Issuu on Google+

Mau Di Mana Anda Shalat Jumat...? Lihat hal. C4-C5 Masjid Raya Medan

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Kliwon, 27 Januari 2012/3 Rabiul Awal 1433 H

No: 23756 Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

Bima Rusuh

Antara

WARGA melintas di samping bangunan KPUD Bima yang dibakar massa saat terjadi aksi ribuan pengunjukrasa menduduki kantor Bupati Bima, Kab. Bima, NTB, Kamis (26/1).

MATARAM (Antara): Sepuluh ribu lebih warga mengamuk dan membakar kantor Bupati Bima terkait penanganan insiden di Pelabuhan Sape, 24 Desember 2011. Selain kantor bupati, juga kantor KPUD Bima, sepedamotor dan kendaraan lain yang ada di area itu. Peristiwa itu terjadi Kamis (26/1), ketika mereka dihadang saat akan berunjukrasa menyampaikan aspirasi terkait penahanan rekan mereka dalam kasus Pelabuhan Sape. “Informasi yang kami terima, yang dibakar Kantor Bupati Bima, Kantor KPUD Bima yang berada di kawasan itu,” kata Kepala Bidang Hubungan Masyarakat Polda Nusa Tenggara Barat (NTB) AKBP Sukarman Husein di Mataram, Kamis. Sepuluh ribuan warga dari Kec. Lambu, Sape dan Langudu itu dihadang aparat kepolisian dan Satuan Polisi Pamong Praja (PP), karena para pengunjuk rasa hendak menduduki kantor bupati. Massa berasal dari ketiga kecamatan itu juga berunjuk rasa dan memblokade jalan di Pelabuhan Sape, pada 19-24 Desember 2011, yang baru bubar setelah dibubarkan paksa oleh aparat Lanjut ke hal A2 kol. 3

Antara

DUA anggota TNI siaga di kantor bupati yang dibakar massa saat terjadi aksi ribuan pengunjukrasa menduduki kantor Bupati Bima, Kabupaten Bima, NTB, Kamis (26/1).

Miranda Tersangka JAKARTA (Waspada): Disebutnya ada tersangka baru oleh KPK dan dikaitkan dengan adanya huruf “A”, terkuak sudah. Ternyata bukan petinggi Demokrat Anas Urbaningrum dan Angelina Sondakh yang menjadi tersangka seperti dugaan wartawan di Jakarta (Waspada 26/1), melainkan Miranda Goeltom. reuters

Miranda Goeltom

Komisi Pemberantasan Korupsi (KPK) resmi menetapkan

Miranda sebagai tersangka baru kasus dugaan suap dalam pemi-

lihan dirinya sebagai Deputi Gubernur Senior Bank Indonesia periode 2004. Ketua KPK Abraham Samad di Jakarta, Kamis (26/1) menyatakan KPK telah memegang bukti kuat keterlibatan Miranda. Berdasarkan hasil ekspos yang telah dilakukan pada Rabu (25/1), maka status Miranda

Swaray Goeltom yang sebelumnya hanya saksi dapat ditingkatkan menjadi tersangka. Terkait dugaan suap terhadap sejumlah anggota dewan periode 1999-2004, KPK baru menetapkan satu orang tersangka selaku pihak pemberi suap, yakni Nunun Nurbaeti.

Lanjut ke hal A2 kol. 3

Bupati Palas Ditangani Poldasu

Gelombang Tinggi, Perairan Indonesia Tidak Kondusif

MEDAN (Waspada): Polda Sumut akan menarik kasus dugaan korupsi Dana Alokasi Khusus dan Dana Alokasi Umum (DAK/DAU) Tahun 2009 Kab. Padang Lawas (Palas), yang menjadikan Bupati Palas BL sebagai tersangka dari Polres Tapanuli Selatan. “Kita akan tarik kasusnya ke Polda, karena salah seorang tersangka masih menjabat sebagai bupati aktif, sehingga memerlukan prosedur panjang untuk pemeriksaannya dan harus ada izin Presiden,” kata Direktur Dit Reserse Kriminal Khusus (Krimsus) Polda Sumut Kombes Pol. Sadono Budi Nugroho kepada wartawan di Mapoldasu, Kamis (26/1). Sehari sebelumnya, Krimsus Poldasu melakukan gelar perkara kasus itu, kemudian menetapkan BL sebagai tersangka kasus korupsi DAK/ DAU 2009 Pemkab Palas. Selain BL, empat pejabat Pemkab Palas juga ditetapkan sebagai tersangka kasus tersebut. Kasus yang menjerat BL terjadi saat pembangunan prasarana perkantoran (proyek multi years) senilai Rp6,7 miliar yang dibangun di atas tanah

JAKARTA (Antara): Badan Meteorologi Klimatologi dan Geofisika mengatakan, tinggi gelombang di berbagai perairan Indonesia mencapai 2,5 meter. Oleh karena itu, nelayan diminta waspada karena perairan wilayah Indonesia sedang tidak kondusif hingga satu-tiga hari ke depan. “Adanya badai karena pertumbuhan bibit badai di Samudera Hindia sebelah selatan Jawa dan Laut Timor selain menyebabkan angin kencang juga gelombang tinggi di perairan,” kata Kepala Informasi Meterologi BMKG Hary Tirto Djatmiko, kemarin. Hary menjelaskan, Rabu (25/1) malam telah terjadi badai Iggy di Samudera Hindia sebelah selatan Jawa. Pergerakan badai Iggy menuju Australia Barat dan menjauhi Indonesia. Gelombang tinggi mencakup berbagai perairan di Indonesia mulai dari Laut China Selatan, perairan Natuna, perairan Kepulauan Riau, Selat Karimata, Laut Jawa, perairan Masalembo, Selat Makassar bagian selatan, Laut Flores, Banda Arafuru, selatan Samudera Hindia sebelah barat daya Sumba hingga Laut Timor, Laut Sulawesi, perairan sekitar Halmahera, dan perairan utara Papua.

Lanjut ke hal A2 kol. 2

Waspada/ME Ginting

WALI Kota Medan Rahudman Harahap menyemprot unggas di pasar burung Jalan Bintang Medan untuk mengantisipasi terjadinya virus flu burung, Kamis (26/1).

Antisipasi Flu Burung, Rahudman Semprot Disinfektan MEDAN (Waspada): Wali Kota Medan Rahudman Harahap melakukan penyemprotan bahan kimia anti flu burung di lokasi yang terdapat unggas untuk mengantisipasi penyebaran virus flu burung di Kota Medan. Lokasi penyemprotan antara lain, pasar burung Jalan Bintang Medan, Kamis (26/1). Wali Kota Medan Rahudman Harahap, didampingi Ke-

pala Dinas Pertanian dan Kelautan (Distanla) Kota Medan menyebutkan, kegiatan tersebut untuk mengantisipasi masuknya virus flu burung di Medan. Selama ini beberapa kota di Indonesia sudah terjangkit virus mematikan ini seperti di Jakarta dan Banten. “Kepada masyarakat kita mengharapkan agar memelihara kebersihan dan segeralah

laporkan ke aparat setempat jika ada unggas yang tiba-tiba mati,” kata Rahudman. Kepala Dinas Pertanian dan Kelautan MedanWahid mengatakan, kegiatan itu dilakukan menyahuti perintah Wali Kota Medan, yakni memonitor pusat-pusat burung dan unggas di Medan terkait maraknya flu

Lanjut ke hal A2 kol. 3

Dosa Perusak Ibadah Oleh Muhammad Arif Fadhillah Lubis, SHI, MSI

Lanjut ke hal A2 kol. 3

Angelina Sondakh

Posisi Yakin Tak Tak Goyah Ditangkap INDRAMAYU (Waspada): Ketua Umum Partai Demokrat Anas Urbaningrum memberikan tanggapan seputar isu rencana pelengseran dirinya dari jabatan puncak di partai tersebut. Anas menegaskan, posisinya sebagai Ketua Umum Partai Demokrat tidak bisa digoyahkan. Menurut Anas, posisinya tetap kuat di Demokrat. “Tidak ada pelengseran. Ketua Umum Partai Demokrat hanya satu, yaitu Anas Urbaningrum,” tegas Anas di Indramayu, Jawa Barat, Kamis (26/1). Anas menekankan, isu pelengseran dirinya hanya rumor tak berdasar. Sampai saat ini, kata dia, Partai Demokrat tetap bersatu di bawah kepemimpinannya. Lanjut ke hal A2 kol. 3

