah swasta yang menumpang, tak tau kemana rimbanya, arang habis besi binasa. Karena itu kita berharap pemerintah menertibkan pemakaian gedung sekolah negeri ini. Buatlah aturan yang mendidik kepada sekolah swasta yang menumpang tersebut. Sudah terlalu lama kolusi dipertontonkan, tak baik buat pendidikan anak bangsa. Nada Sukri Pane Mahasiswa Pascasarjana IAIN SU

Dedi Sahputra


Cerita Seorang Kawan Dalam setiap objek yang sama, akan selalu menyimpan “banyak wajah” yang mengitarinya. Wajah yang banyak inilah yang meniscayakan munculnya sudut pandang yang berbeda-beda pula. Jadi jangan heran, kalau ada orang yang menyukaimu, tapi ada pula yang membencimu. Bahkan para Nabi sekalipun dicintai sekaligus dibenci. Dan sejatinya pula, setiap orang menggendong perspektif-perspektifnya sendiri. Dengan perspektif ini orang memiliki persepsi terhadap sesuatu atau seseorang— yangdalamperjalanannya,penuhdinamika dan berwatak progresif—hingga kecenderungannya adalah berubah-ubah. Dan dengan perspektif ini pula orang seringkali merasa punya hak untuk menjadi hakim, ataupun menjadi pemarah. Saya tak terkecuali. Terhadaporanginimisalnya,sayapunya persepsiyangberbedadalamsekianrentang masa. Pada awalnya saya merasa dia adalah teman bergaul, bercanda, ataupun berdiskusi. Saya tak punya persepsi negatif tentang dia, sampai suatu ketika saat sepedamotor saya mogok di jalan. Saya yang memang tidak punya keahlian tentang kendaraan, hanya mengharapkan ada orang yang bisa membantu. Doa saya seperti langsung dijawab Tuhan. Karena tak lama datang kenalan saya ini melintas. Diapun berbaik hati menghentikan kendaraannyadanmenanyakan kondisi kendaraan saya. Hati saya pun senang, dan merasa segera terlepas dari kesulitan ini. Kalaupun dia tak bisa merawat kendaraanku, setidaknya dia bisa membimbing sampaikebengkel,pikirku. Tapi rupanya dia sekedar bertanya, sambiltersenyumdia kemudian berlalu begitu saja. Ini senyum yang saya ingat sebagai ejekan yang meng-hinakan.Apalagitaklamahujanderas pun turun. Maka dari kesal, saya jadi marah padanya.Makajikatadinyasayamemersepsikan dia sebagai seorang kawan, kini hanya sekedar kawan. *** Kemarahan saya padanya bertahan sekianlama.Sayaterusberharapsuatuketika sepedamotornya mogok di jalan di waktu saya melintas. Saat itu saya akan tertawatawa bahagia untuk mengejeknya. Biar dia tahu bagaimana rasanya diejek seperti itu. Namun belum lagi“doa yang mengancam” itu terkabul, saya sudah menemukan kenyataan baru. Itu ketika strata sosialnya meningkat. Dari naik sepedamotor, dia kini punya mobil baru. Dari orang yang ramah dia kini jadi jaim, dari sering bergaul dia kini hanya berbicara kepada orang“sekelas” saja. Suatu ketika kami berpapasan jalan. Saya pasang senyum paling ramah untuk menyambutnya penuh suka cita. Tapi apa

yang terjadi kemudian sungguh di luar dugaan saya. Dia hanya berlalu seolah tak melihat kehadiran saya di hadapannya. Maka kelakuannya ini cukup untuk menerbitkanmarahsayapadanya.Tapiinikemarah sublimatif belaka, karena tak pernah saya ekspresikan.Sayadamaikanhatisayasendiri; orang kalau sudah punya status baru, perilakunya juga baru. Jadi dimaklumi saja. Maka saya tak mau memusingkannya. Waktu terus berlalu ketika mendengar dia mulai mencoba mengintervensi hidup saya. Dia bicara pada orang lain tentang sesuatu yang jelek mengenai saya. Bahkan saya dengar dia mencoba untuk membuat saya berada dalam kondisi yang tidak menguntungkan. Maka persepsi saya terhadapnya jadi berubah; dari sekedar kawan, menjadi lawan. Namun tetap saja persepsi saya ini tidak diikutiolehperilaku.Sampaiketikadiasudah berani mentang-mentang kepada saya. Di hadapan orang banyak dia memaki saya sedemikian rupa. Bukan caciannya itu yang membuat saya marah, tapi respons orangorang yang memanas-manasi itu. Cukup sudah. Orang ini tak bisa lagi dibiarkan.Dengankemarahansayakatakan kepada diri sendiri; menjadi musuhnya adalah lebih beruntung ketimbang jadi temannya. Setiap kegembiraannya sudah menjadi kesakitan bagi saya, dan setiap penderitaannya adalah kebahagianku. Dia harus dipermalukan biar dia tahu rasanya sakit, dia harus diberi pelajaran biar orang tahu rasa. Jangan seenaknya dia seperti itu. Anda jangan ikut campur, karena saya sudah benar-benar marah. *** Saat yang saya tunggu-tunggu itu akhirnya tiba juga. Wajahnya memerah, matanya sayu. Walaupunbibirnyatersenyumsayatahudia sedangsangatmenderita.Sayabersorakdalam hati: rasakan olehmu sekarang. Ha ha ha… Tapi tanpa saya duga, dia datang ke hadapanku dengan wajah hampir runtuh. Dia tatap wajahku dengan tatapan seribu makna. Sorot mata sampai gestur tubuhnya berbicara banyak sekali padaku. Dia sodorkantangannyasebelummenggenggamnya dengan sangat erat sekali. “Maafkan aku,” katanya. Selama sepersekian detik saya seperti mengalami misorientasi. Selanjutnya saya seperti ditimpuki jutaan batu. Tubuh ini serasa sangat berat sekali, seolah ada beban yang tak sanggup saya pikul. Ucapannya memang singkat saja, tetapi seakan-akan bergaung ke seantero hatiku. Setiap orang memang punya tabiatnya sendiriyangmembuatoranglainjadimarah, benci,danmenyakiti.Tapijikamenyakitiyang jadipilihanmu,itusamahalnyamenghancurkan dirimu sendiri.(Vol.488, 6/2/2014)

Kolom foliopini dapat juga diakses melalui

Menyoal Usulan Pemilu Serentak Oleh Hasrul Harahap, SS, M.Hum Isu Pemilu serentak menjadi target antara menghapus syarat ambang batas pencapresan (presidential threshold), minimal 20 kursi DPR atau 25 persen suara sah pemilihan legislatif.


acana pemilu serentak yang telah disidangkan di Mahkamah Konstitusi (MK) akhirnya

ditolakuntuktahuninidandiberlakukanpada tahun 2019. Pemilihan legislatif yang hitungannya tinggal kurang dari tiga bulan lagi bisa menjadi kegaduhan politik apabila pasal mengenai ambang batas presiden yang terdapat dalam undang-undang Pilpres dihapuskan. Dimungkinkan apabila gugatan yang dilakukanYusril Ihza Mahendra diaminkan olehMKmakaadapeluangsetiappartaipolitik (Parpol) bisa mengajukan calon presiden masing-masing. Argumentasi hukum yang dilontarkan Yusril adalah bagaimana biaya Pemiludalampemilihanlegislatifdanpresiden bisa diminimalisir. Nyatanya permohonan calon presiden dari Partai Bulan Bintang tersebutakhirnyaditolakdanakandiselenggarakan pada 2019. Yang menjadi pertanyaan mendasar adalah apakah motif hukum yang disampaikan pemohon di MK dalam perubahan pasal mengenai calon presiden? Atau karena semata ini hanya kekuasaan un sich oleh para aktor politik dalam mencalon diri sebagai presiden. Argumentasi yang disampaikan oleh Yusril dalam resume permohonan barunya mengangkatargumentasisejenis.PengaturanPemilu tak serentak dan syarat ambang batas presidensialyangkemudianmenghalangimunculnya calon presiden dan wakil presiden dari partai lain yang terdapat dalam pasal 28D ayat (1) UUD 1945. Isu Pemilu serentak menjadi target antara menghapus syarat ambang batas pencapresan (presidential threshold), minimal 20 kursi DPR atau 25 persen suara sah pemilihan legislatif. Bila Pilpres digelar serentak syarat presidential threshold tidak akan lagi diperlukan.

Semua Parpol peserta Pemilu bisa mengajukan Capres sendiri. Apabila dihitung secara kalkulasi politik apabila UU Pilpres ini dikabulkan MK maka akan banyak calon presiden yang akan bertarung. Di antara calon presiden yang berkompetisi antara lain Partai NasDem akan mengusung Jusuf Kalla, PKB akan mengusung Mahfud MD, PKS Hidayat NurWahid, PDI-P Joko Widodo, Golkar Aburizal Bakrie, Gerindra Prabowo Subianto, Demokrat Dahlan Iskan, PAN Hatta Rajasa, PPP Suryadharma Ali, Hanura, Wiranto, PBB Yusril Ihza Mahendra dan PKPI Sutiyoso. Selanjutnya, yang paling dikhawatirkan adalah jika masa jabatan presiden dan wakil presiden sudah berakhir, sementara Pilpres belum terlaksana. SebaliknyaYusril meyakini bahwajadwalPemilu2014takakanterganggu, jika MK mengabulkan gugatannya tersebut. KPU kemudian hanya mengundurkan pelaksanaan Pemilu DPRD, DPR RI dan DPD menjadi sama dengan Pilpres dan hal itupun tidak mengganggu persoalan logistik Pemilu 2014. Jika sekarang rencananya Pemilu DPRD, DPR, RI Sistem Presidensial Menurut UUD 1945, seluruh anggota DPR dipilih melalui mekanisme pemilihan umum yang pesertanya diikuti Parpol, sehingga anggota DPR pasti anggota Parpol. Karena konfigurasi kekuatan partai politik yang memiliki anggota di DPR, maka posisi Parpol yang memiliki kursi di DPR dalam sistem pemerintahan sangatlah penting karena dapat memengaruhi efektivitas dan kebijakan pemerintahan. Walaupun demikian, presiden dalam menjalankan pemerintahan tidaktergantungsepenuhnyapadadukungan Parpol. Karena presiden dipilih langsung rakyat, maka dukungan dan legitimasi rakyat itulahyangseharusnyamenentukanefektivitas

kebijakan pemerintahan yang dilakukan presiden. Dari ketentuan UUD 1945 tersebut, dapat disimpulkan secara sederhana bahwa Parpol dalam posisi penting dan strategis. Dengan kata lain, presiden memerlukan dukungan Parpol yang memiliki anggota di DPR untuk efektivitas penyelenggaraan pemerintahan dan pada sisi lain menempatkan rakyat dalam posisi yang menentukan legitimasi seorang presiden. Dalam penyelenggaraan Pilpres tahun 2004 dan 2009, ditemukan fakta bahwa untukmendapatdukunganmenjadipresiden, calon presiden harus melakukan bargaining politik terlebih dahulu dengan Parpol—berakibat sangat memengaruhi roda pemerintahan di kemudian hari. Negosiasi tersebut pada kenyataannya lebihbersifattaktisdansesaatdaripadabersifat strategis dan jangka panjang. Karena itu, presiden pada faktanya menjadi sangat tergantung pada Parpol—dapat mereduksi posisi presiden dalam menjalankan kekuasaan pemerintahan menurut sistem pemerintahan presidensial. Dengan demikian, penyelenggaraan Pilpres harus menghindari bargaining politik. Hal demikian akan lebih memungkinkanbagipenggabunganParpolsecara alamiah dan strategis sehingga dalam jangka panjang akan lebih menjamin penyederhanaan. Peluang Poros Tengah JikamelihatUUPemiluNo.42tahun2008, Parpol atau gabungan Parpol baru dapat mencalonkan Capres/Cawapres jika memenuhi syarat menguasai 20 persen kursi di parlemen, atau memiliki suara nasional 25 persen. Berdasarkan ketentuan ini, bisa dipastikanParpolyangmenggagasporostengah tidak dapat mengajukan Capres sendiri. Kalau kita lihat data perolehan suara partai tahun 2009, dari 38 Parpol hanya beberapa yang memenuhi persyaratan mengajukan calon presiden. Gabungan beberapa Parpol yang bisa mengajuka calon presiden harus memenuhi 20 persen kursi di parlemen. Pasangan Megawati dan Prabowo Subianto yang memperoleh 26,79 persen suara yang didukung PDIP dan Gerindra pada 2009. Mereka mengakui Susilo Bambang Yudhoyono dan Boediono yang memperoleh

60,80 persen suara yang didukung Partai Demokrat, PKB, PKS, PPP. Sementara Jusuf KalladanWirantoyangdidukungPartaiGolkar dan PBB hanya memeroleh 12,41 persen suara. Itulah sebabnya, bila perolehan suara kursi parlemen harus memenuhi syarat 20 persen untuk mengusung calon presiden, maka partai Islam dan nasionalis seperti PPP, PKB, PAN, PBB, PKPI, NasDem, PKS harus fusi untuk memenuhi persyaratan. Sejauh ini tahapan Pemilu 2014 sudah berjalan sesuai jadwal yang disusun sejak awal. Maka apabila diubah dikhawatirkan terjadi ketidakstabilan, sangat mungkin akan terjadi gesekan dan instabilitas di masyarakat. Selain itu dari sisi ketersediaan waktu, Pemilu Legislatif 2014 ini sudah tidak mungkin lagi dilaksanakan secara serentak dengan Pilpres. Karena jika MK mengabulkan permohonanYusril, hendaknya dengan satu syarat bahwa Pemilu serentak baru bisa dilakukan tahun 2019. Penutup Saat ini yang perlu diperbaiki adalah mengefektifkan Pemilu serentak. Dengan kata lain, kita dapat membagi Pemilu menjadi dua yaitu, Pemilu nasional dan daerah. Pertama, Pemilu nasional untuk memilih Presiden, DPR, DPRD dan DPD dan yang kedua, memilih kepala daerah. Dengan dilakukan Pemilu serentak pada 2019 diharapkan Parpol lebih selektif menentukan calon presiden agar masyarakat tak memilih kucing dalam karung. Jika hal tersebut tak dilakukan secara selektif jangan harapkan mendapatkan sosok presiden yang mampu membawa negeri ini keluar dari keterpurukan. Di lain sisi, apabila rekrutmendalamParpoltakberjalanmaksimal makacalonperseoranganbisamenjadijawaban alternatif dalam memilih presiden ke depan. Untuk itulah, Pemilu serentak masih cukup panjang agar para perangkat Pemilu dalam hal ini KPU, Bawaslu, Bawaslu, DPR, dan pemerintah harus mampu mengawal putusan MK ini secara objektif. Selain itu juga kesiapan KPU menyongsong Pemilu serentaktahun2019sejakdiniharusdipersiapkan komprehensif agar pembiayaan politik lebih efisien. Penulis adalah Peneliti Di Candidate Center.

Malfungsi Dana Saksi Oleh Agus Adhari Usulan dana saksi Parpol untuk Pemilu yang diambil dari APBN sebenarnya diusulkan partai politik pada Menkopolhukam. Namun partai mana saja yang mengu-sulkannya tidak diketahui rimbanya.


eberapa partai politik (Parpol) sepertinyabakalmendapatkan“durian rontok” menjelang dikucurkannya dana saksi bagi peserta pemilihan umum (Pemilu). Dana saksi tersebut diambil dari APBN dengan jumlah fantastis mencapai Rp700miliar.SetiapsaksiParpoldibayarRp100 ribu, dikalikan jumlah TPS 545.778 dikalikan 12 Parpol, hingga masing-masing mendapatkan Rp54,5 miliar yang pencairannya dilakukanolehBadanPengawasPemilu(Bawaslu) di TPS. Angkayangbegitubesardigunakanuntuk saksiParpolsebenarnyatidaktepatditerapkan mengingat kebutuhan Pemilu yang begitu besardiluardanasaksitersebut.Untukpenyelenggaraan Pemilu 014 saja, pemerintah menyiapkandanauntukKPURp16triliun,belum termasuk dana yang diterima Parpol seperti yang tertuang dalam Pasal 34 (3) UU No.2 Tahun 2008 tentang Partai Politik. Dana tersebut adalah dana yang diterima Parpol sesuai jumlah kursi yang didapat. Singkatnya, proses pemilihan ini telah memakan cukup banyak biaya yang sejatinya dapat digunakan untuk pembangunan infrastruktur. Diskriminasi Dana Saksi Perlu dipahami, makna Pemilu dalam

Pasal 22 E (2) UUD 1945 adalah diselenggarakan untuk memilih anggota Dewan Perwakilan Rakyat, Dewan Perwakilan Daerah, Presiden danWakil Presiden dan Dewan Perwakilan Rakyat Daerah. Berdasarkan makna ini, dapat dilihat bahwa peserta Pemilu bukan hanya dari Parpol, namun ada calon dewan perwakilan daerah (DPD). Kemudian jika mautetapmenggelontorkandanasaksi,maka bukan hanya Parpol saja yang menerima, namun seluruh pihak yang ikut serta dalam Pemilu. Namun dana APBN yang mencapai Rp700 miliar tersebut hanya diperuntukan bagi 12 Parpol sebagai dana saksi. Padahal bukan hanya calon legislatif (Caleg) Parpol saja yang menjadi kandidat. Masih ada calon DPDyangmengikutiajangpemilihantersebut. Jika dana hanya diberikan pada 12 Parpol, lantasbagaimanadengancalonDPD?Apakah mereka yang harus memberikan uang saksi diTPS?Tentu hal demikian merupakan diskriminasi hak politik. Kemudian bagaimana dengan alokasi dana saksi bagi tiga partai lokal Aceh yang ikut dalam pesta demokrasi tersebut? Apakah ada penerimaan dana dari APBD provinsi karena keikutsertaan mereka hanya pada level provinsi?