JAKARTA (Waspada): Anggota Komisi X DPR, Angelina Sondakh, mengaku tak habis pikir mengapa namanya kerap disebut dalam kasus suap Wisma Atlet terutama dalam sidang M Nazaruddin. “Saya tidak faham, kenapa nama saya ditarik-tarik terus dalam kasus Wisma Atlet SEA Games Palembang. Tapi kalau dilihat latar belakang orang tersebut, saya paham skenario ini,” kata perempuan yang kerap disapa Angie dalam rilisnya, Kamis (26/1). Angie meminta kepada Nazaruddin dan para saksinya untuk berkata jujur bahwa dirinya tidak pernah terlibat dalam proyek Wisma Atlet. “Bicara sama mereka saja tidak penah, apalagi minta dan menerima.Tolong jangan diskenariokan dan direkayasa cerita-cerita Lanjut ke hal A2 kol. 3

‘’Kami Pulang Masuk VIP Room Seperti Pejabat Penting’’ TIDAK Seperti biasanya,VIP Bandara Polonia Medan selalu dipergunakan tamu-tamu penting seperti presiden, menteri, gubernur dan setingkat pejabat negera. Namun, kali ini 11nelayan yang baru bebas dari penjara Pokok Sena Malaysia, juga menggunakan VIP room Bandara itu, Kamis (26/1). Suasana suhu udara yang begitu terik mencapai 33 derajat Celcius, tidak membuat mereka lelah saat mendarat di Bandara Polonia Medan dengan penerbangan Lion Air JT-1285 pukul 12:25 dari Penang.

Saat turun dari mobil pengantar dari pesawat ke VIP room, terlihat wajah-wajah gembira terhias dari bibir nelayan asal Batubara dan nelayan Paluh Sibaji Deliserdang. Kebetulan yang menyambut mereka saat itu Dirjen Pengawasan Sumber Daya Kelautan dan Perikanan Syahrin Abdurrahman, Bupati Batubara OK. Arya Zulkarnain, Wabup Deliserdang H. Zainuddin Mars serta Kadis Kelautan dan Perikanan Sumut H. Zulkarnain.

Waspada/Surya Efendi

TAMU WASPADA: Utusan Khusus Republik Seychelles untuk ASEAN Nico Barito (tengah) didampingi Bupati Serdang Bedagai Erry Nuradi (kiri) berbincang dengan Pemred Harian Waspada Prabudi Said di BumiWarta Harian Waspada Medan, Kamis (26/1).

Seychelles Dorong Komoditas Sumut Masuk Pasar Afrika MEDAN (Waspada): Utusan Khusus Republik Seychelles untuk ASEAN mengajak pemerintah daerah, pebisnis dan para pemilik dana di Sumatera Utara memasuki pasar Afrika melalui negara tersebut. Ajakan itu disampaikan langsung Special Envoy (utusan khusus) Republik Seychelles untuk ASEAN, Nico Barito Lanjut ke hal A2 kol. 6

TEBINGTINGGI (Waspada): Empat Ruko tempat botot dan penyimpanan peralatan mesin (spare part) sepedamotor dan mobil di Km 2, Jalan Gatot Subroto, Kel. Lubuk Baru, Kec. Padang Hulu, Tebingtinggi, Kamis (26/1) dini hari, ludes terbakar. Belum diketahui asal api, pemilik ruko saat kejadian tidak berada di tempat. Penjaga gudang Syarifuddin sedang tertidur di sebelah ruko tersebut. Kuat dugaan api berasal dari korsleting listrik. Informasi diperoleh Waspada, api pertama kali berasal dari samping ruko atau gudang botot. Akibat angin kencang serta barang-barang yang mudah terbakar membuat api cepat merembet. Tiga unit

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 5

Ada-ada Saja

Empat Ruko Terbakar Di T. Tinggi

Al Bayan

“Kalau seorang Mukmin ditimpa musibah, kelelahan atau keresahan atau duri yang melukainya, maka ia menjadi penghapus pada dosa-dosanya.” Demikian redaksi hadis shahih dalam kitab hadis Bukhari-Muslim. Hadis ini menerangkan ada beberapa perkara yang mampu menghapus dosa kita sebagaimana redaksi hadis tersebut. Namun tidak sedikit atau paling tidak ada beberapa hal sebaliknya, yaitu dosa-dosa yang dilakukan banyak mengakibatkan ibadah atau tepatnya pahala terhapus. Di antaranya adalah memaki atau menggerutu yang bisa menghapuskan pahala sedekah. Demikian juga riya

net

net

Anas Urbaningrum

100 Tewas Akibat Obat Jantung

Waspada/Surya Efendi

PARA terdakwa mendapat pengawalan ketat polisi dari amukan keluarga korban pada sidang lanjutan di Pengadilan Negeri (PN) Medan, Kamis (26/1).

Sidang Lanjutan Pembunuh Pegawai BRI Syariah

Terdakwa Kena ‘Bogem’ MEDAN (Waspada): Sidang perampokan dan pembunuhan karyawan BRI Syariah Cabang Jalan S Parman Medan Sri Wahyuni Simangunsong diwarnai isak tangis ibu korban dan bogeman massa kepada terdakwa. Hal itu terjadi usai sidang lanjutan di Pengadilan Negeri (PN) Medan di ruang CakraVII, Kamis (26/1). Ketika terdakwa digiring petugas ke sel tahanan, massa keluarga korban yang telah menunggu di luar ruangan membogem para Lanjut ke hal A2 kol. 1

SEKURANG-kurangnya 100 orang tewas setelah memakan apa yang menurut para pejabat obat jantung yang diduga telah tercemar, di Lahore, Pakistan Timur, demikian menurut kementerian kesehatan Kamis (26/1). Pemerintah provinsi Punjab telah menutup pabrik Lanjut ke hal A2 kol. 8

Serampang - Sedap juga meliput ke Afrika - He...he...he...

Siapa Khatib Jumat Anda ? Lihat Hal. C4-C5

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Kliwon, 27 Januari 2012/3 Rabiul Awal 1433 H z zNo: 23756 * Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

BIMA RUSUH Kantor Bupati Dibakar, 53 Tahanan Dibebaskan Paksa

MATARAM (Antara): Sepuluh ribu lebih warga mengamuk dan membakar kantor Bupati Bima terkait penanganan insiden di Pelabuhan Sape, 24 Desember 2011. Selain kantor bupati, juga kantor KPUD Bima, sepedamotor dan kendaraan lain yang ada di area itu. Peristiwa itu terjadi Kamis (26/1), ketika mereka dihadang saat akan berunjukrasa menyampaikan aspirasi terkait penahanan rekan mereka dalam kasus Pelabuhan Sape. “Informasi yang kami terima, yang dibakar Kantor Bu-

pati Bima, Kantor KPUD Bima yang berada di kawasan itu,” kata Kepala Bidang Hubungan Masyarakat Polda Nusa Tenggara Barat (NTB) AKBP Sukarman Husein di Mataram, Kamis. Lanjut ke hal A2 kol 2

“Acara Sidang mendengarkan keterangan para pihak dan bersifat pleno,” tulis situs MK, Kamis (26/1). Dalam laman itu disebutkan kuasa pemohon yakni Drs. Ujang Sudirman, M.Si, Drs. Susilo, Drs. Dodi Riyatmadji, Prof. Dr. Zudan Arif Fakrulloh, SH, MH, Erma Wahyuni, SH, M.Si, dan Permelia Fabyane, Lanjut ke hal A2 kol 1

P.SIDIMPUAN (Waspada): Kapolres Tapanuli Selatan, AKBP Subandriya SH.MH, menyebut kasus dugaan korupsi yang melibatkan Bupati Kab. Padanglawas, BL, ditangani oleh Poldasu. “Urusan (penyidikan-red) Bupati dan Ketua DPRD Palas ditangani Polda. Mungkin pejabat daerah seperti Kadis PU, kita yang tangani,” kata Kapolres Tapsel kepada wartawan, Kamis (26/1). Ditanya kapan penyidikan itu dilakukan, Kapolres Tapsel belum bisa memastikan. Namun pihak Kepolisian sesegera mungkin melakukannya, karena korupsi merupakan perkara yang diprioritaskan penanganannya. “Penyidikan yang kita lakukan sebelum di Polres Tapsel baru sebagai penyidikan awal untuk mengumpul keterangan dan bukti-bukti. Setelah semua terkumpul, dilakukan gelar perkara di Polda,” jelasnya. Untuk diketahui, dugaan korupsi Dana Alokasi Khusus (DAK) dan Dana Alokasi Umum(DAU) sebesar Rp6.048.827.227,73 (berdasarkan audit BPKP) diduga melibatkan sejumlah pejabat. Seperti Bupati Palas, Ketua DPRD, Kadis PU dan sejumlah SKPD seperti Bappeda, Dispenda, dan PU. Lanjut ke hal A2 kol 5

Anas Tegaskan Posisinya Tidak Bisa Digoyahkan

Pagi Ini MK Gelar Sidang Sengketa Terkait Pilkada Aceh JAKARTA (Waspada): Mahkamah Konstitusi (MK),Jumat (27/1) pagi ini menggelar sidang Sengketa Kewenangan Lembaga Negara Direktorat Jenderal Otonomi Daerah Kementerian Dalam Negeri RI terhadap Komisi Independen Pemilihan (KIP) Aceh. Pemohonnya Direktorat Jenderal Otonomi Daerah Kementerian Dalam Negeri RI dengan termohon KIP Aceh.

Dugaan Korupsi Bupati Palas Ditangani Poldasu

Antara

WARGA melintas di samping bangunan KPUD Bima yang dibakar massa saat terjadi aksi ribuan pengunjukrasa menduduki kantor Bupati Bima, Kabupaten Bima, NTB, Kamis (26/1).

INDRAMAYU (Waspada): Ketua Umum Partai Demokrat Anas Urbaningrum memberikan tanggapan seputar isu rencana pelengseran dirinya dari jabatan puncak di partai tersebut. Anas menegaskan, posisinya sebagai Ketua Umum Partai Demokrat tidak bisa digoyahkan. Menurut Anas, posisinya tetap kuat di Demokrat. “Tidak ada pelengseran. Ketua Umum Partai Demokrat hanya satu, yaitu Anas Urbaningrum,” tegas Anas di Indramayu, Jawa Barat, Kamis (26/1). Anas menekankan, isu pelengseran dirinya hanya Lanjut ke hal A2 kol 2

Sidang Lanjutan Pembunuh Pegawai BRI Syariah

Terdakwa Kena ‘Bogem’ Dari Massa Korban MEDAN ( Waspada): Sidang perampokan dan pembunuhan karyawan BRI Syariah Cabang Jalan S Parman M e d a n S r i Wa h y u n i S i mangunsong diwarnai isak tangis ibu korban dan bogeman massa kepada terdakwa. Hal itu terjadi usai sidang lanjutan perampokan dan pembunuhan karyawan BRI Antara

FERI TERSERET ARUS. Sejumlah penumpang kapal feri Andhika Nusantara dievakuasi menggunakan perahu nelayan saat terdampar di perairan Labuhan Poh, Kecamatan Sekotong, Lombok Barat, NTB, Rabu (25/1). Kapal feri dari pelabuhan Padangbai Bali tujuan pelabuhan Lembar Lombok nyaris tenggelam akibat gelombang tinggi.

Gelombang Tinggi, Perairan Indonesia Tidak Kondusif JAKARTA (Antara): Badan Meteorologi Klimatologi dan Geofisika mengatakan tinggi gelombang di berbagai perairan Indonesia mencapai 2,5 meter. Oleh karena itu, nelayan diminta waspada karena perairan wilayah Indonesia sedang tidak kondusif hingga satu-tiga hari ke depan. “Adanya badai karena pertumbuhan bibit badai di Sa-

mudera Hindia sebelah selatan Jawa dan Laut Timor selain menyebabkan angin kencang juga gelombang tinggi di perairan,” kata Kepala Informasi Meterologi BMKG Hary Tirto Djatmiko, kemarin. Hary menjelaskan, Rabu (25/1) malam telah terjadi badai iggy di Samudera Hindia sebelah selatan Jawa. Pergerakan badai iggy menuju Australia Barat dan menjauhi Indonesia.

Gelombang tinggi mencakup berbagai perairan di Indonesia mulai dari Laut China Selatan, perairan Natuna, perairan Kepulauan Riau, Selat Karimata, Laut Jawa, perairan Masalembo, Selat Makassar bagian selatan, Laut Flores, Banda Arafuru, selatan Samudera Hindia sebelah barat daya Sumba hingga Laut Timor, Laut Sulawesi, perairan sekitar Halmahera, dan perairan utara Papua.

yang digelar di Pengadilan Negeri (PN) Medan di ruang Cakra VII, Kamis (26/1). Ketika terdakwa digiring petugas ke sel tahanan, massa keluarga korban yang telah menunggu di luar ruangan berhasil mencuri dengan membogem para terdakwa yang dikawal ketat oleh pihak kepolisian. Sebelumnya dalam sidang

lanjutan tersebut, Erwin Panjaitan, kembali tidak hadir, hanya tiga dari empat terdakwa yang hadir yaitu Ria Br Hutabarat, istri Erwin Panjaitan, Suherman alias Embot dan istrinya Eva Lestari Surbakti. Massa keluarga korban Sri Wa h y u n i y a n g s e b a g i a n Lanjut ke hal A2 kol 6

Miranda Gultom Resmi Tersangka JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) resmi menetapkan Miranda Gultom sebagai tersangka baru kasus dugaan suap dalam pemilihan dirinya sebagai Deputi Gubernur Senior Bank Indonesia periode 2004. Ketua KPK Abraham Samad di Jakarta, Kamis (26/1) menyatakan KPK telah memegang bukti kuat keterlibatan Miranda (foto). Berdasarkan hasil ekspos yang telah dilakukan pada Rabu (25/1), maka status Miranda yang tidak lain adalah Miranda Swaray Goeltom yang sebelumnya hanya saksi dapat ditingkatkan menjadi ter-

sangka. Terkait dugaan suap terhadap sejumlah anggota dewan periode 1999-2004, KPK baru menetapkan satu orang ter-

sangka selaku pihak pemberi suap, yakni Nunun Nurbaeti. Istri dari mantan Wakapolri Adang Daradjatun ini diduga menjadi perantara dalam memberikan cek perjalanan sebagai suap. Miranda, menurut Abraham, dijerat dengan pasal 5 ayat 1 huruf b Undang-Undang (UU) Nomor 30 tahun 1999 sebagaimana diubah dengan UU Nomor 20 tahun 2001 tentang Pemberantasan Ti n d a k P i d a n a Ko r u p s i (Tipikor). Dengan pasal tersebut mantan Deputi Gubernur Lanjut ke hal A2 kol 6

Ada-ada Saja

Al Bayan

Dosa Perusak Ibadah Oleh: M. Arif Fadhillah Lubis,SHI,MSI “Kalau seorang Mukmin ditimpa musibah, kelelahan atau keresahan atau duri yang melukainya, maka ia menjadi penghapus pada dosa-dosanya.” Demikian redaksi hadis shahih dalam kitab hadis Bukhari-Muslim. Hadis ini menerangkan ada beberapa perkara yang mampu menghapus dosa kita sebagaimana redaksi hadis tersebut. Namun tidak sedikit atau paling tidak ada beberapa hal sebaliknya, yaitu dosa-dosa yang dilakukan banyak mengakibatkan ibadah atau tepatnya pahala terhapus. Di antaranya adalah memaki atau menggerutu yang bisa menghapuskan pahala sedekah. Demikian juga riya yang mampu menghapus pahala amal ibadah. Hal ini dijelaskan Allah SWT dalam surah Al-Baqarah (2) ayat

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 5

Digerebek Polisi Saat Nyabu Empat Pemuda Menangis P. SIDIMPUAN (Waspada): Tim Khsusus Anti Judi Narkoba dan Pencurian (Timsus JNC) Polres Padangsidimpuan menggerebek empat pemuda yang sedang berpesta sabu di Lingk. Rambin, Kel. Rambin Kampung Marancar (Bincar), Kec. Padangsidimpun Utara, Kamis (26/1). Namun, ketika hendak digelandang ke Mapolres Padangsidmpuan, keempat

Angelina Yakin Tidak Ditangkap KPK

Rumah Dari Uang Kertas

SEORANG seniman pengangguran asal Irlandia membangun sebuah rumah dari sisa-sisa sobekan uang sebesar 1,4 miliar Euro atau sekira Rp16,4 triliun (Rp11.746 per euro). Ia melakukan hal ini sebagai bentuk protes antikemapanan. Frank Buckley membuat rumah ini sebagai bentuk “Monumen Kegilaan” dari Irlandia, yang menurutnya terkontaminasi oleh mata uang tunggal, maraknya konstruksi spektakuler serta berbagai tragedi memilukan yang terjadi. Bangunan ini dibuatnya di lobi gedung kantor yang kosong, sejak selesai dibangun empat tahun lalu. “Ini adalah refleksi dari keseluruhan kegilaan yang mencengkeram kita,” kata Buckley seperti dikutip Reuters, Kamis (26/1).