Tujuan dibiayainya saksi Parpol adalah guna mencegah terjadinya manipulasi hasil Pemilu, karena jika saksi tidak dibiayai maka mereka akan mencari partai lain yang akan memberikan “uang makan”—yang justru akan merusak hasil Pemilu—begitu penjelasan oleh salah satu Parpol dalam menanggapi kontroversi dana ini. Terlepas dari tujuan tersebut, sebenarnya sangat sederhana membalikan pembenaran di atas. Pertama, Pasal 139 (1) huruf C UU No. 8Tahun 2012 tentang Pemilu menyatakan bahwa peserta Pemilu dilarang menerima dana dari pemerintah, dan hal ini sangat jelas, bahwadanasaksimerupakandanayangdiberikan oleh pemerintah pada Parpol melalui Bawaslu, ringkasnya Bawaslu adalah “mafia” penyalur dana Parpol. Kedua,jikahanyaRp100ribu/saksi,Parpol menjamin akan menciptakan hasil yang baik di TPS mungkin hal ini harus dikoreksi. Pasalnya kebobrokan hasil rekapitulasi data biasanya terjadi pada tingkat Panitia Pemilihan Kecamatan(PPK).Inidikuatkanolehbeberapa kasus sengketa Pemilu di MK—selalu saja penggelembungan suara terjadi di PPK. Saksi hanya memantau hingga hasil rekapitulasi di TPS selesai. Jadi, tidak ada korelasi serius terkait bersihnya Pemilu dengan saksi yang bertugas di TPS. Parpol Bernurani GeliatParpolmenjelangPemiluyangterus melancarkan manuver politik, tentu akan mengambil kesempatan menaikan citra politik dan mengharapkan elektabilitas yang surplus pada Pemilu mendatang. Dua Parpol yang menolak dana saksi tersebut, yakni PDI-

P dan Nasdem mungkin bertujuan menaikan popularitas Parpolnya menjelang Pemilu. Namun langkah yang mereka ambil di lain sisi memiliki makna yang lebih berani dari Parpol lain untuk berani menolak dana saksi yang diberikan APBN. Sulit memang menemukan Parpol bernurani dengan kualitas demokrasi yang masih tertatih di negeri ini. Usulan dana saksi Parpol untuk Pemilu yang diambil dari APBN sebenarnya diusulkan oleh partai politik pada Menkopolhukam. Namun partai mana saja yang mengusulkannya tidak diketahui rimbanya. Hal ini berdasarkan keterangan dari ketua Bawaslu sendiri yang mengatakan bahwa “pertama kali yang mengusulkan adalah Menkopolhukam berdasaarkan masukan dari partai politik”. Kini partai pengusul tersebut tidak pernah tampildandenganberanimengatakanbahwa mereka yang mengusulkan dana saksi ini. Terakhir beberapa partai coba “cuci tangan” dengan mengatakan bahwa mereka tidak setuju selama tidak ada kejelasan prosedur pemberian dana tersebut. Mungkin rakyat bisa dengan bijak memilih dan menilai partai mana yang memiliki nurani dan partai tak bernurani. Sudah dapat sumberdana keuangan dari APBN, kini dana saksi juga minta dari APBN.Wajar jika demokrasi biaya tinggi terjadi. Ini masih pemilihan legislatif, belum lagi pemilihan presiden. Jadi APBN jebol tahun ini salah satunya adalah pembiayaan demokrasi limatahunan yang teramat mahal.

Penulis adalah Dosen Fakultas Hukum Universitas Pembangunan Panca Budi Medan.




06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 terkini 11:03 Lanjutan FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:00 Liputan 6 Terkini 16:03 Lanjutan Eat Bulaga indonesia 16:30 SL Liputan 6 Petang 17:00 Bidadari-Bidadari Surga 18:15 Si Cemong 19:45 Cinta yang Sama 21:00 Emak Ijah Pengen Ke Mekah 22:30 SCTV FTV Utama

07:00 Kisah Unggulan 08:30 Pose 09:00 Layar Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Top Pop 15:00 Lintas Petang 15:30 Animasi Spesial 16:30 Tuntas 17:00 Biru 18:10 Juna Cinta Juni 19:10 Cinta Itu Anugerah 20:20 Gajah Mada 21:20 Raden Kian Santang 23:00 Suka-suka Uya 00:30 Lintas Malam 01:00 Sidik

07:30 Hati Ke Hati Bersama Mamah Dedeh 08:00 Seleb @ Seleb 08:30 Scooby DooWhere AreYou 09:00 Curious George 09:30 Marsha & The Bear 10:00 Fenomania Hits 11:00 Ngobrol Asik 11:30 New Friends 12:00 Topik Siang 13:00 Seputar Obrolan Selebriti 14:00 Tom & Jerry 14:30 Bima Sakti 15:00 Curious George 15:30 Mr. Bean 16:00 Angry Birds Toon 16:30 Topik Petang 19:30 Pesbukers 20:30 Campur-Campur 21:30 RT Sukowi 23:55 Sinema Spesial

08:30 Sinema Pagi 10:30 KISS Pagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Drama Korea Sore: Jewel In The Palace 16:30 Drama Korea Sore: Full House Take 2 18:00 Drama Seri Indonesia: Aku BUkan Anak Haram 19:00 Sinema Indonesia: Si Buta Dari Lembah Hantu 20:00 Sinetron Unggulan: DamarWulan 21:00 Take Me Out Indonesia 23:00 One FC

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 12:05 Road To Eagle Awards 2013 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 20:30 Healthy Living 21:05 Top 9 News 21:30 Mata Najwa 2 2 : 3 0 S t a n d Up Comedy Show 23:05 Realitas

WASPADA Kamis 6 Februari 2014

07:30 YKS Best Moment 08:30 Sinema Spesial Liburan 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:30 Show Imah 16:30 Reportase Sore 17:00 Sinema Indonesia Sore 19:00 Oh Ternyata 20:00 YKS 22:30 Bioskop TransTV 00:30 Harta Tahta Wanita 01:00 Reportase Malam

07:00 Apa Kabar Indonesia Pagi 09:00 Tempo Hari 09:30 Kabar Pasar 10:00 Coffee Break 11:30 Kabar Siang 13:00 Kabar Haji 2013 13:30 Ruang Kita 14:30 Kabar Pasar 15:00 Coffee Break Sore 15:30 Kabar Pemilu 16:00 Menyingkap Tabir 16:30 Sorotan Kasus 17:00 Kabar Petang 19:30 Indonesia Lawyers Club 22:30 Kabar Malam 23:30 Kabar Hari Ini

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Spongebob Squarepants 07:30 The Penguins Of Madagascar 08:00 Thomas and Friends 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Seleb On Cam 13:00 Super Hero Kocak 14:00 Unix14:30 Fokus Selebriti 15:00 Awas Ada Sule 16:00 Canda Lucu Bikin Ketawa 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:30 Big Movies

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Ga Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Laptop Si Unyil 13:00 Si Bolang 13:30 Dunia Binatang 14:00 Tau Gak Sih 14:30 Brownies 15:00 Jejak Petualang 15:30 Redaksi Sore 16:30 Indonesiaku 17:00 Orang Pinggiran 18:00 On The Spot 19:00 Opera Van Java 21:00 Hitam Putih 22:00 Bukan Empat Mata 23:30 Dua Dunia **m31/G

Film 7 Misi Rahasia Sophie :

Tularkan Aura Positif Kebaikan Via Sosial Media FENOMENA keranjingan para remaja saat ini berselancar di dunia maya termasuk mengunggah video di media sosial – Youtube, selain mencuatkan imej negatif yakni membuang waktu percuma juga terkesan Narsis Abis juga Egosentris. Tapi, lewat film 7 Misi Rahasia Sophie, produser Starvisionplus – Chand Parwez Servia dan Sutradara Billy Christian, justru ingin menyuguhkan kisah sebaliknya, Bahkan lewat tokoh utamanya Sophie diperankan aktris masa depan- Alisia Rininta mereka mencoba menularkan aura positif kebaikan via sosial media. Yakni memotret fenomena remaja era sosial media lengkap dengan lingkungan dan keluarga mereka

“Film ini mengisahkan seorang gadis ceria nan kenes yang peduli sesama, berjiwa humanis dan menjadikan sosial media untuk kepentingan orang lain. Bukan semata-mata untuk eksis apalagi penganut aliran Narsisius alias narsis abis,” papar Chand Parwes Servia selepas preview film 7 Misi Rahasia Sophie (7 MRS) di Epicentrum Jakarta Selatan, Senin (3/2) petang. Billy Chirsian – sang sutradara menambahkan, didukung lokasi syuting di apartemen Sophie dan Marko (StefanWilliam) sebagai set utama - film ini berhasil memotret kehidupan masyarakat kota besar yang individualistis dan dingin. Lengkap dengan gambaran orang-orang curhat di sosial

media, mengunggah foto atau video hingga terlihat jelas apa yang mereka lakukan, terbaca dengan gamblang, nyaris tanpa rahasia. “Tapi, aktivitas Sophie dalam dunia maya sepertiYoutube dan Twitter dijamin berbeda. Satu demi satu kebaikan-kebaikan kecil jelang ajal menjemput karena penyakit Kanker Pankreas untuk orang lain terkuak. Bantuan kecil Sophie pada seseorang saat mengalami bagian terberat dalam hidupnya menjadi sangat berarti semoga menjadi insprirasi banyak orang yang nonton film ini,” harap Billy – sutradara yang mengorbit lewat proyek Omnibus film Thriller Hi5teria.

Perbedaan Film 7 MRS diputar serentak di bioskop seluruh Indonesia mulai 6 Februari 2014 antra lain juga dibintangi Pamela Bowie (Imel), Bucek Deep dan Wulan Guritno (orangtua Sophie), Roewina Sahertian (ibu Marko), Gary Ishak (Ayah Marko), Ambar Soedarno (Oma) plus Khansa Athaya dan Marsha Beby Clarissa (Adik Sophie), dibuka dengan gambaran keseharian Sophie mencoba eksis di dunia maya dengan mengunggah tips-tips ringan mulai dari cara berdandan hingga memilih aksesoris. Sophie yang ceria punya sahabat satu apartemen yang dingin dan tertutup bernama Marko yang akrab disapa Komar . Sophie berkepribadian ha-

ngat dan berasal dari keluarga harmonis dan tinggal bersama Papa-Mamanya serta dua adik perempuannya . Sedangkan Marko yang dingin dan tertutup, tinggal berdua dengan Mamanya (Roewina Sahertian), yang bercerai dengan sang Papa. Perbedaan latar belakang ini malah membuat Sophie dan Marko menjadi dekat. Marko suka meledek, Sophie serta orang-orang yang eksis di dunia maya sebagai orang yang egois dan narsis. Karena apa pun yang mereka pikirkan – cuma soal diri masing-masing. Hal ini membuat Sophie gusar. Suatu hari Marko kabur dari rumah karena tak diizinkan berlibur ke Thailand. Selama dua mingguan, ia berada di villa pu-

ncak dan sama sekali tak bisa dihubungi Sophie. Padahal sebelumnya, Sophie sempat beranggapan kalau Marko kabur karena dirinya. Sekebali Marko, Sophie lalu mengajaknya melakukan 7 Misi Rahasia bersama. Lewat misi itu, Sophie ingin membantah kalau orang yang mengunggah video mereka ke youtube adalah orang yang egois atau narsis. Sayangnya, ketika semua misi rahasia terwujud - akibat penyakit Kanker Pankreas akut, Sophie“pindah” ke planet lain dan tak bisa ditemui lagi. Sebagai gantinya sekaligus jawaban misi rahasia ketujuh, Sophie ternyata ingin pula membahagiakan Imel dengan mendekatkan sahabatnya sama Marko yang masih jomblo. * (AgusT)

Sinema Bollywood Satu Abad

JK Rowling:

He r m i o n e S e h a r u s n y a Menikahi Harry Potter RonWeasley dan Hermione Granger menikah dalam penutup kisah Harry Potter, tapi kini sang penulis JK Rowling mengaku salah. Menurut Rowling, Her-

mione lebih baik menikah dengan Harry Potter. Rowling mengemukakan hal itu dalam komentar dimuat di harian Inggris Sunday Times.

Rahasia BCL Awet Dengan Ashraf Penyanyi dan aktris Bunga Citra Lestari atau akrab disapa BCL memiliki cara agar hubungannya dengan sang suami, Ashraf Sinclair, selalu terjaga. Menurut BCL, dia selalu membangkitkan getaran cinta dengan suaminya. “Aku dan Ashraf berusaha terus untuk jatuh cinta. Misalkan dengan dengar lagu-lagu kesukaan bersama,” katanya dalam acara diselenggarakan salah satu produk kecantikan, di Jakarta, Selasa. Tak hanya itu, BCL juga menjaga penampilan agar tetap mempesona di hadapan suami adalah hal yang tak boleh dikesampingkan.“Setelah menikah bukan berarti saya mengesampingkan penampilan saat di rumah. Tampil mempesona di depan suami membuat dia semakin dekat dan tidak dapat berpaling dari rumah,” ujar BCL. Cara lainnya ialah melakukan hal-hal yang menyenangkan di sela-sela rutinitas seperti sarapan bersama. Hal lain dilakukan BCL ialah berusaha memberikan waktu khusus untuk berdua dengan Ashraf. “Mengurus anak yang baru berusia tiga tahun seperti Noah memang bukan hal yang mudah...Tapi bukan berarti aku melupakan waktu berdua dengan suamiku,” katanya. Ia pun mengaku kerap mengatur date night dengan Ashraf misalkan menonton film di bioskop dan konser bersama.(ant)

Bahkan, Rowling membayangkan nantinya pernikahan Ron dan Hermione bermasalah dan mereka terpaksa mendatangi konseling suami-istri. “Saya membuat Hermione menikah dengan Ron karena keterikatan saya akan alur cerita saat pertama kali membayangkannya, jadi bukan karena alasan sastra,” kata JK Rowling dalam wawancara dengan majalah Wonderland, yang petikannya dilansir Sunday Times. “Saya tahu, banyak fans yang marah atas hal ini, saya minta maaf, sejujurnya karena saya punya jarak dengan cerita ini, saya punya sudut pandang sendiri. Akhir cerita itu saya putuskan atas dasar alasan sangat pribadi, bukan demi kredibilitas,” katanya. “Semoga orang tidak kecewa karena saya berkata begini.” Emma Watson memerankan Hermione adalah pewawancara JK Rowling dalam majalah Wonderland. Emma sependapat dengan JK Rowling dan mengatakan; “Saya rasa para fans tahu tentang itu dan mereka juga sebenarnya bertanya-tanya apakah Ron bisa membahagiakan Hermione.”(ant)