Waspada/Sukri Falah Harahap

TERSANGKA pengguna narkoba jenis sabu-sabu di Lingkungan Rambin, Kelurahan Bincar, Kota Padangsidimpuan, menangis saat digrebek polisi, Kamis (26/1).

Waspada/Surya Efendi

UTUSAN Khusus Republik Seychelles untuk ASEAN, Nico Barito ( dua dari kanan) didampingi Bupati Serdang Bedagai Erry Nuradi (tiga dari kiri), Pemred Harian Waspada Prabudi Said (tiga dari kanan) , staf ahli Bupati Sergai Rachmad Karokaro, Kabag Humas Sergai Mariyono diabadikan di Bumi Warta Harian Waspada Medan, Kamis (26/1).

Seychelles Dorong Komoditas Sumut Masuk Pasar Afrika MEDAN (Waspada): Utusan Khusus Republik Seychelles untuk ASEAN mengajak pemerintah daerah, pebisnis dan para pemilik dana di Sumatera Utara memasuki pasar Afrika melalui negara tersebut. Ajakan itu disampaikan langsung Special Envoy of The Republic of Seychelles for ASEAN

(utusan khusus Republik Seychelles untuk ASEAN) Nico Barito saat berkunjung ke gedung BumiWarta Harian Waspada Medan, Kamis (26/1). Dia datang bersama Bupati Serdang Bedagai (Sergai) HT Erry Nuradi, Lanjut ke hal A2 kol 5

JAKARTA (Waspada): Anggota Komisi X DPR, Angelina Sondakh, mengaku tak habis pikir mengapa namanya kerap disebut dalam kasus suap Wisma Atlet terutama dalam sidang M Nazaruddin. “Saya tidak faham, kenapa nama saya ditarik-tarik terus dalam kasus Wisma Atlet SEA Games Palembang. Tapi kalau dilihat latar belakang orang tersebut, saya paham skenario ini,” kata perempuan yang kerap disapa Angie ini dalam rilisnya, Kamis (26/1). Angie meminta kepada Nazaruddin dan para saksinya untuk berkata jujur bahwa dirinya tidak pernah terlibat dalam proyek Wisma Atlet.

Lanjut ke hal A2 kol 1

Baca Pentas Demokrasi Aceh Di Halaman A7

pemuda tersebut, SBN, RH,HP, dan ELG, menangis sembari meminta gari di tangannya dilepaskan. Meski di bawah pengaruh sabu, para tersangka sepertinya masih tetap sadar. Dari keempat tersangka, polisi menyita barang bukti berupa peralatan yang digunakan untuk nyabu seperti bong dan mancis, uang Rp4 juta lebih dan satu paket sabu yang masih terbungkus dalam plastik kecil. Penggrebekan itu membuat warga sekitar berdatangan ke lokasi. Mereka melihat para tersangka yang sudah diamankan, dan menyaksikan polisi menyisir rumah di sekitar tempat kejadian. Menurut warga, sikap para tersangka yang sering menggunakan narkoba telah lama meresahkan mereka. Kapolres Padangsidimpuan, AKBP Andi Syahriful Taufik SIK. MSi, menyebut penggrebekan itu dilakukan setelah pihaknya menerima informasi masyarakat. “Kami mengetahuinya karena mendapat laporan masyarakat.Warga sudah sangat resah akibat ulah para tersangka yang sering menggunakan narkoba di lingkungan itu,” ujarnya. (a27)

Serampang - Semakin tinggi semakin kencang angin berhembus - He.... he....he....

Berita Utama

A2

WASPADA Jumat 27 Januari 2012

Dubes Korsel Minta Pemerintah Aceh Lindungi Warganya

Waspada/Zafrullah

DUTA Besar Korea Selatan untuk Indonesia Mr Kim Young Sun (empat dari kiri) melakukan pertemuan dengan Gubernur Aceh yang diwakili Sekda T Setia Budi di ruang kerja Gubernur Aceh, Kamis (26/1). Mr Kim, didampingi sejumlah stafnya, sementara dari Pemerintah Aceh juga hadir Kabid Keolahragaan Dispora Aceh Nuzuli (dua dari kanan).

Angelina ....

“Bicara sama mereka saja tidak pernah, apalagi minta dan menerima. Tolong jangan diskenariokan dan direkayasa cerita-cerita ini,” tandas mantan Putri Indonesia tersebut. Angie yakin dirinya tidak akan ditangkap Komisi Pemberantasan Korupsi (KPK) terkait kasus ini. Sebab, dirinya yakin tidak terlibat dalam kasus mega korupsi ini. “Saya yakin KPK tak akan ‘memasukkan’ orang yang tidak terlibat, karena KPK profesional dan adil,” tegas peremp u a n b e rd a r a h Ma n a d o tersebut. Sebagaimana diberitakan sebelumnya, nama Angelina Sondakh disebut Yulianis (saksi persidangan dan mantan anak buah Nazaruddin) telah menerima fee sebesar Rp5 miliar terkait proyek ini. Angie sebelumnya juga dituding telah terlibat percakapan berujung transaksi dengan Mindo Rosalina Manulang. Dari situlah istilah “Apel Malang” dan “Apel Washington” muncul. (okz)

Pagi Ini ....

SH, MH. Ini sidang kedua setelah sidang serupa pertama pada 16 Januari lalu dengan agenda acara perbaikan permohonan. Sebelumnya, Ketua MK Mahfud MD di Hotel Sultan Jakarta, Selasa (25/1) menyatakan akan menggelar sidang putusan akhir Pilkada Aceh Jumat, 27 Januari pukul 14.00. Wartawan yang menanyakan apakah putusan akhir MK memutuskan Pilkada diundurkan, Mahfud menyatakan tidak tahu, apakah ada kemungkinan atau tidak. Dalam pertemuan delegasi KIP Aceh dan KIP kabupaten/kota dengan Mahfud di Gedung MK pada Selasa (25/ 1) memohon putusan MK menggeser jadwal Pilkada ke 9 April 2012 dengan alasan KIP tidak mampu melaksanakan Pilkada pada 16 Februari mendatang karena waktu terbatas dan masalah tehnis lain. (cmh)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kxc6+, Ra8. 2. Ba7+mat. (jika 1. ...., MxKc6 open sekak).

Jawaban TTS: TTS Topik

Y A R MU A U H E R A C L U I S D I MA M U B Y Z A A U K H A L I F MU I I K U N T A A R A

Mimbar Jumat

K

K H A H L I U S L N A D H I I K N T I U M A K A F A H H S L I A Y A S I N A U H I MA H

L I D A H A MK A A L A F S A H K A U K U M S D U A MA L B I H A L A L B L I A U L L A H

Jawaban Sudoku:

7 4 5 3 8 6 1 9 2

3 6 9 1 7 2 5 4 8

8 2 1 9 5 4 3 7 6

4 5 3 2 1 8 7 6 9

9 7 6 4 3 5 2 8 1

2 1 8 6 9 7 4 5 3

6 8 7 5 2 1 9 3 4

5 3 2 8 4 9 6 1 7

1 9 4 7 6 3 8 2 5

Tersangka Baru Wisma Atlet, KPK Tak Perlu Wangsit Istana JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) membantah tudingan yang menyebutkan perlu ‘izin Istana’ dalam menetapkan tersangka baru suap wisma atlet SEA Games Palembang. Dalam kasus ini, terdakwa Muhammad Nazaruddin dan mantan anak buahnya Mindo Rosalina Manulang menyebut keterlibatan sejumlah kader Partai Demokrat. “Kami tidak ada urusan dengan Istana. Kami adalah lembaga independen,” tegas Ketua KPK Abraham Samad dalam jumpa pers, Kamis (26/1). “Jadi kami tidak perlu menunggu wangsit dari Istana.” Dalam menetapkan tersangka, lanjut Abraham, KPK harus berdasarkan dua alat bukti yang cukup. “Di negeri ini tidak ada yang kebal hukum sekalipun dia ketua partai. Jadi kami tidak perlu menunggu wangsit dari Istana,” tegasnya. KPK masih mendalami peran kader Demokrat yang disebut Nazaruddin dan Rosa, seperti Anas Urbaningrum, Angelina Sondakh, Mirwan Amir dan mereka telah membantah. Sebelumnya diberitakan KPK akan mengumumkan tersangka baru kasus dugaan suap Wisma atlet SEA Games.

Anas Tegaskan ....

BANDA ACEH (Waspada): Duta Besar Korea Selatan untuk Indonesia Mr Kim Young Sun, meminta Pemerintah Aceh untuk melindungi dan memberikan rasa aman kepada warga Korea Selatan yang tinggal di Aceh. Hal ini disampaikan Mr K i m Yo u n g S u n k e p a d a Gubernur Aceh, diwakili Sekda Aceh T Setia Budi dalam pertemuan selama satu jam di ruang kerja Gubernur Aceh, Kamis (26/1). M r K i m Yo u n g S u n mengaku ada 20 warga Korsel yang saat ini tinggal di Aceh. Mereka adalah para tenaga ahli dan akademisi, serta pelatih taekwondo yang tinggal di Aceh sebagai bagian dari implementasi kerjasama yang telah dijalin antara Pemerintah Korea dan Pemerintah Aceh selama ini. Kunjungan ke Aceh yang baru pertama kali dilakukan Dubes Korea Selatan beserta staf, selain bertemu dengan jajaran Pemerintah Aceh, juga untuk menghadiri acara pembukaan Korean Cultural Center di Universitas Syiah Kuala, meninjau komunitas masyarakat Korea Selatan di Aceh dan meninjau keadaan Aceh pasca tsunami. “Tari Saman merupakan jenis tarian yang sangat popular, dan kami lihat banyak memiliki kesamaan dengan gaya dan ciri khas bangsa Korea

gung soal pelengseran,” kata Wakil Sekretaris Jenderal Demokrat Ramadhan Pohan secara terpisah. Isu pelengseran Anas muncul setelah Susilo Bambang Yudhoyon selaku ketua Dewan Pembina selama dua malam berturut-turut memanggil seluruh pengurus dan Dewan Kehormatan partai. Salah satu bahasannya adalah soal Anas. Anas Bantah Terima Rp3 M Ketua Umum Partai Demokrat, Anas Urbaningrum, membantah pengakuan mantan Wakil Direktur Keuangan Permai Group Yulianis yang dalam persidangan di Pengadilan Tindak Pidana Korupsi (Tipikor ) yang menyebutkan ada dana sebesar Rp3 miliar untuk Anas.

“Apa itu? Daun pisang kali ya. Saya kira tidak ada itu. Tidak benar,” kata Anas di selasela panen raya udang di Indramayu, Jawa Barat, Kamis (26/1). Pada kesempatan itu, Anas menegaskan, terkait pemberitaan akhir-akhir ini yang selalu mengaitkan kasus Wisma Atlit dengan posisinya sebagai Ketua Umum PD tak perlu ditanggapi. “Ah itu kan cerita-cerita di luar. Yang pasti di dalam posisi PD mantap, kompak, solid, dan waras cara berpikirnya,” kata Anas. Mantan anggota DPR RI itu bahkan menegaskan, di internal partai tak ada upayaupaya untuk menggoyang posisinya sebagai ketua umum. (vn)

Bima Rusuh ....

Bupati Bima Ferry Zulkarnaen, yang mencakup areal tambang seluas 24.980 hektare, yang mencakup wilayah Kecamatan Lambu, Sape, dan Langgudu. Bebaskan 53 Tahanan Selain membakar kantor bupati dan KPUD Bima, warga yang mengamuk juga membebaskan paksa 53 orang tahanan dari Lembaga Pemasyarakatan Raba, Kabupaten Bima. Saksi mata mengatakan, massa itu mendatangi Lembaga Pemasyarakatan (Lapas) Raba, Kabupaten Bima, dan meminta para tahanan titipan polisi terkait insiden berdarah di Pelabuhan Sape, 24 Desemer 2011, dilepas saat itu juga. “Massa mengancam jika tidak dilepas maka Lapas Raba Bima itu juga akan dibakar, sehingga petugas lapas memenuhi tuntutan tersebut, dan massa menyambut dengan kegembiraan,” kata Didin, seorang saksi mata aksi massa tersebut. SBY: Ditindak Tegas Presiden, Julian Aldrin Pasha mengatakan, Presiden Susilo Bambang Yudhoyono

sudah mengetahui peristiwa pembakaran kantor Bupati di Bima. “Ya sesungguhnya seperti yang terjadi hari ini di Bima, beberapa waktu yang lalu pernah dilaporkan terkait dengan kerusuhan di tempat yang sama,” kata Julian di Kantor Presiden, Jakarta, Kamis (26/1). Presiden meminta seluruh instansi terkait agar segera melakukan antisipasi agar peristiwa hari ini tidak merembet menjadi destruktif dan anarkis. “Bapak Presiden telah menginstruksikan kepada Menkopolhukam untuk bersama-sama dengan Kapolri melakukan langkah antisipasi untuk menghindari tindakantindakan yang sifatnya destruktif. Apalagi anarkis,” ujarnya. Julian menuturkan, presiden juga minta pelaku pelanggar hukum ditindak tegas sesuai dengan hukum yang berlaku. “Tentu karena kita tahu bahwa ada kejadiankejadian yang masih terus berlangsung itu akan sepenuhnya diproses secara hukum. Sebagaimana hukum yang berlaku di sini,” ujarnya. (ant/vv)

Al Bayan ....

dan sesungguhnya sebaik-baik bekal adalah takwa dan bertakwalah kepada-Ku hai orangorang yang berakal.” Ibnu Abbas sebagaimana dinukil Ibnu Katsir dalam kitab tafsirnya, mengar tikan rafats dengan mengeluarkan kata sindiran yang mengandung arti persetubuhan. Ungkapan ini menurut orang-orang Arab dinamakan ‘irabah yang artinya ‘kata-kata yang jorok.’ Jadi rafats dapat diartikan dengan perkataan yang menimbulkan birahi yang tidak senonoh atau kotor. Dosa lain adalah mengeraskan suara di depan Rasulullah SAW (atau saat ini, ketika sabdanya disampaikan). “Hai orang-orang yang beriman, janganlah kamu meninggikan suaramu melebihi suara Nabi, dan janganlah kamu berkata kepadanya dengan suara yang keras, sebagaimana kerasnya suara sebagian kamu terhadap sebagian yang lain, supaya tidak hapus (pahala) amalanmu, sedangkan kamu tidak menyadari.” Demikian redaksi Firman Allah SWT dalam surah Al-Hujurat (49) ayat ke2. Jelas dan tegas bahwa meninggikan suara di hadapan R a s u l u l l a h S AW a k a n menghapus seluruh amal ibadah. Selanjutnya beberapa hadis Rasulullah SAW menegaskan menyakiti tetangga

dengan lidah menghapuskan pahala puasa dan shalat malam. Alquran menjelaskan agar menghindarkan diri dari menyakiti orang lain dan tidak memperbincangkan kebatilan bahkan diancam neraka, sebagaimana keterangan surah AlMuddatstsir (74) ayat ke-42 sampai ke-47, “Apakah yang memasukkan kamu ke dalam Saqar (neraka)? Mereka menjawab: ‘Kami dahulu tidak termasuk orang-orang yang mengerjakan salat, dan kami tidak (pula) memberi makan orang miskin, dan adalah kami membicarakan yang batil, bersama dengan orangorang yang membicarakannya, dan adalah kami mendustakan hari pembalasan, hingga datang kepada kami kematian’.” Setidaknya demikianlah beberapa dari sekian banyak dosa lainnya yang mampu menghapus pahala ibadah kita. Sebagai penutup ada baiknya kita merenungkan firman Allah SWT dalam surah Muhammad (47) ayat ke-33, “ H a i o ra n g - o r a n g y a n g beriman, taatlah kepada Allah dan taatlah kepada Rasul dan janganlah kamu menghapus amal-amalmu.” Semoga Allah SWT menolong kita semua untuk dapat menghindari diri dari dosa-dosa yang dapat menghapus ibadah kita. Amin. Wallahu Al-‘Alim.

rumor tak berdasar. Sampai saat ini, kata dia, Partai Demokrat tetap bersatu di bawah kepemimpinannya. “Itu (upaya pelengseran) kan cerita di luar. Di dalam kami kompak, solid dan waras cara berpikirnya,” ujar Anas. Kemarin, Anas mengumpulkan jajaran pengurus inti Dewan Pengurus Pusat Partai Demokrat dalam sebuah rapat harian di Kantor DPP Demokrat, Jakarta. Turut hadir dalam rapat itu adalah Sekretaris Jenderal Demokrat Eddhie Baskoro Yudhoyono (Ibas). Rapat yang dipimpin Anas itu membahas tentang perbaikan dan penguatan partai. “Kami berbicara tentang perbaikan, penguatan dan penajaman partai. Tak menying-