Sinema India genap berusia satu abad. Film Bollywood pertama berjudul Raja Harischandra diproduksi dan dirilis di India akhir tahun 1913, setahun setelah dirilisnya film motion picture perdana dibuat tahun 1912. Dengan terbitnya film itu, suratkabar terkemuka India, The Times of India menulis, “abad ini sebagai menakjubkan bagi perfilman India. Sinema bakalan berkembang di India dan pada waktu yang bersamaan perfilman juga bakalan maju di barat ,” tulis esayis Mukul Kesavan Meskipun produser film India banyak memproduksi film Bollywood setiap tahunnya, namun para produsen tetap mengutamakan kualitas film yang dirilisnya. Sekitar 130 film diluncurkan Bollywood di tahun 2011. Ditambah lagi film produksi Telugu, Tamil, Malayam, Kannada, Marathi, Bengali, Punjabi, Bhojpuri, Assamese, Gujrati Oddisa dan negara-negara bagian timur laut India menghasilkan hampir seribu produksi film. Industri film India sangat membanggakan masyarakat negeri itu karena semua yang berkaitan dengan entertaimen, musik atau fashion tergabung dalam satu produksi sinema Bollywood. Dari rancangan busana dan perlengkapan lainnya, referensi harian, bisnis, politik , tujuan pariwisata, kekerasan, seksualitas, superhero , tarian dan ikon semuanya tergabung dalam alur cerita film Bollywo-

od. Industri film berbasis di Mumbai dinamai Bollywood tidak jarang menjadi pusat style dan fashion kaum muda India. G Venket Ram, seorang profesional gaya dan film mengatakan perpaduan antara film, fashion dan tren sosial tak pernah lepas dari produksi film Bollywood. Industri musik juga berkembang sejalan dengan majunya sinema India. Cerita film Bollywood juga mengikuti perkembangan zaman dan masalah apa yang terjadi pada zaman itu. Mengikuti momen kemerdekaan negara itu sekitar tahun 1930-an dan 1940-an, produksi film-film Bollywood banyak mengambil tema politik, paham sosialis, kritikan dan usaha-usaha memerangi kemiskinan. Pada tahun 1960-an, tema-tema film Bollywood menonjolkan cerita kekayaan dan kejahatan versus kemiskinan dan kebaikan serta orang desa yang baik lawan orang kota yang jahat. Pada tahun 1970-an dan 1980-an merajalela sindrom megastar bintang-bintang Bollywood seperti aktor Rajesh Khanna, Amitabh Bachchan dari Bollywood, MGR, Sivaji Ganesan, Rajnikanth, NT Rama Rao, Raj Kumar dari selatan India serta Uttam Kumar, Prosenjit Chatterjee dari Bengali. Selebriti India itu menjadi superstar pujaan penggemar film India. Film Bollywood pada awal abad 21 ini disebut-sebut sebagai film yang diarahkan orang-

orang luar atau istilahnya outsiders. Istilah ini muncul karena aktor, produser dan sutradara film-film Bollywood sekarang tidak berasal dari keluarga orang-orang film. Dulunya, kebanyakan orang-orang yang terlibat di dunia perfilman memang keluarga atau sahabat terdekat dari produser, sutradara atau aktris Bollywood. Nama-nama seperti Vishal Bhardwaj, Anurag Kashyap, Dibakar Banerjee, Sujoy Ghosh, Tigmanshu Dhulia, and Vik-ramaditya Motwane adalah produsen film berongkos murah, namun karya mereka mampu menembus pasaran film global. Film-film mereka juga masuk dalam festival film Cannes dan Toronto. Syuting film Bollywood sekarang ini tidak hanya berlangsung di India atau negara tetangganya saja, bahkan sampai ke Amerika dan negaranegara Eropa. Produser cewek seperti Reema Kagti, Zoya Akhtar dari Hindi dan Aparna Sen dari Bengali, Revathi dari Tamil mempopulerkan penyanyi-penyanyi cewek India bersuara emas. Saat ini pelataran film Bollywood diramaikan sederetan aktor ganteng dan aktris cantik populer seperti Shah Rukh Khan, Salman Khan, Aamir Khan, Akshya Kumar, Abhisek Bachan, Saif Ali Khan dan Ajay Devgn. Sementara aktrisnya termasuk Kajol, Kareena Kapoor, Katrina Kaif, Priyanka Chopra, Madhuri Dixit, Deepika Padukone, Kangana Ranaut dan Shilpa Shetty.

Shah Rukh Khan salah seorang bintang pujaan Bollywood/ Dari film bisu sampai film yang bisa ngomong. Dari film hitam putih sampai film berwarna dan dari sinemaskop sampai yang sudah memakai peralatan canggih dalam produksi film, yang jelas film Bollywood mam-

pu bertahan sampai kini bahkan makin maju. Film Bollywood yang kaya tarian dan nyanyian tidak hanya disaksikan penonton domestik masyarakat India saja, tapi sudah go internasional. Aljazeera/Nur

Slank Ke Ruang Kerja Jokowi-Ahok


Ada yang berbeda dengan penampilan dua personel Slank, Kaka dan Bimbim, tampak lebih rapi Selasa petang. Pasalnya, mereka menemui Gubernur DKI Jakarta Joko Widodo (Jokowi) dan wagubnya Basuki Tjahaja Purnama (Ahok) di ruang kerja masing-masing. “Tadi habis ke Pak Ahok, sekarang mau ke Pak Jokowi mau undang beliau ke Indonesia Baru,” kata Bimbim terburu-buru saat memasuki kantor Jokowi di Balaikota, Senin Bimbim dan Kaka datang ke Balaikota dengan gaya rapih. Bimbim mengenakan celana jin, kaus putih, dan jaket kulit warna hitam. Adapun Kaka, yang datang belakangan mengenakan celana jin dan kemeja kotak-kotak berwarna merah kegelapan. Indonesia Baru merupakan sebuah acara talk show dibawakan para personel Slank yang membahas politik secara santai sekaligus kritis.(ant)


B10 Nelayan Keluhkan Fasilitas Pelabuhan BANDA ACEH (Waspada): Wakil Gubernur Aceh Muzakir Manaf, Rabu (5/2) menyempatkan diri melakukan dialog langsung dengan nelayan di Pelabuhan perikanan Lampulo, Banda Aceh. Dialog yang difasilitasi Dinas Kelautan dan Perikanan Aceh tersebut berlangsung secara interaktif. Di hadapan Mualem, sapaan akrab Wagub Aceh, sejumlah nelayan mengeluhkan persoalan minimnya fasilitas di pelabuhan Lampulo yang baru diresmikan itu, sedangkan pelabuhan itu disebutkan sudah berstandar internasional, tapi di lapangan masih ditemukan sejumlah persoalan. Nelayan menyebutkan, persoalan yang dihadapi terutama soal infrastruktur jalan yang belum diaspal dan berdebu, kemudian sanitasi, instalasi listrik, dan belum tersedianya stasiun pengisian bahan bakar nelayan (SPBN) untuk kapal dan boat nelayan. “Kami berharap, agar Pemprov Aceh segera memperbaiki kekurangan yang ada di pelabuhan Lampulo yang baru ini sehingga aktivitas nelayan bisa lancar dan tidak ada hambatan,” harap nelayan kepada wagub. Wakil Gubernur Aceh enegaskan komitmennya dalam pengembangan Lampulo dan menjadikan pelabuhan tersebut berstandar internasional. “Infrastruktur jalan menuju lokasi pelabuhan tahun ini akan tuntas,” kata Mualem. Menyangkut persoalan SPBN, Wagub menerangkan bahwa hal inj telah dibicarakan dengan pihak Pertamina, dan ditargetkan juga hal ini dapat direalisasikan dalam waktu dekat. (cb01)

DPW SPA Subulussalam Galang Dana Sinabung SUBULUSSALAM (Waspada): Peduli bencana Gunung Sinabung, Kab. Karo, Sumut, jajaran Dewan PimpinanWilayah (DPW) Serikat Pekerja Aceh (SPA) Subulussalam menggalang dana kemanusiaan. Titik penggalangan, berpusat di Jalan Teuku Umar Desa Penanggalan, Kecamatan Penanggalan, Subulussalam, juga didukung pihak lain. Tampak antusias para pengendara yang melintas memberikan sumbangan melalui kotak yang disediakan petugas terkait bertuliskan ‘Peduli Bencana Alam Sinabung’. Di sela-sela mengkoordinir segenap anggota untuk keperluan terkait, Selasa (5/2), Amransyah Putra Brutu, Ketua Umum DPW SPA itu menjelaskan, hal terpenting yang melatarbelakangi gerakan penggalangan semata-mata faktor kemanusiaan. “Bersama kawan-kawan DPW SPA, kami sepakat memberi bantuan bagi masyarakat Kabupaten Karo yang terkena erupsi Gunung Sinabung melalui gerakan penggalangan dana, kami juga berharap partisipasi masyarakat,” tutur Amran. (b28)

Konser Solo Rafli Kande Di Subulussalam SUBULUSSALAM (Waspada): Konser solo Rafli Kande, penyanyi Aceh mengundang antusias warga Kota Subulussalam. Ribuan warga memadati Lapangan Beringin Subulussalam, saat sang idola tampil, Minggu (2/2) malam. Konser Rafli di bumi Sada Kata Subulussalam itu dikemas dalam ‘konser syiar dan syair damai bersama Rafli Kande’, sekaligus rangkaian silaturahmi sang idola yang menjadi calon anggota DPD-RI asal pemilihan Aceh. Tampil dengan pakaian serba putih pada konser sekira dua jam itu, sekali-kali Rafli menyampaikan tausiyah. Tampak hadir sejumlah Calon Anggota Anggota Legislatif (Caleg) DPRK Subulussalam, seperti Fajri Munthe, Safran Kombih dan SyafiadiDilaporkan panitia, konser Rafli juga digelar di sejumlah kabupaten/kota se-Aceh. (b28)

WASPADA Kamis 6 Februari 2014

Berbusana Ketat, Puluhan Mahasiswi Terjaring Razia BANDA ACEH (Waspada): Puluhan mahasiswi dan remaja putra terjaring dalam razia yang digelar petugas Satpol PP dan Wilayatul Hisbah di Jalan T Nyak Arief Banda Aceh, Rabu (5/2). Mereka dinilai melanggar peraturan daerah atau qanun Nomor 11 Tahun 2002 tentang Aqidah, Ibadah dan Syi’ar Islam. PantauanWaspada, mereka yang terjaring dalam razia

tepatnya di kawasan Simpang Mesra itu didata petugas kemudian diberi pengarahan agar menggunakan busana sesuai Syariat Islam. Usai diberi pengarahan, seluruh pelanggar yang umumnya pengendara roda dua, diperkenankan melanjutkan perjalanan. Kasi Penegakan dan Penindakan Satpol PP dan WH Aceh, Samsuddin mengatakan, sebanyak 60 orang terjaring dalam razia yang dimulai sekira pukul 10:00 tersebut. Selain petugas Satpol PP dan WH, razia juga melibatkan personel kepolisian. “Razia akan terus kami

lakukan agar kesadaran warga di Kota Banda Aceh ini dalam berpakaian semaki baik. Ada 60 pelanggar yang terjaring,” ujar Samsuddin. Menurut dia, meski belum sepenuhnya meningkat, namun gencarnya razia serta sosialisasi tentang qanun tersebut membuat jumlah pelanggar terus menurun. Sebelumnya dalam setiap razia, pihaknya menjaring pelanggar hingga ratusan, namun kini hanya puluhan orang. “Tujuan kami hanya menertibkan para pemakai busana ketat dan tidak Islami sebagaimana yang dianjurkan dalam Islam,” paparnya. (cb06)

Bupati Ajak Masyarakat Jaga Fasilitas Agama JULOK (Waspada): Bupati Aceh Timur Hasballah M Thaib mengajak seluruh masyarakat untuk menjaga fasilitas agama yang sudah dibangun agar bisa bermanfaat kepada para generasi di masa mendatang. “Untuk itu, seluruh masyarakat agar seimbang bahu seayun langkah agar tetap bekerjasama di dalam memaju-

kan dan membangun dayah ini agar ke depan mutu pendidikan agama bagi generasi kita dapat lebih baik dan bisa berguna bagi kita semua,” ungkap Bupati Aceh Timur, Hasballah Bin M Thaib ketika meresmikan Dayah Bustanud Dhuha yang merupakan cabang dari Dayah Bustanul Huda di Gampong Cek Doi dan Paya Pasi, Aceh Timur,

Rabu (5/2). Dikatakan, dari dayah tersebut nantinya diharapkan kelak akan lahir generasi penerus yang islami, memahami agama yang berbangsa dan berakhlatul qarimah, sebab dengan lahirnya dayah ini sekaligus memjadi momentum untuk mencerdaskan kehidupan anak bangsa. (cri)

200 Pemuda Aceh Ikut Pelatihan Konstruksi BANDA ACEH (Waspada): Wakil Gubernur Aceh Muzakir Manaf membuka pelatihan pelaksana lapangan pekerjaan jalan jembatan dan pelatihan tukang bidang konstruksi tingkat pemula se-Aceh, di Balai Pelatihan Konstruksi Wilayah I Aceh, Banda Aceh. Ketua pelaksana, Eddy Irwanto mengatakan, pelatihan yang diprakarsai Balai Pelatihan Konstruksi Wilayah I Banda Aceh dan bekerja sama dengan DPD I KNPI Aceh tersebut berlangsung 3 hingga 27 Februari 2014. Dijelaskan Eddy, pelatihan bertahap yang diikuti oleh 200

pemuda asal Aceh ini dilaksanakan atas program Pusat Pembinaan Kompetensi dan pelatihan Konstruksi Badan Pembinaan Konstruksi Kementerian Pekerjaan Umum Republik Indonesia. Kepala Badan Pelatihan Konstruksi Wilayah I Banda Aceh, Sutjipto menambahkan, pelatihan ini merupakan persiapan dalam menyongsong Asean Community, yaitu mempersiapkan tenaga kerja yang memiliki kompetensi dan sertifikasi sesuai dengan bidang yang dimiliki. Ketua DPD I KNPI Aceh, Jamaluddin Jamil, menyebut-

kan, pertumbuhan tenaga kerja di bidang konstruksi tingkat nasional maupun regional sangat signifikan, namun jika dikaitkan dengan kualifikasi tenaga konstruksi di Aceh hanya sebagian kecilyangmemilikiketeram-pilan yang dilegitimasi dengan sertifikasi, sesuai UU No 18 tahun 1999 tentang jasa konstruksi. Sementara Wakil Gubernur Aceh Muzakir Manaf yang membuka pelatihan itu berharap dengan program pelatihan tersebut masalah kekurangan tenaga terampil di bidang konstruksi yang selama ini dihadapi Aceh, segera teratasi dengan baik. (b06)

Waspada/Muhammad Hanafiah

MANEJER PT.Rapala Wilayah Kerja Kabupaten Aceh Tamiang berpose bersama dengan unsur muspika, tokoh masyarakat dan sejumlah anak yatim setelah penyerahan santunan yang berlangsung di Masjid Mistahul Jannah, Desa Paya Rehat,Kecamatan Banda Mulia, kab.Aceh Tamiang, Jum’at (31/1).

Rapala Bantu Tiga Masjid Dan Santuni Anak Yatim Di Aceh Tamiang KUALASIMPANG ( Waspada): PT.Rapala melaksanakan kegiatan bakti sosial membantu biaya pembangunan tiga masjid dan memberikan santunan untuk anak yatim di tiga Kecamatan dalam wilayah Aceh Tamiang yang ada di sekitar lokasi perusahaan perkebunan kelapa sawit tersebut.Acara berlangsung di Masjid Mistahul Jannah,Paya Rehat,Kec.Banda Mulia,Kab.Aceh Tamiang,Jum’at (31/1) Camat Bendahara,Ibnu Hajar pada kesempatan dalam sambutannya mengucapkan terima kasih kepada PT.Rapala yang sudah memberikan bantuan untuk masjid dan menyantuni anak yatim . Semoga saja ini bukan yang terakhir ,namun diharapkan pada masa mendatang perusahaan ini supaya dapat memberikan bantuan yang lebih banyak lagi untuk masjid dan anak yatim di tiga kecamatan seputaran perusahaan PT.Rapala. Manager PT.Rapala Wilayah Kabupaten Aceh Tamiang ,H.TR.Safrul Syahputra pada kesempatan tersebut menyatakan pihaknya yang membuka usaha perkebunan di Aceh Tamiang tetap mempunyai kepedulian sosial terhadap masyarakat di sekitar lokasi perusahaan perkebunan kelapa sawit yang di kelola oleh

PT.Rapala. “ Bantuan dan santunan yang kami berikan merupakan untuk menjalin hubungan yang harmonis antara masyarakat dengan pihak perusahaan Rapala di Tiga Kecamatan yaitu Kecamatan Banda Mulia, Bendahara dan Seruway,” katanya. Safrul juga menyatakan bantuan diberikan pihaknya kepada Panitia pembangunan masjid Mistahul Jannah ( Paya Rehat), Masjid Baitulrahman ( Marlempang) , Masjid Baitulrahman ( Gelung) masing-masing masjid diberikan uang bantuan sebesar Rp15 juta , santunan bagi anak yatim yang ada di Desa Paya Rehat, Marlempang dan Gelung juga diberikan uang yang diserahkan pihak perusahaan secara simbolis kepada tiga Datok Penghulu atau yang mewakili Datong Penghulu yang mewakili Kampung tersebut yang selanjutnya nanti menyerahkan santunan kepada anak yatim yang ada di tiga Kampung itu. Acara tersebut,selain dihadiri oleh utusan PT.Rapalajuga turutdihadiriunsurMuspikasetempat, pengurus ke tiga masjid,tokoh masyarakat Paya Rehat, Tgk.Armia,Mantan Panglima GAM Wilayah Tamiang, Tgk.Helmi Ahmad,sejumlah anak yatim dan undangan lainnya.(b23)

Masa Kepemimpinan Bupati H. Hamdan Sati, ST Dan Wabup Drs. Iskandar Zulkarnain, MAP

Pengembangan PATEN Di Kabupaten Aceh Tamiang PENINGKATAN kualitas pelayanan publik merupakan agenda Pemerintah Kabupaten Aceh Tamiang Periode Tahun 2012-2017 di bawah kepemimpinan Bupati H. Hamdan Sati, ST dan Wakil Bupati Drs. Iskandar Zulkarnain, MAP, sebagai implementasi salah satu dari tujuh program prioritas pemerintah dalam mewujudkan Reformasi Birokrasi sebagai sarana pencapaian Misi meningkatkan tata kelola pemerintahan yang amanah berbasis Good Governance. Menurut Bupati Aceh Tamiang, H. Hamdan Sati, ST, salah satu tuntutan masyarakat yang sekarang dihadapi adalah peningkatan kualitas pelayanan publik. Hal tersebut sudah sewajarnya, karena salah satu tugas pemerintah adalah memberikan pelayanan kepada masyarakat melalui peningkatan kualitas dan mutu pelayanan secara efektif, efesien, melayani dan berdaya saing. Kecamatan sebagai unsur pelayanan terdepan dan cermin dari Pemerintah Kabupaten harus benar-benar dapat menangkap dimensi tuntutan masyarakat ini, karena bila pelayanan di kecamatan buruk, maka persepsi yang muncul dimasyarakat pelayanan Pemerintah Kabupaten juga buruk. Oleh karena itu, perlu dilakukan perbaikan-perbaikan dan pembenahan-pembenahan terhadap kualitas dan mutu pelayanan di Kecamatan sehingga dapat terwujudnya Pelayanan Prima (Excelent service) bagi masyarakat, ujar Bupati. Menurut Bupati lagi, sebagai langkah awal perbaikan sistem pelayanan di kecamatan, telah kami instruksikan kepada seluruh Camat untuk mempercepat peningkatan kualitas pelayanan kecamatan melalui Instruksi Bupati Aceh Tamiang Nomor 8030 Tahun 2013 tentang Percepatan Peningkatan Kualitas Pelayanan Administrasi Terpadu Kecamatan (PATEN). Namun, kata Bupati, pihaknya juga menyadari bahwa peningkatan kualitas pelayanan tentu juga harus dibarengi dengan ketersediaan dukungan anggaran, personil dan kualitas SDM yang memadai. Mengantisipasi hal tersebut, Bupati Aceh Tamiang telah menyusun Rencana Tindak Lanjut (RTL) dengan mengalokasikan anggaran biaya bagi

Bupati H.Hamdan Sati,ST operasional dan perbaikan sarana prasarana PATEN sebesar Rp.,- (satu miliar dua ratus juta rupiah) untuk 12 (dua belas) kecamatan dan Monitoring pelaksanaan PATEN sebesar Rp. 50.000.000,- (lima puluh juta rupiah) yang dituangkan dalam APBK Aceh Tamiang Tahun 2014.

Pelayanan Prima (Excelent service) merupakan dambaan dari seluruh masyarakat, untuk itu Saya selaku Bupati Aceh Tamiang bersama Wakil Bupati Aceh Tamiang menghimbau kepada seluruh aparatur pemerintahan agar dapat memberikan pelayanan yang terbaik bagi masyarakat. Pelayanan prima harus mengedepan di bumi muda sedia kita tercinta ini, sehingga masyarakat bumi muda sedia benar-benar terlayani segala kebutuhan yang menjadi tanggung jawab Pemerintah Kabupaten Aceh Tamiang. Mari bersama melakukan perubahan (do a change) terhadap wajah pelayanan Kabupaten Aceh Tamiang. PATEN dari sudut pandang Wakil Bupati Aceh Tamiang Drs. Inskandar Zulkarnain, MAP merupakan wadah pelayanan bagi masyarakat yang berada dipelosok jauh dari pusat pelayanan.

front office bagi KP2TSP dan Pemerintah Kabupaten. Konsep tersebut akan mulai diterapkan di Kabupaten Aceh Tamiang pada tahun 2015 melalui sistem e-Government dengan membangun jaringan antara kecamatan dengan KP2TSP dan Pemerintah Kabupaten. Perencanaan pengembangan sistem e-Government telah tera-

komodir didalam Rencana Pembangunan Jangka Menengah (RPJM) Kabupaten Aceh Tamiang dan Rencana Strategik Sekretariat Daerah Kabupaten Aceh Tamiang pada tahun 2015 dengan anggaran sebesar Rp. 800.000.000,- (delapan ratus juta rupiah), namun tidak tertutup kemungkinan pengembangan sistem pelayanan dilakukan

melalui anggaran dana otonomi khusus Provinsi Aceh. Oleh karenanya Bupati Aceh Tamiang H. Hamdan Sati, ST telah memerintahkan kepada Ketua Tim TAPK Kabupaten Aceh Tamiang Ir. Razuardi,ST selaku Sekretaris Daerah) untuk mengusulkan pengembangan sistem e-Government dan pembangunan gedung pelayanan

kecamatan melalui anggaran dana otonomi khusus Provinsi Aceh pada Tahun 2015. Karena pada dasarnya perbaikan kualitas dan mutu pelayanan bukan hanya menjadi tanggung jawab Pemerintah Kabupaten, namun juga men-jadi tanggung jawab Pemerintah Provinsi dalam mewujudkan pelayanan prima bagi seluruh masyarakat Aceh.

Wakil Bupati Drs. Iskandar Zulkarnain, MAP, Dengan adanya PATEN di kecamatan, masyarakat yang membutuhkan pelayanan perizinan tidak perlu lagi harus jauh-jauh datang ke Kabupaten dengan mengeluarkan biaya yang besar. Pelayanan masyarakat cukup dilakukan di kecamatan dengan menjadikan kecamatan sebagai

Kegiatan-kegiatan Yang Dilakukan Sekretaris Daerah Kabupaten Aceh Tamiang Ir. Razuardi, ST dengan di bantu oleh Asisten Pemerintahan dan Kepala Bagian Tata Pemerintahan Setdakab Aceh Tamiang dalam menindaklanjuti Instruksi Bupati Aceh Tamiang Nomor 8030 Tahun 2013 tentang Percepatan Peningkatan Kualitas Pelayanan Administrasi Terpadu Kecamatan (PATEN), melaksanakan beberapa kegiatan antara lain: 1.Pelatihan bagi penyelenggara PATEN yang difasilitasi oleh Bagian Tata Pemerintahan Setdakab Aceh Tamiang bekerjasama dengan LOGICA 2 di Aula Bappeda Kabupaten Aceh Tamiang tanggal 21 Juli 2013. Pelatihan yang diberikan berupa pemahaman konsep dasar PATEN, sikap dan prilaku dalam pelayanan, SIM PATEN dan tata ruang pelayanan. 2.Pembinaan bagi penyelenggara PATEN yang dilakukan Asisten Pemerintahan (Drs. Rianto Waris) dan difasilitasi oleh Bagian Tata Pemerintahan Setdakab Aceh Tamiang dalam Rapat Koordinasi Penyelenggara PATEN di Ruang Rapat Bupati Aceh Tamiang tanggal 24 Desember 2013. Pembinaan yang dilakukan dalam konteks merubah mindsite aparatur pelayanan kecamatan, konsep pe-

Sekdakab Aceh Tamiang Ir. Razuardi, ST ngembangan PATEN serta arah dan tujuan peningkatan kualitas PATEN. 3.Pembinaan secara langsung yang dilakukan oleh Asisten Pemerintahan beserta Kabag Tata Pemerintahan dan Kasubbag Pembinaan Perangkat Pemerintahan Daerah di 12 (dua belas) Kecamatan dalam Kabupaten AcehTamiang. Pembinaan yang dilakukan lebih diarahkan pada konsep 3 S (Senyum, Salam dan Sapa), Pelayanan tanpa gratifikasi dan membangun jiwa melayani pada aparatur kecamatan 4.Monitoring dan Evaluasi Pelimpahan Sebagian Kewenangan Bupati kepada Camat yang dilakukan oleh Tim Monitoring dan Evaluasi berdasarkan

Keputusan Bupati Aceh Tamiang Nomor 23 Tahun 2014. Pelaksanaan monitoring di Ketuai oleh Asisten Pemerintahan yang dilakukan di 12 (dua belas) Kecamatan pelaksana PATEN pada tanggal 28 Januari 2014. Dari hasil monitoring tergambar perubahan yang sangat signifikan terhadap peningkatan kualitas pelayanan PATEN di Kecamatan, dimana berdasarkan wawancara langsung yang dilakukan oleh Ketua Tim Monitoring dengan masyarakat pengguna pelayanan (Sdr. Supriyono) di Kecamatan Rantau, yangbersangkutanmerasasangat puas atas pelayanan kecamatan yang dapat berjalan dengan cepat, petugas pelayanan melayani dengan ramah dan santun serta biaya yang transparan. Menurut Sekretaris Daerah Kabupaten Aceh Tamiang (Ir. Razuardi, ST), kedepan perbaikan sistem pelayanan tidak saja dilakukan di kecamatan akan tetapi juga pada semua level pemerintahan, termasuk pelayanan di pemerintahan kampung agar reformasi birokrasi Pemerintahan Kabupaten Aceh Tamiang dapat berjalan dengan optimal sesuai dengan visi dan misi Pemerintah Kabupaten Aceh Tamiang Periode Tahun 2012-2017.

GUBERNUR Aceh, Dr.Zaini Abdullah memberikan penghargaan kepada Bupati Aceh Tamiang, H.Hamdan Sati,ST .

Penghargaan Yang Diterima Di masa kepemimpinan Bupati H. Hamdan Sati, ST dan Wakil Bupati Drs. Inskandar Zulkarnain, MAP, PATEN Kabupaten Aceh Tamiang berkembang dengan sangat pesat dan mendapatkan beberapa penghargaan antara lain: 1.Penghargaan yang diberikan oleh Dirjen PUM Kementerian Dalam Negeri pada acara Rapat Koordinasi Nasional Bidang Peme-rintahan Umum dalam rangka Penerapan Kebijakan Pelayanan Administrasi Terpadu Kecamatan yang dilaksanakan di Hotel Lumire Jakarta tanggal 24 November 2013, sekaligus ditetapkannya Kabupaten Aceh Tamiang sebagai Pilot Projek Pelaksanaan PATEN. 2.Penghargaan yang diberikan oleh Gubernur Aceh (Dr. Zaini Abdullah) kepada Pemerintah Kabupaten Aceh Tamiang dalam Rapat Koordinasi PATEN se Provinsi Aceh yang dilaksanakan

di Aula Bappeda Aceh tanggal 16 Desember 2013 sekaligus penyerahan DIPA Tahun 2014. 3.Penghargaan yang diberikan oleh DFAT kepada Pemerintah Kabupaten Aceh Tamiang diwakili oleh Asisten Pemerintahan pada Rapat Project Coordinating Commite (PCC) Meeting LOGICA Ke-7 di Hotel Oasis Banda Aceh Tanggal 22 Januari 2014, dimana dalam rapat tersebut Kecamatan Karang Baru menjadi yang terbaik dalam pelaksanaan PATEN se Provinsi Aceh. Penghargaan yang diterima oleh Pemerintah Kabupaten Aceh Tamiang, merupakan buah hasil dari komitmen bersama Bupati danWakil Bupati beserta jajaran Pemerintahan Kabupaten Aceh Tamiang dalam merubah penampilan pelayanan di Kecamatan. Pariwara

Ekonomi & Bisnis

WASPADA Kamis, 6 Februari 2014


PDB Masyarakat Tahun 2013 Rp36,5 Juta JAKARTA (Waspada): Kepala Badan Pusat Statistik (BPS) Suryamin, mengatakan, Pendapatan Domestik Bruto (PDB) masyarakat Indonesia 2013 mencapai Rp 36,5 juta, dengan laju peningkatan sebesar 8,88 persen dibanding PDB per kapita tahun 2012 yang sebesar Rp 33,5 juta. “Hal ini dikarenakan meningkatnya PDB per kapita kita pada tahun lalu menjadi Rp 36,5 juta. Sedangkan di 2012 dan 2011, realisasi PDB per kapita masing-masing sebesar Rp 33,5 juta dan Rp 30,7 juta,” katanya di Kantor BPS, Jakarta, Rabu (5/2). Sepanjang 2013, PDB Indonesia tercatat Rp 9.084 triliun Atas Dasar Harga Berlaku (ADHB). Sedangkan PDB Atas Dasar Harga Konstan (tahun 2000) adalah Rp 2.770,3 triliun. Untuk kuartal-IV 2013 sendiri PDB ADHB sebesar Rp 2.367,9 triliun, dan ADHK sebesar Rp 699,9 triliun. Angka ini naik dibanding kuartal-IV 2012, di mana PDB ADHB sebesar Rp 2.092,4 triliun dan ADHK sebesar Rp 662,1 triliun. Suryamin, menyampaikan, kenaikan PDB ini menyumbang peningkatan pendapatan per

kapita. Namun, jika diukur dengan dollar AS, maka PDB terlihat mengalami penurunan. “Memang ada penurunan kalau dihitung pakai dollar AS, karena ada pelemahan nilai tukar rupiah,” jelas Suryamin. Sepanjang 2013, PDB per kapita orang Indonesia sebesar 3.499,9 dollar AS. Sedangkan pada 2012 mencapai 3.583,2 dollar AS, dan pada 2011 sebesar 3.525,2 dollar AS. Di sisi lain, Produk Nasional Bruto (PNB) AHDB pada 2013 sebesar 3.391,6 dollar AS atau Rp 35,4 juta. Angka ini naik 8,72 persen dibanding realisasi 2012 yang sebesar Rp 32,5 juta. BPS mencatat, terjadi pertumbuhan di semua sektor. Ada tiga sektor sumber terbesar pertumbuhan ekonomi 2013 ada pada sektor industri pengolahan, sektor perdagangan, hotel, dan restoran, serta sektor pengangkutan dan komunikasi. Menurutnya, laju pertumbuhan industri pengolahan sepanjang 2013 mencapai 5,56 persen, dengan nilai Rp 707,5 triliun. Sementara itu, laju pertumbuhan sektor perdagangan, hotel dan restoran mencapai 5,93 persen, dengan nilai Rp 501,2 triliun. (j03)

Gula Impor Mulai Masuk Sumut Waspada/Surya Efendi

PERMINTAAN MENINGKAT: Seorang karyawati menyusun aneka coklat di salah satu toko di Jl. Teuku Umar Medan, Rabu (5/2). Menurut pedagang, menjelang Hari Valentine 14 Februari, pesanan coklat ini meningkat hingga 100 persen.