Sepuluh ribuan warga dari Kec. Lambu, Sape dan Langudu itu dihadang aparat kepolisian dan Satuan Polisi (Satpol) Pamong Praja (PP), karena para pengunjuk rasa hendak menduduki kantor bupati. Massa berasal dari ketiga kecamatan itu juga berunjuk rasa dan memblokade jalan di Pelabuhan Sape, pada 19-24 Desember 2011, yang baru bubar setelah dibubarkan paksa oleh aparat kepolisian hingga mencuat insiden penembakan yang menewaskan dua orang warga itu. Aksi unjuk rasa yang berujung pembakaran kantor Bupati Bima itu terkait tuntutan pembebasan 56 warga Lambu dan Sape yang dulu berunjuk rasa di Pelabuhan Sape, dan saat ini ditahan aparat kepolisian untuk diproses hukum. Tuntutan lainnya yakni pencabutan Izin Usaha Pertambangan (IUP) yang dikantongi PT Sumber Mineral Nusantara (SMN), sebagaimana tuntutan dalam aksi sebelumnya. IUP bernomor 188/45/ 357/004/2010 itu diterbitkan

ke-264, “Hai orang-orang yang beriman, janganlah kamu menghilangkan (pahala) sedekahmu dengan menyebutnyebutnya dan menyakiti (perasaan si penerima), seperti orang yang menafkahkan hartanya karena riya kepada manusia dan dia tidak beriman kepada Allah dan hari kemudian. Maka perumpamaan orang itu seperti batu licin yang di atasnya ada tanah, kemudian batu itu ditimpa hujan lebat, lalu menjadilah dia bersih (tidak bertanah). Mereka tidak menguasai sesuatupun dari apa yang mereka usahakan; dan Allah tidak memberi petunjuk kepada orang-orang yang kafir.” Dosa lain yang mampu menghapus pahala amal ibadah manusia adalah perkataan kotor menghapuskan ibadah haji. Masih dalam surah AlBaqarah (2), Allah SWT menegaskan hal tersebut, yakni ayat ke-197, “(Musim) haji adalah beberapa bulan yang dimaklumi, barangsiapa yang menetapkan niatnya dalam bulan itu akan mengerjakan haji, maka tidak boleh rafats, berbuat fasik dan berbantahbantahan di dalam masa mengerjakan haji. Dan apa yang kamu kerjakan berupa kebaikan, niscaya Allah mengetahuinya. Berbekallah,

yang dinamis. Saman mewakili spirit bangsa Korea. Di samping itu, Aceh memiliki kekayaan alam dan khazanah budaya yang sangat bagus,” ungkap Mr Kim. Terkait dibukanya Pusat Kebudayaan Korea di Universitas Syiah Kuala, Dubes Korsel mengharapkan terjalinnya hubungan berdasarkan pemahaman antara kedua budaya yang bermuara pada persahabatan dan kerjasama lebih lanjut di berbagai bidang. Menanggapi kemungkinan kerjasama berbagai bidang dengan Pemerintah Korsel, Sekda Aceh menyampaikan harapan dan kesungguhan. Sekda menyampaikan penghargaan dan terima kasih kepada pemerintah dan masyarakat Korea Selatan yang banyak membantu Aceh melewati masa-masa sulit, ketika musibah gempa dan tsunami terjadi pada 2004. “Karena ini merupakan kunjungan perdana Dubes Korsel ke Aceh, atas nama Pemerintah dan rakyat Aceh, kami menyampaikan ucapan terimakasih dan penghargaan kepada pemerintah dan masyarakat Korsel atas segala bantuan yang diberikan, baik pada masa pasca bencana, rehab-rekon, sampai dengan sekarang,” ungkap Setia Budi (b04)

Ada-ada Saja ....

“Orang-orang menuangkan uang miliaran untuk membuat bangunan yang kini tidak bernilai apapun. Saya ingin menciptakan sesuatu dari nol,” jelas Buckley. “Rumah Miliaran Euro” dibangun sejak awal Desember oleh Buckley. Dinding dan lantai yang terbuat dari potongan kertas euro membuat rumah begitu hangat, sehingga Buckley kerap tidur tanpa selimut. Buckley mengatakan, ia ingin politisi Eropa untuk mengatasi krisis utang zona euro tanpa merusak mata uangnya. Tapi jika mata uang akhirnya gagal, ia dengan senang hati akan menggunakan mata uang euro sebagai bahannya untuk membuat karya di masa depan. (ok/rzl)

Seychelles ....

Rachmad Karo-karo, staf ahli Bupati Sergai dan Mariyono, K a b a g Hu m a s y Pe m k a b Sergai. Mereka diterima Pemimpin Redaksi Harian Waspada Prabudi Said, Redaktur Pelaksana Berita Armin Nasution dan Redaktur Sumatera Utara T. Dony Paridi. Nico Barito yang dulu bekerja untuk PBB bercerita tentang Republik Seychelles. Ketika dia memperkenalkan negara tersebut baru ada pemahaman tentang letak negara. Dia mengatakan ini adalah negara kepulauan. Republik Seychelles berada di tengah Samudera Hindia, merupakan negara kepulauan di kawasan Afrika. Letak Seychelles strategis, berada sekitar 1.600 kilometer sebelah timur daratan Afrika dan timur laut Madagaskar. Penduduk Seychelles, menurut Nico, 85 ribu jiwa dengan pendapatan per kapita 28.000 dolar AS mewakili keragaman etnis seperti Eropa, Arab, China, India, dan dari sejumlah negara Asia lain. Dari Jakarta, saat ini, kata dia, ada penerbangan setiap hari dengan melintas ke Dubai. Jakarta-Dubai makan waktu tujuh jam, kemudian dari Dubai ke Seychelles sekira empat jam. “Negara ini setidaknya menjadi destinasi khusus. Juga menjadi financial hub. Bahkan bisa juga menjadi international business offshore,” tuturnya. “Saya melihat Seychelles dan Sumut bisa berhubungan. Bahkan negara ini bisa dimanfaatkan untuk memasuki pasar Afrika.” Dia mengatakan jumlah penduduk Afrika saja sekira 800 juta orang. “Jika ingin menggali pasar baru, Seychel-

Dugaan Korupsi ....

Dugaan korupsi ini merupakan perkara kedua yang melibatkan BL sebagai pejabat tertinggi sebuah daerah. Pertama, perkara pemalsuan surat akta tanah saat dia menjabat Camat di Kec. Barumun. Perkaranya sudah mendapat putusan dari Mahkamah Agung dan berkekuatan hukum tetap. Basyrah Lubis dihukum 6 bulan penjara dengan masa percobaan 1 tahun. Perkara kedua adalah, dugaan korupsi DAK/DAU 2009 untuk pembangunan sarana prasarana perkantoran Pemkab Palas setelah BL menjabat bupati di tanah kelahirannya. (a27)

Waspada/Surya Efendi

Terdakwa yang merampok dan membunuh karyawan BRI Syariah Cabang Jalan S Parman Medan mendapat pengawalan ketat polisi dari amukan keluarga korban pada sidang lanjutan perampokan dan pembunuhan karyawati BRI Sri Wahyuni di Pengadilan Negeri (PN) Medan, Kamis (26/1).

Terdakwa Kena ....

wab oleh oknum petugas polisi tersebut bahwa korban tidak memakai safety bel dan melanggar lampu merah. Namun, hasil pembicaraan yang pada saat itu oknum polisi tersebut mengaku dari Poldasu siap membantunya. Akan tetapi lima belas sampai dua puluh menit kemudian, korban Sri Wahyuni kembali sms kepada Al Fattah b a h w a d i r i n y a d i s e k a p. Dengan mendapatkan sms tersebut, Al Fattah langsung menghubunginya via telefon selular namun tidak berhasil. Kemudian melakukan penyisiran di sejumlah lokasi setelah berbuka puasa hingga pukul sebelas malam pada Senin, 1 Agustus 2011. Pencarian dihentikan setelah mendapatkan sms bahwa korban sedang menjenguk temannya di rumah sakit dan sekarang istirahat.

Namun, menurut Al Fattah ada kejanggalan dari tulisan sms tersebut berbeda dari biasanya, kemudian katakatanya tidak menyambung dimana sms nya “Aku menjenguk teman di rumah sakit, aku istirahat”. Tetapi ketika dihubungi kembali menanyakan posisi korban, dari HP korban tidak ada jawaban sehingga hal ini diteruskan ke pimpinannya dan dilakukan pencarian kembali. Keesokan harinya pada 2 Agustus 2011, Al Fattah kembali menanyakan kepada keluarga korban tentang keberadaannya, namun keluarganya mengatakan korban tidak berada di rumah sejak Senin, 1 Agustus. Setelah mendengarkan saksi, ketua Majelis Muhammad melanjutkan sidang pada Kamis mendatang. (m38)

Miranda Gultom ....