Dispenda Belum Mampu Hitung PAD MEDAN (Waspada): Dinas Pendapatan Daerah (Dispenda) Sumut belum mampu menghitung potensi Pendapatan Asli Daerah (PAD) dengan baik. Itulah yang kemudian membuat realisasi penerimaan PAD pada Anggaran Pendapatan dan Belanja Daerah (APBD) jauh di bawah target yang ditetapkan. Ketidakmampuan Dispenda menghitung PAD tersebut terungkap dalam rapat dengar pendapat antara Komisi C DPRD Sumut dengan jajaran Dispenda Sumut, Rabu (5/2). Rapat hari itu dipimpin oleh Ketua Komisi C, Isma Padly Pulungan, dan dihadiri Kadispenda Sumut Rajali, dan sejum-

lah staf. Adalah anggota Komisi C, Melijar Latief, mengatakan ada beberapa item dari sektor pendapatan yang pada setiap tahunnya pasti. Diantaranya Pajak Bahan Bakar Kendaraan Bermotor (PBBKB). Untuk menghitung pendapatan dari sektor ini sangat mudah. Karena dari awal transaksi, apakah dari masing-masing SPBU atau swasta yang melakukan impor sudah diketahui. Namun, menurut Melijar Latief, keanehan terjadi pada tahun 2013. Karet realiasi pajak yang ditermia sangat jauh berbeda. Dari target yang direncanakan Rp962,5 miliar, hanya terealisari Rp682,7 miliar, atau hanya 70,93 persen. ‘’Inikan aneh. Jauh sekali selisihnya,’’ kata Melijar. Hal yang sama, menurut Melijar Latief, juga terjadi pada Pajak Air Permukaan. Capaiannya pada tahun 2013 hanya 46,11 persen. Yakni dari target Rp83, miliar, hanya mampu

direalisasikan Rp38,2 miliar. Menjawab ini, Kadispenda Sumut Rajali, berdalih. Dia mengatakan terjadi perbedaan pemahaman dalam menarik Pajak Bahan Bakar Kendaraan Bermotor ini. Pemprovsu menggunkan Peraturan Daerah (Perda) dengan nilai 10 persen, sementara pihak Pertamina menggunakan Perpres, yang hanya memberikan kontribusi 5 persen. Melijar Latief, sepertinya tidak puas dengan jawaban ini. Dia menyusul dengan mempertanyakan kembali kalau sepertinya pihak Dispenda Sumut tidak jujur. Baginya, dengan penghitungan pasokan dan penggunaan Bahan Bakar Minyak (BBM) yang hampir sangat tidak mungkin berubah, namun, PBBKB yang diterima sangat jauh dari yang ditargetkan. ‘’Jujur saja. Apa ada yang terganjal?’’ kata Melijar lagi. Menjawab ini, seorang staf Dispenda Sumut Fiktor Lumbanraja, mengaku memang

sangat sulit menembus Pertamina untuk memperoleh data tentang penggunakan BBM yang sebenarnya. ‘’Karena yang memungut pajak adalah Pertamina. Mereka yang kemudian transfer ke kita (Dispenda),’’ kata Fiktor. Begitupun, ke depan, dia mengaku sangat perlu untuk melakukan pendekatan kepada Pertamina, untuk mencari tahu nilai pasti dari PBBKB ini. Sementara tentang Pajak Air Permukaan (APU), Kadispenda Sumut Rajali, mengatakan, target tidak tercapai karena ada perbedaan persepsi dengan pemerintah kabupaten dan kota. Katanya, Pemkab dan Pemko beranggapan air permukaan sama dengan air bawah tanah. Sehingga ada 102 titik Pajak Air Permukaan yang tidak bisa ditarik Dispenda. Karena Pemkab dan Pemko mengklaim itu sebagai air bawah tanah. Tidak tercapai Hal lain yang disoroti Komisi

C DPRD Sumut dalam rapat dengar pendapat itu adalah menyangkut PAD yang tidak tercapai secara keseluruhan pada tahun 2013. Pada APBD 2013, realisasi PAD hanya Rp3,6 teriliun lebih, dari target Rp4,5 triliun lebih. Sama seperti pada penjelasan sebelumnya, Kadispenda Sumut Rajali, menjawab ini berdalih karena pungutan untuk Pajak Kendaraan Bermotor (PKB) masih menggunakan Perda yang mencantumkan pungutan 15 persen. Sementara di sejumlah provinsi lainnya memungut pajak 10 persen. Akibat dari ini, menurut Rajali, pungatan dari PKB tidak maksimal. Karena, masyarakat yang membeli mobil baru lebih memilih untuk membelinya di luar Sumut. Terlebih bagi korporasi atau perusahaanperusahaan yang membeli mobil baru (termasuk truk) dalam jumlah yang banyak. ‘’Jadi pajaknya tidak masuk ke kita,’’ kata Rajali. (m12)

Pemahaman Masyarakat Terhadap Jasa Keuangan Minim J A K A RTA ( Wa s p a d a ) : Pemahaman masyarakat Indonesia terhadap produk dan lembaga jasa keuangan masih sangat minim. Dari survei tahun 2013 hanya 21,84% masyarakat yang memahami dengan baik produk dan lembaga jasa keuangan. Ini berarti hanya 22 orang dari 100 orang yang memiliki pengetahuan tentang lembaga

keuangan serta produk dan jasanya, termasuk juga manfaat, risiko serta hak dan kewajibannya. “Kondisi infrastruktur daerah di Indonesia yang belum merata mengenai literasi keuangan dinilai sebagai faktor penghambat bagi masyarakat setempat dalam memperoleh layanan jasa keuangan (LJK),” kata Dewan Komisioner Oto-

Pertumbuhan Ekonomi Aceh Terus Melambat BANDA ACEH (Waspada): Pertumbuhan ekonomi Aceh terus melambat dalam tiga tahun terakhir ini. Karenanya dibutuhkan perhatian serius jajaran Satuan Kerja Pemerintah Aceh (SKPA). Kepala Badan Pusat Statistik (BPS) Aceh Hermanto, mengatakan itu, Rabu (5/2), di Banda Aceh. Katanya, SKPA yang menangani sektoral harus mulai mencermati serius kondisi pertumbuhan ekonomi Aceh yang terus melamban dalam tiga tahun terakhir ini. Kata dia, pertumbuhan ekonomi Aceh secara kumulatif tahunan mengalami perlambatan. “Pertumbuhan ekonomi Aceh tanpa migas tahun 2013 hanya 5,36,’’ sebutnya. Angka itu, tambah Hermanto, melambat dari tahun tahun 2012, dengan pertumbuhan 6,07 persen tanpa migas dan 5,14 persen dengan migas. “Hal ini kemungkinan besar disebabkan oleh adanya kenaikan tarif dasar listrik pada April 2013 dan kenaikan harga BBM bulan Juni 2013,” cetusnya. Hermanto, menjelaskan, dalam kurun waktu tahun 2011-2013 hampir semua komponen ekonomi Aceh tumbuh melambat. Komponen konsumsi rumah tangga tumbuh terus melambat dari 5,43 persen pada tahun 2011 menjadi 4,79 tahun 2013. Selanjutnya, untuk komponen konsumsi pemerintah 7,46 persen pada tahun 2011, sedangkan tahun 2013 komponen ini hanya tumbuh 4,27 persen. Dikatakannya, komponen pembentukan modal tetap bruto (PMTB) menjadi satu-satunya komponen yang pertumbuhan tahun 2013 sebesar 5,42 persen lebih cepat dibandingkan dengan tahun 2011 hanya sebesar 3,99 persen. “Seperti halnya komponen konsumsi rumah tangga dan komponen konsumsi pemerintah, komponen ekspor dan impor juga melambat. Bahkan untuk komponen impor tahun 2013 tumbuh negatif, sama halnya dengan ekspor Aceh yang juga tumbuh negatif,” tuturnya. Kepala BPS juga mengungkapkan penurunan aktivitas ekspor dan impor di Aceh mendukung kondisi sektor pengangkutan dan komunikasi yang juga dalam kurun waktu 2011-2013 terus melambat,” demikian Hermanto. (b06)

ritas Jasa Keuangan (OJK), Kusumaningtuti Sandriharmy Soetiono di Jakarta, Selasa (4/2). Survey yang dilakukan OJK di 20 provinsi dengan jumlah responden sebanyak 8 ribu orang dilaksanakan pada semester I-2013. Dari survey tersebut diketahui, bahwa perbankan adalah lembaga keuangan yang paling dikenal oleh masyarakat dan untuk pasar modal atau asuransi, masyarakat belum sepenuhnya mengerti betul jasa keuangan itu. “Saat ini, dari 100 orang di Indonesia, ada 57 orang yang sudah memanfaatkan produk dan jasa perbankan. Angka itu berturut-turur diikuti oleh

asuransi sebanyak 12 orang, lembaga pembiayaan 7 orang, pegadaian 5 orang dan pasar modal hanya 1 orang,” tuturnya. Sementara itu Presdir asuransi AIA Carl Gustini, menambahkan, bahwa pertumbuhan ekonomi di Indonesia tidak sebanding dengan tingkat pertumbuhan pasar asuransinya. Karena itu AIA selalu berupaya menghadirkan berbagai produk asuransi yang sekiranya dapat memenuhi kebutuhan masyarakat. “Potensi pasar asuransi di Indonesia sangat besar. Penetrasi pasar asuransi disini baru mencapai 1% dari jumlah penduduk Indonesia. Dari

gambaran ini inovasi dalam memenuhi kebutuhan berasuransi mengharuskan kami memperluas jaringan dengan bekerja sama dengan pihak lain,” papar Gustini. Untuk itu, AIA menjalin kerjasama dengan Bank BCA dalam melahirkan produk bancassurace MAXI yang ditujukan kepada masyarakat berusia 1855 tahun. “Produk ini mengkombinasikan manfaat asuransi jiwa, kesehatan, penyakit kritis, p e m b e b a s a n p re m i d a n peluang berinvestasi optimal untuk antisipasi risiko di setiap tahapan kehidupan,” jelas Gustini. (j03)

Pencabutan Subsidi Listrik Industri Belum Tepat MEDAN (Waspada): Rencana pemerintah mencabut subsidi listrik industri dinilai kalangan pengusaha belum tepat. Hal ini akan menambah biaya produksi industri yang berdampak pada menaikkan harga produk. Akibatnya masyarakat yang bakal merasakan kenaikan harga-harga barang. “Kita bingung melihat ini, satu sisi pelayanan PLN belum optimal, sisi lain selalu dengan alasan mengurangi dan menghapus subsidi, sehingga dunia usaha diminta harus menanggung sepenuhnya. Tentunya ini berdampak pada biaya operasional produksi,” kata Sekretaris Asosiasi Pengusaha Indonesia (Apindo) Sumut Laksama Adyaksa, Rabu (5/2). Laksamana, menyebutkan, rencana pencabutan subsidi oleh pemerintah yang juga di-

iringi dengan keputusan menaikkan tarif listrik pada MeiDesember 2014 untuk golongan industri skala besar seperti I-3 dan I-4, ini tentunya akan menambah beban bagi beberapa industri yang ada di Sumut seperti industri baja yakni PT Gunung Gahapi Sakti, PT Growth Steel dan PT Baja Deli, serta beberapa industri kaca seperti Kedaung Group. “Industri-industri tersebut membutuhkan listrik yang sangat besar. Bila biaya listrik bertambah, tentunya biaya produksi juga bertambah. Mau tidak mau, pasti akan ada kenaikan harga jual produk. Sehingga konsumen atau masyarakat yang akan terbebani. Perusahaan harus menaikkan harga karena biaya operasional akan membengkak,” katanya. Kenaikan harga produk baja tersebut nantinya akan mempengaruhi harga rumah. Sebab,

penggunaan baja untuk pembangunan rumah cukup besar sehingga kenaikan harga ini akan menambah biaya barang modal. Begitu juga dengan produk kaca, yang banyak menjadi kebutuhan masyarakat. “Menaikkan beban kepada industri, tentunya akan menaikkan beban kepada rakyat,” ujarnya. Menurutnya, keputusan menaikkan tarif listrik ini memang sangat tidak tepat mengingat masih ada sejumlah daerah di Indonesia yang mengalami krisis hingga mengancam industri. “Pelaku usaha merasa aneh dengan keputusan ini. Meski dikatakan untuk efisiensi, namun kenyataannya, pasokan untuk industri tidak bisa dijamin. Makanya kita menganggap kenaikan ini tidak tepat. Jangan akibat ketidakefisienan PLN, perusahaan yang menjadi korban,” tegas Laksamana. (m41)

MEDAN (Waspada): Para importir di Sumut, saat ini telah memasukkan gula pasir dari Thailan melalui pelabuhan Belawan sebanyak 21.700 ton. Asisten Hukum dan Humas PT Pelabuhan Indonesia I Cabang Belawan M. Azmi Jauhari, Senin (3/2), membenarkan data itu. Menurutnya, gula pasir sebanyak itu diangkut dengan kapal MV Southern Spirit berbendera Panama. Kapal tiba di pelabuhan Belawan, Selasa (21/1) dan telah membongkar muatannya di dermaga 112. Berdasarkan data penyandaran kapal di pelabuhan terlihat, gula impor asal negara gajah putih itu dipasok PT Medan Sugar Industri Percut Seituan, Kab. Deliserdang dari dua perusahaan di Thailand. Azmi Jauhari, menegaskan kedatangan 21.700 ton gula impor asal Thailand ini merupakan impor perdana pada 2014 ini. ‘’Sebagian besar gula impor masuk ke Sumut melalui pelabuhan Belawan berasal dari negara gajah putih ini, ‘’tambahnya. Sedangkan pengimpor 21.700 dilakukan perusahaan yang mengantongi izin impor gula mentah. Yakni, PT Medan Sugar Industry mengimpor sebanyak 12.000 ton dari The Thai Sugar Trading Corporation Bangkot Thailand, dan 9.700 ton diimpor dari Siam Sugar Export Coporation Ltd Bangkok. Gula mentah sesuai peraturan Dinas

Perdagangan diizinkan hanya untuk bahan baku memenuhi kebutuhan pabrik makanan, dan tidak dibenarkan untuk dipasarkan sebagai konsumsi masyarakat, karena harus diproses lebih dahulu. Namun, dari informasi yang diperoleh, dicurigai gula impor tersebut telah merembes ke pasaran, karena bentuk fisiknya yang tidak dapat dibedakan dengan gula konsumsi. Menurut Humas Pelabuhan Belawan Azmi, gula pasir yang rutin masuk ke pelabuhan Belawan untuk memenuhi konsumsi masyarakat berlangsung hampir setiap bulannya berasal dari antar pulau. Yakni, dari pelabuhan Panjang, Lampung, yang merupakan daerah produksi gula terbesar di tanah air. Dan sekali-sekali masuk dari Pulau Jawa. Harga Stabil Pantauan Waspada, Senin (3/2), gula pasir asal Lampung, mengusai sebagian gula eceran yang telah dikemas dengan berbagai merek. Diantaranya merek Gulaku dan Sugaro. Sedangkan harga eceran gula pasir di pasaran relatif stabil, Untuk gula eceran kiloan dipasarkan dengan harga Rp 10.000 per kg dengan jenis gula lokal kualitas warna merah. Sedangkan kualitas sedang dipasarkan dengan harga Rp11.000 per kg. Sementara gula kemasan khusus dengan berbagai merek dipasarkan antara Rp12.000 hingga Rp13.000 per kg.(m35).

Aceh Butuhkan Tenaga Kerja Bidang Konstruksi BANDA ACEH (Waspada): Wakil Gubernur Aceh Muzakir Manaf, mengharapkan program pembangunan bidang konstruksi dapat terlaksana dengan baik dengan mengandalkan tenaga terampil dari lokal. Hal itu disampaikan Muzakir Manaf, saa membuka Pelatihan Pelaksana Lapangan Pekerjaan Jalan Jembatan dan Pelatihan Tukang Bidang Konstruksi Tingkat Pemula se-Aceh, Selasa (4/2). Dia juga berharap, pelatihan yang digelar dapat dijadikan momentum yang tepat guna mengatasi masalah kekurangan tenaga terampil di bidang konstruksi yang selama ini dihadapi Aceh “Belajarlah semaksimal mungkin, sehingga semua ilmu yang diajarkan dapat diserap dengan baik. Ilmu itu akan menjadi modal penting dalam berkarya di tengah-tengah,’’ kata Muzakir, dihadapan 40 pemuda Aceh yang mengikuti pelatihan gelombang I tersebut. Sementara itu, Kepala Badan Pelatihan Konstruksi Wilayah I Banda Aceh Sutjipto, mengatakan, pelatihan ini merupakan salah satu persiapan dalam menyongsong Asean Community. Yaitu mempersiapkan mereka

untuk memiliki kompetensi dan sertifikasi sesuai dengan bidang dimiliki. “Pelatihan yang kami lakukan, disesuaikan dengan jabatan yang dikuasai, mulai dari level 1 yaitu tukang pemula sampai level 9 yaitu ahli utama dari berbagai jabatan kerja yang ada di pekerjaan konstruksi,” kata Sutjipto. Ketua Pelaksana, Eddy Irwanto, S.T, M.Tech, dalam laporannya mengatakan, pelatihan ini berlangsung dari tanggal 3 – 27 Februari 2014. Dijelaskan Eddy, pelatihan bertahap diikuti oleh 200 pemuda Aceh ini dilaksanakan atas program Pusat Pembinaan Kompetensi dan pelatihan Konstruksi Badan Pembinaan Konstruksi Kemeterian Pekerjaan Umum Republik Indonesia. Turut hadir dalam acara tersebut, Dekan FT Unsyiah, Ketua Jurusan Teknik Sipil FT Unsyiah, Kadisdik Aceh, Wanda Monic GIZ German, Disnakermobduk Aceh, Dinas Bina Marga Aceh, Pembina Jasa Konstruksi Aceh, Perwakilan Asosiasi dan Perwakilan Lembaga Pengembangan Jasa Konstruksi Aceh, serta diikuti oleh instruktur dan puluhan peserta pelatihan. (b04)

Kandungan Lokal Mobil Murah Ditargetkan100 Persen JAKARTA (Waspada): Pemerintah berharap local content (kandungan lokal) mobil murah ramah lingkungan (Low Cost Green Car/LCGC) Daihatsu Ayla dan Toyota Agya bisa mencapai 100 persen dalam lima tahun mendatang. Hal itu sesuai dengan tujuan utama diciptakannya program LCGC oleh pemerintah. “Kandungan kendaraan LCGC yang diproduksi PT Astra Daihatsu Motor (ADM) kini sudah mencapai 85 persen dan menuju 88 persen hingga akhir tahun ini. Terima kasih atas prestasi ini. Setelah ini, dalam waktu lima tahun, saya berharap bisa mencapai 100 persen kandungan lokalnya,” kata Menteri Perindustrian (Menperin) MS Hidayat di Karawang, Jawa Barat. Menperin mengatakan hal tersebut saat memberikan penghargaan kepada PT ADM atas ekspor perdana LCGC Ayla ke Filipina di Pabrik Perakitan Astra Daihatsu Motor, Jawa Barat, baru-baru ini. Hadir Duta Besar Jepang untuk RIYoshinori Katori, ExecutiveVice President Daihatsu Motor Company Tatsuya Kaneko, Managing Officer Toyota Motor Corporation Hiroyuki Fukui, Presiden Direktur PT Astra International Tbk Prijono Sugiarto, Presiden Direktur PT ADM Sudirman MR, dan sejumlah pejabat setempat. Menurut Hidayat, perkembangan otomotif di Indonesia sudah berhasil dengan didirikannya empat pabrik mobil dan lebih dari 100 pabrik komponen. Semuanya telah menyerap 80.000 tenaga kerja. Dengan adanya ekspor LCGC ke Filipina, membuktikan bahwa industri otomotif Indonesia sudah bisa berbicara di tingkat internasional.