Bank Indonesia ini terancam minimal satu tahun dan maksimal lima tahun. Tidak hanya itu, Miranda juga dijerat dengan pasal 13 UU Tipikor dan pasal penyertaan 55 ayat 1 dan 2 KUHP. Abraham mengatakan MSG membantu atau turut serta membantu NN melakukan Tindak Pidana korupsi memberikan cek perjalanan. Dengan pasal-pasal tersebut tersangka dapat dijatuhi hukuman lebih berat jika memang terbukti.

Terkejut Tersangka cek pelawat, Miranda S. Goeltom, mengaku terkejut telah ditetapkan tersangka oleh Komisi Pemberantasan Korupsi (KPK). “Sa y a t e r k e j u t ,” k a t a Miranda kepada wartawan di kediamannya di Jakarta. Kendati menghargai langkah yang ditempuh KPK kepada dirinya, Miranda mengaku tidak pernah menyangka bakal melalui proses hukum yang diakuinya sejak lama harus ditempuhnya. “Saya tidak menyangka

akan melalui proses seperti ini,” kata Miranda. Dia berharap, status terakhir dirinya dari KPK membuat kasus ini akan segera terang dan berakhir, tidak lagi berlarut-larut. Miranda juga menyatakan tidak melihat KPK akan menahannya karena selama ini dia selalu kooperatif dengan selalu memenuhi panggilan KPK dan memberikan keterangan apapun yang diminta KPK. “Tak ada keperluan untuk menahan saya,” kata Miranda.

les merupakan hub yang menguntungkan,” jelasnya. Kalaupun tidak mau ke Afrika, ada negara-negara kecil di kawasan Seychelles. Negara tetangga Seychelles ialah Mauritius dan Reunion di sebelah selatan, Komoro dan Mayotte di barat daya, dan Maladewa di timur laut. “Negara di kawasan tersebut butuh consumer goods yang banyak diproduksi di wilayah Sumut,” ungkapnya. Untuk tahap awal perkenalan produk dari Sumatera Utara diwakili Serdang Bedagai tahun ini, kata dia. “Selama ini kita hanya dengar di Serdang Bedagai ada sawit, karet dan consumer goods bahkan dodol. Maka dalam carnaval Seychelles yang mulai 2 Maret, Sergai ambil bagian,” jelasnya. Mana tahu setelah itu akan ada kontak bisnis sehingga hub u n g a n p e b i s n i s Su m u t dengan Seychelles terjalin, jelasnya. Erry Nuradi mengungkapkan ini memang salah satu upaya daerahnya masuk ke pasar lain. “Sering kita lihat produk kita banyak yang bisa dijual ke

negara lain. Inilah salah satu cara. Kita ikuti carnaval sehingga nanti ada promosi dan langkah apa saja yang bisa diambil untuk bekerjasama,” tuturnya. One village one product Selain kunjungan tersebut, Erry Nuradi seperti rutinitas setiap tahun juga menyerahkan buku edisi khusus perkembgangan kabupaten yang dipimpinnya selama 2011. Dia menyatakan kalau selama ini Sergai sudah melakukan berbagai upaya untuk mendorong kemajuan daerahnya, tahun ini pun akan melanjutkan hal sama. “Dulu kita dikenal sebagai perintis one stop service perizinan. Lalu kita lanjutkan dengan program pendidikan serta pariwisata. Kalau tahun ini saya ingin fokus dengan program pemerintah one village one product (OPOP). Tiap kecamatan nanti ada produk unggulan,” jelasnya. Menurut Erry, seringkali produk Sumut atau juga Sergai sering tak dikenal setelah sampai di luar negeri. “Sebab sudah ganti kemasan. Itu

sebabnya dengan OPOP kita ingin memperkenalkan secara maksimal ke luar negeri,” kata Erry Nuradi. Di kesempatan itu, Prabudi Said sedikit menyinggung tentang produk dari Sumut yang harus memperhatikan kualitas. “Saya punya pengalaman beli dodol untuk dibawa ke Amerika. Pertama dibawa enak. Tapi ketika beli lagi dan bawa ke sana rasanya sudah beda. Itu mengecewakan. Saya ingin pesankan kepada Pak Bupati untuk ikut memberi warning pada pengusaha kita mempertahankan kualitas produk,” tuturnya. Dalam pertemuan tersebut banyak sekali topik pembicaraan mengalir. Termasuk keberadaan Seychelles serta upaya Serdang Bedagai terus memajukan daerahnya. Di akhir pertemuan Erry Nuradi menyerahkan buku edisi khususnya kepada Prabudi Said dan Nico Barito. Kemudian secara khusus Prabudi Said menyerahkan buku sejarah peristiwa 60 tahun halaman satu Harian Waspada kepada Nico. (m06)

berpakaian bertuliskan Front Pembela Islam (FPI) tampak memenuhi ruang sidang. Sementara pada sidang terdakwa Suherman alias Embot, istrinya Eva Lestari Surbakti, dan Ria Br Hutabarat, jaksa menghadirkan dua orang saksi yakni Khainidar Lubis, ibu korban dan, Al Fattah, Briptu Bagian Perencanaan Polsek Medan Kota, teman korban. Al Fattah, dalam keterangannya mengatakan, pada hari Sri Wahyuni diculik tepatnya Senin, 1 Agustus 2011, sekitar jam lima sore sempat menelefon kepada saksi bahwa ada razia oleh pihak kepo-lisian dan minta tolong untuk dibantu. Kemudian Al Fattah menelefon kepada petugas razia tersebut agar dibantu dan sempat menanyakan kesalahannya apa, kemudian dija-

Berita Utama

A2

WASPADA Jumat 27 Januari 2012

Security Pertamina Amankan Truk Angkut Crode Oil Curian BESITANG (Waspada): Satu truk Cold Diesel BK 8397 YI mengangkut crude oil hasil curian, diamankan security PT Pertamina EP Field Rantau, Aceh Tamiang, setelah terjadi kejar-kejaran dari Besitang hingga ke wilayah Kec. Padangtualang, Langkat, Kamis (26/1) subuh. Pengejaran yang dipimpin Pws security, Darjo, bersama Patwal Pertamina Rantau, berawal dari informasi masyarakat, sekira pukul 01:00 ada komplotan mafia yang mencuri minyak mentah dari jalur pipa HM 450 Dusun Muarasoma, Desa Bukitmas, Kec. Besitang. Menerima laporan ini, sejumlah perso-

nil security masuk ke wilayah jalur melakukan pengejaran. Namun, sebelum sampai ke tempat kejadian perkara (TKP), petugas melihat satu unit truk Cold Diesel melarikan diri menuju arah Jalinsum Medan. Merasa curiga, petugas melakukan pengejaran dan sekira pukul 02:40, security berhasil menangkap truk tersebut, sopir truk berhasil kabur. Dari dalam truk, security menemukan barang bukti selang sepanjang kurang lebih 200 meter, 4 fiber, 6 drum kosong dan satu drum telah berisi crude oil. Untuk proses hukum, kasus ini dilaporkan security Pertamina ke Polsek Besitang

Empat Ruko ...

barang bekas, peralatan mesin (spare part) sepedamotor dan mobil serta material bangunan yang terbakar. Kapolres Tebingtinggi, AKBP Andi Rian Djajdi, Sik ketika dikonfirmasi melalui Kasubag Humas AKP Ngemat Surbakti mengatakan kasus kebakaran itu masih dalam penyelidikan petugas. “Belum diketahui asal api, kita masih menunggu hasil penelitian Latpor Poldasu, paparnya. Ditinjau Wali Kota Usai membuka acara Serasehan Karang Taruna Kota Tebingtinggi di gedung Hj. Sawiyah Nasution, Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Hasibuan, MM bersama rombongan meninjau lokasi kebakaran. Setelah melihat seluruh ruangan gudang yang hangus terbakar,Wali Kota menyambangi pemilik ruko dan mendengarkan penuturannya atas kejadian tersebut. (a11)

mobil pemadam kebakaran yang diterjunkan Pemko Tebingtinggi kurang berfungsi akibat saat dioperasikan sering ngadat. Yoyonli, 56, pemilik ruko mengatakan, empat ruko miliknya terbakar. Dua ruko tempat penyimpanan barang bekas dan dua ruko lagi digunakan untuk menjual alat-alat sepedamotor dan mobil serta bengkel. “Sebelum kejadian sekira pukul 02:00, saya bersama beberapa teman kumpul di samping gudang tersebut. Begitu pulang ke rumah di Jalan Jendral Sudirman Simpat Empat Kota Tebingtinggi, belum sempat tidur, ada orang mengabarkan gudang saya terbakar. Begitu sampai gudang, api sudah membesar,” tutur Yonli. Akibat kejadian tersebut dia mengaku mengalami kerugian miliaran rupiah dari tumpukan