Sudirman MR mengatakan, dengan ekspor LCGC ke Filipina berupa mobil bermerek Agya, membuktikan kualitas PT ADM telah diterima di pasar internasional. Selama 2013 Ayla dan Agya telah terjual lebih dari 41.000 unit di pasar domestik. Mobil LCGC itu diproduksi di pabrik perakitan Daihatsu di Karawang yang diresmikan operasionalnya oleh Wakil Presiden Boediono pada 22 April 2013 lalu. Kapasitas produksi Daihatsu di pabrik ini mampu mencapai 460.000 unit per tahun. “Tahun lalu, produksi PT ADM mencapai 3 juta unit. Tiap tahun, 14 persen produksi pabrik Daihatsu baik yang di Sunter dan Karawang sudah rutin diekspor ke-68 negara seperti ke Asia Tenggara, Timur Tengah, Jepang, dan Amerika Latin. “Produksi ADM sudah memenuhi standar dunia, dan masuk industri global,” tambah Sudirman. Sesuai arahan pemerintah, sambungnya, terkait dengan lokalisasi komponen produk LCGC Ayla dan Agya akan mencapai tingkat kandungan dalam negeri sebesar 88 persen. Hingga akhir 2013, penggunaan komponen lokal pada Agya dan Ayla telah mencapai 85 persen. “ Jadi hanya 12 persen lagi komponen yang diimpor dari negara lain,” papar Sudirman. Sementara itu, Executive Vice President Daihatsu Motor Company Tatsuya Kaneko menyambut baik ekspor LCGC produksi PT ADM ke Filipina.“Semua ini berawal dari kuatnya permintaan domestik di sana. Tentunya setelah menganalisa pasar, daya saing harga, dan kebutuhan masyarakat di sana,” ujarnya. (Ril/ J03)


WASPADA Kamis 6 Februari 2014

B11 Rumah Guru Madrasah Terbakar SIGLI (Waspada): Rumah milik Siti Rahmah, 50, guru Madrasah Ibtidaiyah Negeri (MIN) di Desa Dayah Ribeun, Kecamatan Mutiara, Pidie, Rabu (5/2) sekira pukul 09:30 ludes terbakar. Penyebab kebakaran belum diketahui. Namun, sumber api diduga berasal dari lantai bagian atas.“Saat kejadian saya sedang mengajar di dalam kelas di MIN Kampong Pisang, Kecamatan Kota Bakti. Saya didatangi warga, dikatakan segera pulang. Tidak disebutkan apa yang terjadi. Setiba saya di rumah, saya melihat rumah saya sudah hangus terbakar” kata Siti Rahmah, Rabu (5/2). Kata dia, saat kejadian, di dalam rumah hanya tinggal putrinya bersama cucu. Api yang muncul secara tiba-tiba pada bagian atas rumah langsung membesar dan menghanguskan seisi

rumah. “Sehelai kain pun tidak bisa kami selematkan, karena api cepat membesar dan menghanguskan seisi rumah” katanya. Api juga menghanguskan semua dokumen –dokumen penting yang disimpan di dalam rumah. Semisal, surat-surat tanah, ijazah, anakanaknya dan ijazah dirinya sendiri. Begitupun peralatan rumah seperti tempat tidur, lemari TV dan sebagainya ludes dilalap si jago merah. Hingga berita ini diturunkan bantuan masa panik dari Dinas Sosial Pemerintah Kabupaten Pidie, belum diterima. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Pidie, Apriadi kepada wartawan menyampaikan, bantuan masa panik akan segera disalurkan oleh Pemkab Pidie, melalui Dinas Sosial. (b10)

Bocah 16 Bulan Tewas Makan Racun

Waspada/Muhammad Riza

GURU MIN, Kota Bakti, Pidie, Siti Rahmah, sedang memperhatikan dan mengumpulkan buku-buku dan dokumen penting yang terbakar, dalam kebakaran rumahnya, Rabu (5/2)

Terdakwa Sakit, Sidang Pembunuhan Siswi SMK Ditunda

Tentang Sejarah Islam Di Aceh

LHOKSUKON (Waspada): M Yusuf, 20, terdakwa dalam kasus pembunuhan siswi SMK Nurmala Dewi, 17, Rabu (5/ 2) sakit. Karena itu, Majelis Hakim Pengadilan Negeri Lhoksukon, Aceh Utara terpaksa harus menunda sidang lanjutan kasus pembunuhan tersebut hingga, Senin (10/2). Sidang dengan agenda mendengar pembelaan dibuka Ketua Majelis Hakim Abdul Aziz yang didampingi dua hakim anggota Mustabsyirah dan T Almadyan pada pukul 11:15. Hakim ketua sempat mempertanyakan mengapa terdakwa tidak berhadir pada sidang tersebut. Dahnir, Jaksa Penuntut Umum (JPU) mengatakan, terdakwa tidak berhadir karena sedang sakit. Karena itu, hakim meminta pengacara terdakwa Tufiq M Nur untuk membacakan materi pembedaan pada sidang yang akan digelar kembali pada Senin (10/2). (b18)

Lima Desa Endemis DBD PANTONLABU (Waspada): Lima desa di Kec. Tanah Jambo Aye, Aceh Utara, meliputi Desa Samakurok, Rawang Iteik, Meunasah Panton, Keude Pantonlabu dan Desa Cempeudak, berstatus endemis demam berdarah dengue atau DBD. “Kita menemukan kasus DBD di lima desa ini, dalam tiga tahun terakhir. Karena itu, dinyatakan sebagai daerah endemis,” jelas Fitriadi, Kepala Puskesmas Tanah Jambo Aye, Rabu (5/2). Fitriadi menambahkan, untuk meminimalisir dampak yang ditimbulkan sekaligus sebagai langkah pencegahan, Dinas Kesehatan Aceh Utara, mengasapi atau melakukan fogging di sejumlah titik yang dicurigai sebagai sarang nyamuk, di lima desa tersebut, kemarin. Kaur Umum Desa Samakurok, Abdul Rafar, mengapresiasi langkah preventif Dinkes Aceh Utara ini. Ia juga berharap, fogging terus dilaksanakan secara berkala dan rutin sehingga masyarakat benar-benar bebas dari DBD. (b19)


PETUGAS dari Dinkes Aceh Utara melakukan fogging di Desa Samakurok, Kec. Tanah Jambo Aye, Aceh Utara, Rabu (5/2).

Irigasi Aceh Utara Memprihatinkan LHOKSEUMAWE (Waspada): Pada pertemuan pra-Musrembang Kabupaten Aceh Utara TA-2014, membahas kondisi irigasi yang memprihatikan, Rabu (5/2). Ketua Komisi-D DPRK Aceh Utara yang membidangi pembangunan mengatakan, dalam pramusyawarah rencana pembangunan (Musrembang) Aceh Utara TA-2014 memprioritaskan pembangunan irigasi. “Kita baru saja turun ke beberapa lokasi irigasi, kondisinya memprihatinkan,” jelas Ketua Komisi-D, Junaidi. Di antaranya, Irigasi Teupin Reusep yang mengairi sekitar 3.500 hektare lahan sawah warga Kecamatan Sawang dan Kec. Bandar Baro.“Pembangunan irigasi ini harus mendapat prioritas,” tambahnya. Junaidi menyebutkan, setelah pembangunan prioritas dibahas dalam Musrembang, harus direalisasikan. (b15)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Buku Pelajaran SMA Menyimpang LHOKSEUMAWE (Waspada): Dunia pendidikan sekolah di Kota Lhokseumawe, Rabu (5/2) dikejutkan adanya temuan buku mata pelajaran sekolah tahun 2008 terbitan CV Aryaduta telah menyimpang dari fakta asal usul sejarah kerajaan Islam di Aceh. BukupelajaranSejarahuntuk tingkat SMA kelas dua itu mengalami kesalahan fatal dalam penulisan lokasi situs sejarah Kerajaan Samudera Pasai disebut bukan berasal dari Aceh. Akan tetapi, dalam buku tersebut, tepatnya pada halaman 61 dan 62, justru tertulis Kerajaan Samudera Pasai pada masa kepemimpinan Sultan Malikussaleh itu terletak di Sumatera Utara. Padahal seluruh masyarakat Acehtahupersissejarahkera-jaan SamuderaPasemerupakanpintu gerbang penyebaran aga-ma Islam pertama di nusantara yang berada di kawasan Desa Beuringen, Kecamatan Samudera Geudong,KabupatenAcehUtara. Salah seorang penemu kejanggalan itu adalah Guru Sejarah SMA N 1 Lhokseumawe, Zulfikar yang merasa kaget setelah membaca isi buku seja-

rah yang dirasa menyimpang dari fakta sejarah Aceh. Disebutkan, pada halaman 61 dan 62 tertulis bahwa Kerajaan Samudera Pasai terletak di Sumatera Utara secara berulang kali. Zulfikar mengaku sudah lama menemukan kejanggalan buku sejarah pada tahun 2013. Namun lantaran tidak ada respon serius dari berbagai pihak, akhirnya Zulfikar mengambil sikap untuk meluruskan sejarah dengan terpaksa mengajak para siswanya mengunjungi langsung lokasi situs sejarah Kerajaan Samudera Pasai di Kecamatan Samudera Geudong. Termasuk berziarah ke makam Sultan Malikussaleh di Desa Beuringen agar tidak ter-

pengaruh dengan tulisan dalam buku. Zulfikar menyebutkan buku pelajaran sejarah ini sudah menyimpang dari fakta aslinya dan ini merupakan kesalahan yang fatal. Kadis Pendidikan, Pemuda dan Olahraga Lhokseumawe, Rusli membenarkan temuan adanya buku yang menyimpang dari sejarah Aceh. Rusli mengaku kaget setelah mengecek kembali isi buku mata pelajaran sejarah itu ternyata benar ada yang salah tulis. Akan tetapi, Rusli menjelaskan pihaknya akan mengambil tindakan tegas dalam waktu dekat ini akan melayangkan surat protes kepada penerbit buku CV Aryaduta. (b16)

Kalapas Redam Napi Berdemo LHOKSEUMAWE (Waspada) : Guna meredam ratusan napi yang berencana menggelar aksi demo dalam penjara, Rabu (5/ 2) akhirnya Kalapas Kota Lhokseumawe terpaksa berjanji akan memenuhi sejumlah tuntutan, antara lain akan mengurus sebanyak 50 surat izin pembebasan bersyarat ke Jakarta. Ratusan napi yang sudah bersiap akan melakukan aksi berdemo, telah berhasil diredam oleh pihak Lapas Kota Lhokseumawe dengan memanggil seluruh ketua kamar penjara sebagai perwakilan. Kalapas Kota Lhokseumawe Lisa Beta melalui Kepala Pengamanan Lembaga Permasyarakatan (KPLP) Indra Gunawan membenarkan pihaknya telah berhasil meredam aksi demo yang hendak dilakukan oleh ratusan napi.(b16)

Mantan Kepsek Korupsi Dana Sekolah Dituntut 1,5 Tahun Penjara BANDA ACEH (Waspada): KA, 52, mantan Kepala SMKN 1 Jeumpa, Kabupaten Bireuen, dituntut 1,5 tahun penjara (satu tahun enam bulan) karena diduga telah melakukan korupsi berbagai bantuan untuk keperluan sekolah tersebut. Terdakwa KA yang ditahan penyidik sejak 25 Juni 2013, selain dituntut 1,5 tahun penjara, terdakwa juga harus membayar denda sebesar Rp50 juta subsidair enam bulan kurungan. Tuntutan dibacakan jaksa penuntut umum Faisal Moga cs dari Kejari Bireuen dalam sidang lanjutan di Pengadilan Tipikor Banda Aceh, Selasa (4/2), dengan majelis hakim diketuai Ainal Mardhiah dibantu anggota HamidiDjamildanZulfanEffendi. Jaksa merinci lima item perbuatan korupsi yang dilakukan terdakwa yang berkaitan dengan penggunaan dana di sekolah SMKN 1 Jeumpa, Bireuen,

yang tidak dapat dipertanggungjawabkan oleh terdakwa. Jaksa menyebutkan, penggunaan dana BOS tahun anggaran 2011, di mana SMKN 1 mendapat dana bos Rp137.770.000. Namun, dari jumlah ini yang dapat dipertanggungjawabkan terdakwa Rp60.443.150 dan sampai batas akhir tahun anggaran terdakwa belum melaporkan ke dinas pendidikan setempat. Selain itu, untuk penggunaan dana bantuan operasional manajemen mutu (BOMM) tahun anggaran 2011, dari jumlah dana yang diterima SMKN 1 Rp12.000.000, yang diperuntukan bagi bahan-bahan pembelajaran praktik, terdakwa menghabiskan dana bantuan ini untuk kepentingan pribadinya. Bukan itu saja, kata jaksa, terdakwa juga mengkorup penggunaan dana bantuan beasiswa untuk siswa miskin tahun anggaran 2011 sebesar Rp16.-

770.000. Begitu juga dengan penggunaan dana Sertifikasi ISO: 2008 tahun anggaran 2011 yang diplotkan untuk SMKN 1 sebesar Rp30.000.000. Dari jumlah itu digunakan terdakwa Rp7. 000. 000, untuk pelaksanaan Diklat ISO 9001:2008, sedangkan sisanya digunakan untuk kepentingan pribadinya. Perbuatan terdakwa telah melanggar pasal 2 ayat (1) UU No.20 Tahun 2001 jo.pasal 18 ayat (1),(2) dan (3) UU tindak pidana korupsi. Untuk mendengarkan keterangan terdakwa majelis hakim menunda sidang hingga, Senin (20/1). Sementara terdakwa di persidangan mengaku sejumlah Rp200 juta uang untuk pembangunan ruang sekolah yang telah diberikan kepada pemborong telah dibawa kabur sehingga ruang sekolah dari dana bloc grand itu tidak selesai. (b02)

PANTONLABU (Waspada): Seorang bocah perempuan berusia 16 bulan, Nurrahmani, tewas setelah memakan butiran racun serangga Curater, di Desa Ulee Glee, Kec. Tanah Jambo Aye, Aceh Utara, Selasa (4/2) sore. Korban sempat dibawa ke Puskesmas Tanah Jambo Aye, dengan kondisi setengah sadar, wajah membiru dan keluar gelembung dari mulut serta hidungnya. Namun saat dalam perjalanan dirujuk ke rumah sakit, bocah malang itu meninggal dunia, sekitar pukul 15:00. “Jasadnya dikebumikan pada hari itu juga, di kampung halaman ibunya, Desa Biram Rayeuk, Kec. Tanah Jambo Aye,” kata M Hasan, Keuchik atau Kepala Desa Ulee Glee. Menurut keuchik, racun serangga yang dimakan korban diduga milik tetangga. Racun itu digantung dalam kantong kresek di dalam kandang kambing. Oleh beberapa anak lain, yang usianya lebih tua beberapa bulan dari korban, kantong itu diturunkan dengan galah kayu, lalu korban memakan butiran racun seukuran pasir tersebut itu karena mengira makanan. “Tak lama kemudian, korban dikabarkan langsung pingsan. Teman-temannya berusaha

membawa pulang korban dengan cara diseret, lantaran tak sanggup dibopong. Saat itulah seorang ibu tetangga korban melihatnya dan peristiwa itu langsung diberitahukan kepada orang tua korban,” kata M Hasan. Sementara Dr Harry Laksamana, tenaga medis yang menangani Rahmani menjelaskan, saat tiba di UGD, korban sudah dalam kondisi sekarat. Nafasnya sudah tersengal dan dari mulut serta lubang hidungnya keluar gelembung seperti buih. Sementara warna kulitnya sudah membiru. “Kita sempat berusaha memancing pasien muntah dengan memberikan susu. Tapi gagal. Begitu juga ketika hendak kita infus, tidak bisa karena vena atau saluran pembuluh darahnya sulit ditemukan. Terakhir, korban hanya bisa dipasangi oksigen, lalu langsung dirujuk ke rumah sakit. Tapi, dalam perjalanan ke sana, korban meninggal dunia,” kata Harry. Hasil diagnosa di puskesmas, lanjut Harry, korban dipastikan meninggal karena insektisida atau racun serangga, serupa seperti obat nyamuk cair. Insektisida itu tertelan oleh korban dalam jumlah banyak dan diperkirakan sudah sampai ke paru-paru. (b19)

Polisi Bongkar Makam Pengusaha Kilang Padi MANGGENG RAYA (Waspada) : Jajaran Kepolisian Resor Aceh Barat Daya bersama tim dokter ahli dari dari Rumah Sakit Umum (RSU) Adam Malik Medan, Rabu (5/2) melakukan ekshumas (membongkar makam) Safril bin Ibrahim, 52, warga Dusun Satu, Desa Pawoh, Kecamatan Susoh. Proses pembongkaran jenazah yang sudah dimakankan hampir sebulan lalu di tempat pemakaman keluarga di samping kilang padi milik korban di Gampong (Desa) Pawoh, Kecamatan Susoh itu dilakukan guna menindaklanjuti dugaan penyebab kematian korban yang dinilai janggal. Selanjutnya jenazah pengusaha kilang padi tersebut dilakukan otopsi oleh tim forensik yang khusus didatangkan dari Medan dengan harapan penyebab kematian Safril dapat terungkap. Dari informasi yang didapatkan, kematian ayah tiga anak tersebut sempat mengundang tanda tanya, karena sebelum meninggalnya almarhum, mertuanya sempat meminta bantuan kepada tetangga untuk mendamaikan Syafril dan abangnya Nasli yang diakui sedang

baku pukul dengan korban. Berat dugaan Safril meninggal akibat dipukul, sebab sebelumnya korban sempat adu mulut bersama abangnya karena persoalan sewa bangunan, harta peninggalan dari orang tua mereka. Kapolres Abdya AKBP Eko Budi Susilo melalui Kasat Reskrim Iptu Fitriadi, kepada sejumlah wartawan di lokasi ekshumasi, Rabu (5/2) mengatakan, penggalian kuburan Syafril dilaksanakan untuk keperluan otopsi oleh dokter ahli dalam upaya mengungkapkan penyebab kematian almarhum. “Korban meninggal tidak diketahui persis bagaimana sebab kejadiannya, berat dugaan korban dipukul, maka dari itu pihak kepolisian atas seizin pihak keluarga dan imam desa melakukan ekshumasi untuk mencari titik kebenarannya,” imbuh Fitriadi. Menurutnya, otopsi mayat alm.Safril dilakukan oleh tim dokter ahli yang diketuai Mistar Ritongai. Lebih lanjut dikatakan, setelah dilakukan otopsi, sampel dari hasil tersebut langsung dibawa ke laboratorium untuk pemeriksaan lebih lanjut. (cza)

Banyak Masjid Di Aceh Kosong MEUREUDU (Waspada) : Akibat pengaruh globalisasi, masyarakat Aceh kerap dilalaikan di warung-warung kopi hanya untuk menonton televisi, akibatnya banyak meunasah (surau) dan masjid di Kabupaten Pidie Jaya dan Pidie sepi (kosong) dari jamaah, karena masyarakat telah terlena dengan urusan duniawi. Hal itu disampaikan Anwar Gani, Kadis Syariat Islam Kabupaten Pidie Jaya dan Mukhtar Ahmad, Kadis Syari’at Islam Pidie, Selasa (4/ 2). “Saya pernah berkunjung ke salah satu masjid dan meunasah di Pidie Jaya. Ternyata masjid dan meunasah telah dipenuhi debu-debu. Ini membuktikan, kalau meunasah dan masjid itu jarang sekali difungsikan oleh masyarakat

setempat. Kondisi ini sangat memprihatinkan,” kata Anwar. Hal serupa diakui Kadis SI Pidie Mukhtar Ahmad yang mengatakan, kondisi umat Islam di Aceh sekarang ini sudah semakin memprihatinkan. Mereka sudah kurang sekali mempedulikan persoalan syariat. Sedihnya, kata dia, warga lebih memilih nongkrong di warung kopi ketimbang memakmurkan masjid. Agar kondisi ini tidak berlanjut, Dinas Syariat Islam Pidie berencana akan menjalankan program gampong percontohan SI. Di gamponggampong itu nantinya akan dilaksanakan kegiatan majelis ta’lim, menghidupkan shalat berjamaah, menggairahkan balai pengajian. (b09)

Alih Fungsi Lahan Pertanian Memprihatinkan BANDA ACEH (Waspada) : Fenomena alih fungsi lahan pertanian menjadi perumahan dan industri cukup memprihatinkan di Aceh. Penyusutan tersebut terjadi di Kabupaten Pidie Jaya, Aceh Besar, Aceh Barat Daya dan juga di Kabupaten Aceh Selatan. “Pemerintah hingga kini belum memiliki aturan tata kelola untuk melindungi lahan pertanian yang selama ini menjadi sumber kehidupan masyarakat di Aceh,” papar Direktur Eksekutif WALHI Aceh Muhammad Nur, Selasa (4/2). “Sejauh ini Pemprov Aceh belum memiliki komitmen menjaga lahan dan wilayah pertanian,” ungkap Muhammad Nur. Di masa mendatang, kata Muhammad Nur, akan terjadi konflik lahan terlebih tidak ada regulasi pemanfaatan lahan. “Ini terkait hajat hidup masyarakat, lahan-lahan yang ada saat ini merupakan basis ekonomi masyarakat Aceh yang hidup di sektor pertanian,” kata Muhammad Nur. Menurutnya, bila pemerintah tidak mampu

memenuhi kebutuhan ekonomi masyarakat Aceh baik penyediaan tenaga kerja jangan pula masyarakat dibuat berkonflik karena semakin kritisnya lahan pertanian. Kritik atas penyusutan lahan pertanian ini juga disampaikan anggota DPR RI asal Aceh, Ali Yakob. Menurutnya, penyusutan tersebut memberikan dampak negatif terhadap pertumbuhan produksi masyarakat di sektor pertanian. Ketua DPP Partai Demokrat itu menyebutkan, penyusutan lahan pertanian di Aceh juga berdampak serius pada peningkatan nilai tukar petani (NTP) di Aceh yang pada Januari 2014 ini mengalami peningkatan sebesar 0,12 persen, namun kenyataannya NTP di Aceh tercatat sebesar 106,45. “Itu tandanya belum menguntungkan para petani. Daya beli petani masih rendah. Kalau menurut data BPS, justru Aceh kalah dari Sumatera Barat di mana peningkatan NTP-nya mencapai 0,93 persen dan tertinggi di Indonesia,” jelasnya. (b08)

Tradisi Kaoy Masih Kental Di Tanah Pasir SAMPAI sekarang ada berbagai macam penyakit yang tidak terdeteksi oleh alat medis dan alat canggih lainnya, dan banyak pula ditemui kasus orang sakit yang tidak wajar, yang telah berobat sana-sini tetapi tidak kunjung sembuh. Di tengah rasa tak berdaya, akhirnya terucaplah kaoy (nazar), ikatan janji pada Allah Swt sebagai jalan terakhir di ujung keputus-asaan. Dalam banyak riwayat me-

nyebutkan bahwa orang Aceh terdahulu paling suka bernazar, dan banyak pula yang tidak menunaikan sampai kemudian meninggal dunia. “Kaoy ini bila tersampaikan maksudnya, maka harus ditunaikan. Bila tidak, ianya akan menjadi hutang. Hutang akan tetap ditagih sampai tujuh turunan, karena bagaimana pun janji harus ditepati,” ucap Rusli, warga Keutapang, Tanah Pasir, Aceh Utara, Selasa (4/2).

Rusli yang sehari-hari dikenal luas sebagai tokoh tua dalam menangani berbagai masalah dan perselisihan di Tanah Pasir, kerap menerima orang yang ingin melepaskan hajatan bila maksud seseorang tercapai. Dia mengatakan, bagi siapa saja berkaoy, berarti sudah mengikatkan diri pada sesuatu yang sebetulnya tidak wajib menjadi wajib dilakukan. Sejauh ini, orang-orang yang mengalami sakit tidak wa-

jar ada kaitannya dengan kaoy di masa lalu. Setelah melakukan ikhtiar dengan berobat dan menghabiskan banyak uang, tetapi tidak sembuh juga. Setelah diselidiki melalui jalan mendatangi teungku atau orang pintar, dapatlah petunjuk bahwa penyebabnya adalah kaoy yang belum ditunaikan. “Setelah kaoy dilaksanakan, penyakit pun sembuh total,” lanjut Rusli. Hal-hal semacam ini memang sulit ditemui logika, tetapi

kenyataan dapat dilihat secara langsung. Itulah sebabnya, sebagian orang masih meyakini betul untuk menempuh jalan dengan ber-kaoy, sebagaimana yang dilakukan pula oleh ibuibu yang mencemaskan anaknya pada masalah perang dulu. Mereka bernazar terhadap anaknya yang meninggalkan rumah, bahwa bila anaknya kembali dalam keadaan selamat kelak, akan menyembelih seeokor kambing untuk diberi-

kan pada anak yatim. Sebagaimana yang dialami Muhammad Thaib, ibunya benazar menyembelih seekor kambing untuk dikendurikan pada anak yatim dan teungku, bila kombatan ini pulang dalam keadaan selamat. Sehabis perang, lelaki ini pulang dengan tubuhnya yang kurus, dan ibunya menyembelih seekor kambing untuk menunaikan janjinya. Arafat Nur



WASPADA Kamis 6 Februari 2014

Gerakan 5000 Untuk Korban Bencana LANGSA (Waspada): Bencana yang melanda Indonesia saat ini seperti banjir dan erupsi gunung berapi telah melahirkan rasa solidaritas dalam masyarakat. Tidak ketinggalan, para mahasiswa/i LP3I Langsa juga ikut berperan aktif menggalang dana untuk membantu mereka yang membutuhkan uluran tangan sesama. Branch Manager LP3I Cabang Langsa, M Ridwansyah kepada Waspada di Langsa, Rabu (5/2) mengatakan, kegiatan penggalangan bantuan yang dilakukan para mahasiswa/i LP3I dengan membuat gerakan 5000, yakni mecari sumbangan kepada para dermawan dengan nominal Rp. 5000 per orang lalu kepada penyumbangnya diberikan sovenir sebagai kenang-kenangan. Sumbangan yang terkumpul tersebut, tambahnya, akan disatukan lagi dengan sumbangan yang dikumpulkan oleh cabang-cabang LP3I lainnya di seluruh Indonesia, kemudian akan diserahkan kepada para korban bencana banjir dan erupsi gunung berapi.(b20)

BNN Langsa Perangi Narkoba LANGSA (Waspada): Dalam upaya pencegahan dari bahaya penyalahgunaan narkoba di masyarakat, Seksi Pemberdayaan Masyarakat Badan Narkotika Nasional (BNN) Kota Langsa menyelenggarakan berbagai program untuk meminimalisir penyalahgunaan narkoba melalui program Fokus Group Discussion (FGD) di kalangan masyarakat. Demikian dikatakan Kepala BNN Kota Langsa, AKBP Navri Yulenny melalui Kasie Pemberdayaan Masyarakat Fitriani, kepada wartawan, Selasa (4/2). Menurutnya, program yang telah kita laksanakan selama Januari yakni melakukan test urine dengan drug test panel di Batalyon Infantri 111/Raider, Senin (13/1), melakukan Fokus Group Discussion (FGD) pemberdayaan alternatif bagi instansi dan tokoh masyarakat, Kamis (23/1). Tujuan dari FGD ini, untuk mengumpulkan informasi, masukan dan saran dalam rangka pemberdayaan alternatif perkotaan dan memberikan informasi tentang pelaksanaan fasilitas kegiatan program pemberdayaan alternatif masyarakat anti narkoba. (m43)

Pemkab Aceh Timur Diminta Aspal Jalan LANGSA (Waspada): Pemkab Aceh Timur diminta melakukan pengaspalan jalan di sejumlah gampong di Kecamatan Rantau Seulamat, Kab. Aceh Timur, meliputi Gampong Bayeun, Simpang Aneuh dan Simpang Peut. Pasalnya sekarang jalan di tiga desa itu mengalami kerusakan cukup parah, sulit dilalui kendaraan. Tokoh pemuda setempat, Muchlis kepada wartawan, Selasa (4/2) mengatakan, kondisi jalan itu semakin parah ketika musim penghujan tiba, sehingga sulit dilalui kendaraan roda dua maupun roda empat. Hal ini jelas-jelas menyengsarakan masyarakat yang melalui jalur tersebut guna menuju pusat kota dan sebaliknya. Menurutnya, kondisi jalan rusak tersebut sudah berlangsung lama, namun warga kecewa karena hingga kini belum ada respon dan perhatian dari pemerintah setempat. Dirinya mewakili masyarakat khususnya di tiga gampong di wilayah Kecamatan Rantau Seulamat, mengharapkan Pemkab Aceh Timur membangun jalan daerah mereka. (cms)

Data Nikah Mulai Online IDI (Waspada): Guna memudahkan masyarakat dalam mengakses data secara menyeluruh di Indonesia, jajaran Kementerian Agama (Kemenag) RI mulai memanfaatkan Sistem Informasi Manajemen Nikah (SIMKAH) secara online. “Kebanyakan data-data di Kantor Urusan Agama (KUA) di kecamatan belum lengkap dan banyak yang masih amburadul sehingga perlu dilakukan beberapa langkah, termasuk SIMKAH yang sedang dilakukan pemantapan,” kata Kepala Kantor Kemenag Aceh Timur Faisal Hasan melalui Kasi Bimas Akli Zikrullah di Idi, Selasa (4/2). Akli menyebutkan, peserta yang mengikuti pemantapan SIMKAH sebanyak 30 tenaga operator dari 21 KUA di wilayah kerjanya. Dia mengaku, kegiatan tersebut merupakan lanjutan dari kegiatan pemantapan sebelumnya. (b24)

Waspada/M. Ishak

Waspada/M. Ishak

TERSANGKA dikawal ketat petugas kepolisian yang ikut menyaksikan pemusnahan ganja di halaman Mapolres Aceh Timur di Peudawa, Rabu (5/2).

KASAT Narkoba Polres Aceh Timur AKP Adi Sofyan ikut memusnahkan barang bukti ganja di halaman Mapolres Aceh Timur, Rabu (5/2).

Ganja Aceh Tembus ‘Pasar’ Internasional PEUDAWA (Waspada): Narkoba jenis ganja asal Aceh diperkirakan tembus ‘pasar’ Internasional. Indikasi itu tercium dalam beberapa kali pengungkapan kasus ganja di Satuan Narkoba Polres Aceh Timur awal Januari 2014 dan Juli 2013 lalu. Juli 2013 lalu kita tangkap ganja asal Aceh Besar hendak

diselundupkan ke Sumatera Utara sebanyak lebih kurang 3 ton dalam sebuah truk jenis Colt Diesel. Lalu, Januari lalu kita amankan lebih kurang 1 ton dalam dua mobil jenis Avanza dan Xenia ditangkap di Idi Cut hendak diangkut ke Sumatera Utara, 5 Januari lalu. Jumlah ganja yang banyak ini kita perkirakan tak hanya dipasarkan dalam negeri, tapi juga ke luar negeri,” kata Waka Polres Aceh Timur Kompol ErlinTangjaya melalui Kasat Narkoba, AKP Adi Sofyan kepada Waspada disela-sela

Murid TK Keumala Bhayangkari Pawai Pelopor Berlalu Lintas BIREUEN (Waspada) : Seratusan murid Taman Kanak-kanak Keumala Bhayangkari Bireuen menggelar pawai Pelopor Keselamatan Berlalu Lintas keliling Kota Bireuen dan Matang Glumpang Dua, Rabu (5/2). Pawai murid Taman Kanak Keumala Bhayangkari yang dibimbing oleh para ibu gurunya menggunakan beberapa buah mobil turut dipandu mobil patroli Satuan Lalu Lintas Polres Bireuen. Pawai pelopor Keselamatan Berlalu Lintas murid TK Keumala Bhayangkari yang mengenakan seragam Polisi Lalu Lintas dan Polwan telah menarik perhatian masyarakat kota Bireuen dan kota Matang Glumpang Dua dalam berlalu lintas harus mengutamakan keselamatan tidak ugal-ugalan di jalan raya. (b12)

beberapa negara tetangga, seperti Malaysia dan Thailand,” kata Adi Sofyan. Kasat Narkoba menyebutkan, 1 ton ganja yang dimusnahkan pihaknya barang bukti (BB) ganja berdasarkan LP-A/02/I/ 2014/Aceh/Res Atim, tanggal 5 Januari 2014 dengan barang bukti 802 kilogram dan tersangka berinisial AS alias AN Bin AH. Selanjutnya, ganja dimusnahkan berdasarkan LP-A/06/I/ Aceh/Res Atim tanggal 12 Januari 2014, berat total yakn 27 kilogram dengan tersangka

MUR Bin HAS dan MZ Bin US. Selanjutnya, ganja yang dimusnahkan juga bersadarkan LPA/07/1/2014/Aceh/Res Atim tanggal 13 Januari 2014, berat ganja 22 kilogram dengan tersangka SOF Bin YUS. “Masingmasing kasus sudah kita sisihkan barang bukti (BB) ganja untuk pemeriksaan di Laboratorium Forensi (Lapfor) Medan,” kata AKP Adi Sofyan. Dalam pemusnahan barang bukti (BB) ganja kali ini hadir antara lainWaka Polres Aceh Timur Kompol Erlin Tangjaya,

Kasat Narkoba AKP Adi Sofyan, Kajari Idi Hasanuddin SH, dr.Zulfikry, M.Mkes (Dinkes Aceh Timur) dan perwakilan Pengadilan Negeri (PN) Idi, Kepala Badan Kesbangpol Aceh Timur M. Amin SH. “Kita harap masyarakattidakbermain-maindengan ganja baik menjadi agen (pengedar—red),penyimpan,pedagang, pemakai atau dalam posisi apapun, karena polisi tidak pernah bernegosiasi dalam penegakan hukum, terutama dalam memerangi narkoba jenis apapun,” tandas AKP Adi Sofyan. (b24)

Kejari Tahan Tiga Tersangka Kasus Dugaan Warga Aceh Tamiang Dipolisikan Korupsi Pasar Pagi Kualasimpang Di Banda Aceh KUALASIMPANG (Waspada) : Kejaksaan Negeri (Kejari) Kualasimpang menahan tiga dari lima orang yang telah ditetapkan sebagai tersangka dalam kasus dugaan tindak pidana korupsi (Tipikor) proyek Pasar Pagi Kota Kualasimpang, Aceh Tamiang yang menyebabkan kerugian negara mencapai Rp3 miliar. Kajari Kualasimpang Amir Syarifuddin didampingi Kasi Intel Mohammad Iqbal, Rabu (5/2) menerangkan, adapun tiga tersangka itu, Ir (Kadiskoperindag Aceh Tamiang), Sur dan Dar (PT GKN) yang melaksanakan

proyek Pasar Pagi Kualasimpang yang sumber dananya berasal dari APBN dengan total anggaran Rp7,5 miliar dan nilai kontrak Rp6,9 miliar pada tahun 2011. Menurut Iqbal, ketiga tersangka pada Selasa (4/2) mulai dari pagi sampai sore diperiksa secara marathon oleh jaksa di Kejaksaan Negeri Kualasimpang dan selanjutnya setelah ada bukti yang kuat tentang indikasi ada perbuatan melawan hukum dan estimasi kerugian negara sehingga ketiga tersangka langsung ditahan dan diboyong ke Lembaga Pemasyarakatan Kua-

Ikaba Gelar Lomba Layang Tunang KUALASIMPANG (Waspada): Ikatan Keluarga Aceh Besar dan Banda Aceh (Ikaba) Aceh Tamiang akan menggelar lomba layang tunang (Aceh) tahun 2014 se-Aceh Tamiang dan Kota Langsa yang dijadwalkan berlangsung pada 9 Maret 2014 di Lapangan Depan Stadion Tanah Terban, Karang Baru, Aceh Tamiang. Ketua panitia lomba Layang Tunang, Ramlan Irwandy yang didampingi sekretaris panitia, Muhammad Nawi, Senin (3/2) menerangkan, lomba layang tunang (Aceh) yang mereka laksanakan itu diselenggarakan oleh Ikaba Aceh Tamiang . Ramlan menjelaskan, lomba layang tunang tersebut pesertanya terbuka untuk warga di Kabupaten Aceh Tamiang dan Kota Langsa . Ramlan juga menerangkan, tujuan penyelenggaraan kegiatan tersebut untuk menggalakkan dan melestarikan seni budaya tradisional yang ada di Aceh Ramlan menyarankan bagi warga Aceh Tamiang dan Kota Langsa yang berminat boleh mendaftarkan diri pada panitia di sekretariat panitia, Jln H Juanda, Kampung Tanah Terban, Karang Baru, Aceh Tamiang atau menghubungi nomor kontak person HP 085275992402 atau 081361630246. Pendaftaran dibuka 1 Februari- Maret 2014. (b23)

pemusnahan 1 ton ganja di halaman Mapolres Aceh Timur, Rabu (5/2). Dia menambahkan, ganja (bakong ijoe—Aceh) selama ini rata-rata dipasarkan di Pulau Sumatera dan Pulau Jawa. Dalam sejumlah pemeriksaan, tersangka mengakui ganja dari Aceh rata-rata diangkut dan transit ke Sumatera Utara. “Untuk dipasarkan disejumlah provinsi sudah pasti, karena ganja dari Aceh diangkut ke Sumatera dan juga ke Jawa, tapi tak tertutup kemungkinan dipasarkan ke


DOKTER sedang memeriksa kesehatan tersangka kasus tindak pidana korupsi proyek Pasar Pagi Kualasimpang. Pemeriksaan berlangsung di Kejari Kualasimpang, Selasa (4/2)

lasimpang sebagai tahanan Kejari Kualasimpang. Sedangkan dua tersangka lagi yaitu Jaf yang bertugas di Dinas Koperindag Aceh Tamiang dan JR sebagai pegawas proyek tersebut belum ditahan karena sedang sakit dan jaksa sedang memperdalam kasus tersebut. Menurut Iqbal, modus operandi sehingga munculnya kerugian negara dalam proyek tersebut karena keterlambatan penyelesaian pekerjaan dan ternyata ada dugaan bank garansi yang tidak diklaim . Selain itu, imbuh Iqbal, ada juga unsur kerugian negara dari konstruksi pekerjaan fisik bangunan ada selisih dalam hal nilai phisiknya. “Kita masih menunggu hasil audit dari BPKP Provinsi Aceh untuk meng-hitung kerugian negara dalam proyek ini. Biasanya hitungan estimasi kerugian negara yang diperkirakan oleh Kejari dengan hasil BPKP hanya beda-beda tipis saja,” tegas Iqbal. Kasi Intel Kejari Kualasimpang itu juga menyatakan tersangka yang terlibat dalam kasus ini akan dijerat dengan Undang-Undang (UU) Nomor 31 Tahun 1999 Tentang Pemberantasan Tindak Pidana Korupsi Junto UU Nomor 20 tahun 2001 Tentang Perubahan atas UU Nomor 31 Tahun 1999 tentang Pemberantasan Tipikor. (b23)

KUALASIMPANG (Waspada): Zul, 48, warga Aceh Tamiang yang diduga melakukan pemalsuan tanda tangan dan berkas untuk keperluan leasing truk Mitsubishi BK 9443 BR pada PT FIAL, Jalan Luengbata telah dilaporkan ke Polresta Banda Aceh. Informasi diperoleh, Rabu (5/2), Zul dilaporkan sesuai tanda bukti lapor Nomor:LPB/5/ I/2014/SPK yang ditandatangani Brigadir Polisi Satu, Syahrul. Dalam laporan polisi tersebut dijelaskan tentang Zul yang diduga melakukan tindak pidana pemalsuan surat akta-akta otentik, surat utang atau sertifikasi hutan, surat sero, talon, surat kredit atau surat dagang serta ada dugaan memalsukan tanda tangan SU, warga Karya Desa Kota Kualasimpang, Kecamatan

Kota Kualasimpang. Terkait adanya laporan tersebut, SU ketika dikonfirmasi, Rabu (5/2) membenarkan dirinya sudah melaporkan Zul kepada polisi di Banda Aceh. “Tanda tangan saya dan berkas-berkas untuk urusan leasing truk BK 9443 BR milik saya itu sudah dipalsukan dan saya telah menyerahkan kasus tersebut untuk diusut atau proses polisi,” tegasnya. Sedangkan Zul yang berulangkali ingin dikonfirmasiterkaitkasusitubelumberhasildimintai komentarnya karena berulangkali dihubungi ternyata nomor telepon genggamnya tidak aktif. Kasat Reskrim Polresta Banda Aceh, Kompol Supriadi, Rabu (5/2) belum bisa berkomentar tentang kasus tersebut. (b23)

FK Unsyiah Lantik Dokter Spesialis Ilmu Penyakit Dalam BANDA ACEH (Waspada): Fakultas Kedokteran Universitas Syiah Kuala (FK Unsyiah) kembali melantik dua dokter Spesialis Ilmu Penyakit Dalam periode ke-2 di Aula FK Unsyiah, Banda Aceh, Rabu (5/2). Pelantikan ini dipimpin Dekan FK Unsytiah, Dr dr Mulyadi, Sp. P (K). Acara ini dihadiri Pembantu Rektor IV Unsyiah, Prof Dr Ir Darusman, M.Sc, Direktur Rumah Sakit Umum Zainal Abidin, Dr dr Syahrul, Sp.S (K), serta Dekan Fakultas Kedokteran Gigi dan Dekan Fakultas Ilmu Keperawatan Unsyiah. Dua Dokter Spesialis Penyakit Dalam yang dilantik tersebut yaitu dr Cut Mela Yunita Sari,SpPD yang berasal dari instansi Pemerintah

Daerah Sigli dan dr Mawaddah Fitria, SpPD asal instansi Pemerintah Daerah Lhokseumawe. Mulyadi, dalam sambutannya berharap kepada yang dilantik semoga dapat menjalankan tugas serta profesinya menjalani dengan sebaikbaiknya dalam bermasyakarat, berbangsa dan bernegara. Dia menambahkan kepada siapapun lulusan dari FK Unsyiah, jangan sesekali melupakan sejarah. Fakultas Kedokteran merupakan salah satu fakultas yang sedang berkembang pesat. Baru-baru ini fakultas ini telah melahirkan dua fakultas baru yang dahulu bernaung di bawahnya, yaitu Fakultas Keperawatan dan Fakultas Kedokteran Gigi. (b07)

Tolak Pembongkaran Lapak, Pedagang Demo DPRK Langsa LANGSA (Waspada): Menolak pembongkaran lapak pedagang kain di kawasan Blok A yang akan dilakukan Pemerintah Kota Langsa, puluhan pedagang kain mendatangi DPRK Langsa meminta agar lapak mereka jangan dibongkar, Rabu (5/2). Sesampainya di DPRK Langsa, perwakilan pedagang melakukan pertemuan yang diterima Wakil Ketua T Hidayat yang dihadiri Camat Langsa Kota, Muhammad Jamil. Rahmi, seorang pedagang kain mengatakan, pada prinsip-

nya mereka sepakat dan mendukung upaya Pemko Langsa yang melakukan penataan pasar dan percepatan pembangunan Blok A. Tapi, mereka mohon agar pemerintah memberikan waktu bagi kami untuk tetap menempati lapak yang ada di kawasan pasar Blok A, sampai siap lebaran atau pun sampai pembangunan lapak sementara di jalan Pabrik Es selesai sebagaimana direncanakan oleh pemerintah,sehinggatidakterlantar. Wakil Ketua DPRK Langsa T Hidayat mengatakan, pihak-

nya akan menampung semua aspirasi tersebut. Namun, dirinya berharap agar pedagang paham dan mendukung program pemerintah dalam melakukan penataan pasar Langsa supaya tidak amburadul dan kumuh seperti sekarang ini. Plt Camat Langsa Kota, Muhammad Jamil menegaskan, upaya pembongkaran lapak pedagang kain di pasar baru Blok A itu adalah untuk proses percepatan pembangunan pasar blok A yang sedang dalam pengerjaan. (cms)

Bupati Aceh Selatan: BLU Itu Bukan Swastanisasi MEDAN (Waspada): Bupati Aceh Selatan H.T. Sama Indra menegaskan, Badan Layanan Umum (BLU) itu bukanlah swastanisasi, namun esensi BLU itu adalah meningkatkan pelayanan kepada masyarakat melalui pemberian “otonomi”

pengelolaan (khususnya pengelolaan keuangan). “Saya berharap setelah RSUD dr. H. Yuliddin Away ini menjadi BLUD, Pemimpin BLUD dan Jajaran Manajemen rumah sakit dapat berkerjasama dan saling berkordinasi dan


BUPATI Aceh Selatan H.T. Sama Indra saat menerima kartu BPJS Kesehatan dari Kepala BPJS Kesehatan Cabang Meulaboh SriYulizar Pohan, Selasa (4/2) kemarin

berkonsultasi dengan lintas sektor terkait, terutama dengan Dewan Pengawas BLUD,” kata Sama Indra saat meresmikan Peluncuran Pola Pengelolaan Keuangan (PPK) - BLUD dan Peresmian Unit Perawatan Intensif Psikiatri (UPIP) dan BPJS Center di RS dr. H.Yuliddin Away, Selasa (4/2). Dia juga mengatakan, amanah yang diberikan kepada seluruh karyawan rumah sakit ini, bahwa menjadi BLUD itu berarti mengubah budaya kerja, mindset harus ikut berubah. Tadinya biasa dilayani, sekarang melayani. Tadinya pasien butuh RS, sekarang RS yang butuh pelanggan. Tadinya uang disetor ke Pemda, sekarang bias dikelola sendiri di rekening BLU RSUD. “Jika mindset tidak berubah, bisa dibayangkan bagaimana saudara dapat melakukan peningkatan kualitas pelayanan

kepada masyarakat?” tanya Sama Indra. Sementara itu, Direktur RSUD dr. H. Yuliddin Away Dr. Akmal Jawardi mengatakan, fasilitas pelayanan yang ikut diresmikan pada acara yang sama adalah gedungUnit Perawatan Intensif Psikiatri (UPIP). Mengingat sangat dibutuhkannya layanan kesehatan jiwa (psikiatri) seiring dengan banyaknya kasus gangguan jiwa di Kabupaten Aceh Selatan. “Maka sudah waktunya RS ini memiliki UPIP agar lebih mudah dijangkau oleh masyarakat, sehingga diharapkan masyarakat dapat mencegah kemungkinan penyakitnya lebih parah atau untuk mengurangi kemungkinan komplikasi yang dapat timbul,” imbuhnya. Sedangkan gedung BPJS Center, yang dibangun dan dihibahkan oleh PT. Askes (Persero) (sekarang BPJS Kesehatan-red)

pada akhir tahun 2013 lalu diharapkan memberikan kemudahan dan kenyamanan bagi pengunjung rumah sakit khususnya peserta BPJS Kesehatan dalam memperoleh layanan informasi,pendaftarandanproses administrasiyangcepatdantepat. Acara peresmian dihadiri oleh Kepala BPJS Kesehatan Cabang Meulaboh Sri Yulizar Pohan. Pada kesempatan tersebut Kepala BPJS Kesehatan Meulaboh juga menyerahkan kartu BPJS Kesehatan kepada Bupati beserta keluarga. Hadir jugaWakil DPRK Aceh Selatan, Sekretaris Daerah, Para Asisten, Staf Ahli dan para Kabag dilingkungan Pemkab Aceh Selatan, Direktur RS Jiwa Banda Aceh, Para Kepala SKPK dilingkungan Pemkab Aceh Selatan, Ketua ARSADA Aceh diwakili Sekretarisnya, Para Kepala Puskesmas dan Perawat Kesehatan Jiwa Masyarakat Kabupaten Aceh Selatan. (rel/h02)

Waspada/Muhammad Hanafiah

ANGGOTA DPRA Jamaluddin T Muku berdialog dengan warga Kampung Durian, Rantau, terkait proyek transmisi pemasangan pipa.

Warga Stop Proyek Transmisi Pipa Gas KUALASIMPANG (Waspada): Warga Kampung Durian, Kecamatan Rantau, Aceh Tamiang yang kecewa dengan sikap perusahaan yang belum mau membayar ganti rugi tanaman milik warga yang terkena proyek transmisi pemasangan pipa gas dari Aceh ke Belawan (Sumut), melakukan aksi menghentikan alat berat (bechoe) dan melarang para pekerja yang sedang mengerjakan proyek senilai Rp17 triliun tersebut. “Tanaman kami yang terkena imbas proyek pemasangan pipa gas ini sudah lama dijanjikan akan dibayar, tapi sampai saat ini pihak perusahaan belum juga membayar,” ungkap warga Kampung Durian di hadapan anggota DPRA, Jamaluddin T Muku yang datang ke lokasi proyek. Menurut warga, sebelum proyek itu, perangkat desa pernah mensosialisasikan kepada

warga bahwa tanaman warga yang terimbas akibat adanya proyek pemasangan pipa gas akan dibayar terlebih dahulu ganti rugi. Ketua Majelis Duduk Setikar Kampung (MDSK) Durian Afrinal menjelaskan pihaknya sudah pernah mengikuti sosialisasi yang diselenggarakan perusahaan, Pemkab Aceh Tamiang di SKB Karang Baru. “Tetapi buktinya tanaman dan harta milik warga terkena gara-gara proyek tidak dibayar dan pihak perusahaan terus kerja,” tutur Afrinal. Anggota DPRA, Jamaluddin T Muku menyatakan proyek transmisi pipa gas ini dibangun untuk terminal gas sebagai upaya aset PT Arun di Lhokseumawe tidak menjadi besi tua nanti ketika gasnya sudah habis. “Saya minta pihak perusahaan yang mengerjakan proyek ini supaya secepatnya membayar ganti rugi kepada warga,” kata Jamaluddin. (b23)

Waspada, kamis 6 februari 2014 ok