Terdakwa Kena ... para terdakwa yang dikawal ketat oleh pihak kepolisian. Pada sidang lanjutan tersebut, terdakwa EP, kembali tidak hadir, hanya tiga dari empat terdakwa yang hadir yaitu R Br H, istri EP, S alias Edan istrinya ELS. Massa keluarga korban Sri Wahyuni yang sebagian berpakaian bertuliskan Front Pembela Islam (FPI) tampak memenuhi ruang sidang, namun sidang ketiga yang digelar di ruang Cakra VII, berjalan lancar dibawah pengawalan ketat puluhan petugas kepolisian. Sementara pada sidang terdakwa S alias E, istrinya ELS, dan R Br H, jaksa menghadirkan dua orang saksi yakni Khainidar Lubis, ibu korban dan, Al Fattah, Briptu Bagian Perencanaan Polsek Medan Kota, teman korban. Al Fattah, dalam keterangannya mengatakan, pada hari SriWahyuni diculik tepatnya Senin 1 Agustus 2011, sekitar jam lima sore sempat menelefon kepada saksi bahwa ada razia oleh pihak kepolisian dan minta tolong untuk dibantu. Kemudian Al Fattah menelefon kepada petugas razia tersebut agar dibantu dan sempat menanyakan kesalahannya apa, kemudian dijawab oleh oknum petugas polisi tersebut bahwa korban tidak memakai safety belt dan melanggar lampu merah. Namun, hasil pembicaraan yang pada saat itu oknum polisi tersebut mengaku dari Poldasu siap membantunya. Akan tetapi lima belas sam-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kxc6+, Ra8. 2. Ba7+mat. (jika 1. ...., MxKc6 open sekak).

Jawaban TTS: TTS Topik

Y A R MU A U H E R A C L U I S D I M A M U B Y Z A A U K H A L I F MU I I K U N T A A R A

Mimbar Jumat

K

K H A H L I U S L N A D H I I K N T I U M A K A F A H H S L I A Y A S I N A U H I M A H

L I D A H A M K A A L A F S A H K A U K U M S D U A M A L B I H A L A L B L I A U L L A H

Jawaban Sudoku:

7 4 5 3 8 6 1 9 2

3 6 9 1 7 2 5 4 8

8 2 1 9 5 4 3 7 6

4 5 3 2 1 8 7 6 9

9 7 6 4 3 5 2 8 1

2 1 8 6 9 7 4 5 3

6 8 7 5 2 1 9 3 4

5 3 2 8 4 9 6 1 7

1 9 4 7 6 3 8 2 5

pai dua puluh menit kemudian, korban SriWahyuni kembali SMS kepada Al Fattah bahwa dirinya disekap. Dengan mendapatkan SMS tersebut, Al Fattah langsung menghubunginya via telefon selular namun tidak berhasil. Kemudian melakukan penyisiran di sejumlah lokasi setelah berbuka puasa hingga pukul sebelas malam pada Senin, 1 Agustus 2011. Pencarian dihentikan setelah mendapatkan SMS bahwa korban sedang menjenguk temannya di rumah sakit dan sekarang istirahat. Namun, menurut Al Fattah ada kejanggalan dari tulisan SMS tersebut berbeda dari biasanya, kemudian kata-katanya tidak menyambung dimana SMS nya “Aku menjenguk teman di rumah sakit, aku istirahat”. Tetapi ketika dihubungi kembali menanyakan posisi korban, dari HP korban tidak ada jawaban sehingga hal ini diteruskan ke pimpinannya dan dilakukan pencarian kembali. Keesokan harinya pada 2 Agustus 2011, Al Fattah kembali menanyakan kepada keluarga korban tentang keberadaannya, namun keluarganya mengatakan korban tidak berada di rumah sejak Senin, 1 Agustus. Setelah mendengarkan saksi, ketua Majelis Muhammad melanjutkan sidang pada Kamis mendatang. (m38)

Bupati Palas ... seluas 5 hektare. Diperkirakan kerugian negara atas dugaan korupsi itu sebesar Rp6.048.827.227,73 (dana ini adalah dana yang hilang dari DAK/DAU, dan sesuai audit BPKP). Ironinya, pembayaran alat berat untuk pelaksanaan proyek tersebut masih menunggak. Sadono mengatakan, penyidikan terhadap kasus itu sebelumnya dilakukan Polres Tapsel. Penyidik Polres Tapsel sudah melakukan pemeriksaan sejumlah saksi, termasuk memeriksa para tersangka, tetapi Polres tidak memeriksa BL. Dalam gelar perkara itu, Polda menetapkan mantan Kadis PU Palas CW, AHN yang menjabat sebagai PPK, PD menjabat BUD dan Ketua DPRD Palas HMRH sebagai tersangka. “Awalnya calon tersangka ada sembilan, tetapi sementara ini hanya lima yang ditetapkan sebagai tersangka,” sebut Sadono sembari mengatakan kerugian dalam kasus tersebut lebih Rp6 miliar. Kasus kedua bupati Sementara itu, Kapolres Tapanuli Selatan AKBP Subandriya ketika ditanya kasus itu mengatakan, kasus yang melibatkan Bupati Padang Lawas BL ditangani Polda Sumut. “Urusan (penyidikan) bupati dan ketua DPRD Palas ditangani Polda. Tetapi mungkin pejabat daerah seperti Kadis PU, kita yang tangani,” ujarnya, Kamis. Dugaan korupsi ini merupakan perkara kedua yang melibatkan BL sebagai pejabat tertinggi sebuah daerah. Pertama, perkara pemalsuan surat akta tanah saat dia menjabat Camat di Kec. Barumun. Perkaranya sudah mendapat putusan dari Mahkamah Agung dan berkekuatan hukum tetap. BL dihukum 6 bulan penjara dengan masa percobaan 1 tahun. Perkara kedua dugaan korupsi DAK/ DAU 2009 untuk pembangunan sara prasarana perkantoran Pemkab Palas setelah BL menjabat Bupati di tanah kelahirannya sendiri. (m27/a27)

dan penyerahan seluruh barang bukti. Pws security, Darjo, yang dikonfirmasi Waspada melalui selular menyatakan, kasus pen-curian crude oil di wilayah Per-tamina Rantau sepanjang tahun 2011 tercatat sebanyak 15 kasus, tahun 2012 hanya satu kasus. Sebelumnya, security bersama Polsek Besitang menangkap dua orang warga Medan Marelan yang diduga terlibat dalam aksi pencurian crude oil. Dalam

penangkapan ini, petugas menyita 3700 liter crude oil, satu unit truk Cold Diesel BK 8713 XA. Saat ini, polisi masih memburu tujuh orang pelaku lainnya. Kapolsek Besitang, AKP Sukerman didampingi Kanit Reskrim, Iptu Abdul Rahman, SH dikonfirmasi Waspada membenarkan pihaknya ada menerima pengaduan sekaligus penyerahan barang bukti truk Cold Diesel BK 8397YI berisikan 1 drum minyak, 4 fiber dan beberapa drum kosong.(a02)

Bima Rusuh ...

cakup wilayah Kecamatan Lambu, Sape, dan Langgudu.

yang baru bubar setelah dibubarkan paksa oleh aparat kepolisian hingga mencuat insiden penembakan yang menewaskan dua orang warga itu. Aksi unjuk rasa yang berujung pembakaran kantor Bupati Bima itu terkait tuntutan pembebasan 56 warga Lambu dan Sape yang dulu berunjuk rasa di Pelabuhan Sape, dan saat ini ditahan aparat kepolisian untuk diproses hukum. Tuntutan lainnya yakni pencabutan Izin Usaha Pertambangan (IUP) yang dikantongi PT Sumber Mineral Nusantara (SMN), sebagaimana tuntutan dalam aksi sebelumnya. IUP bernomor 188/45/357/ 004/2010 itu diterbitkan Bupati Bima Ferry Zulkarnaen, yang mencakup areal tambang seluas 24.980 hektare, yang men-

Antisipasi Flu ... burung di beberapa kota di Indonesia. Wahid menyebutkan, pihaknya sudah membagikan disinfektan ke Camat dan Lurah, sehingga dapat dilakukan penyemprotan di seluruh lingkungan masing-masing untuk mengantisipasi lingkungannya dari virus flu burung. “Di Medan belum endemis flu burung, tapi kita minta kepada masyarakat jika ada unggas yang mati seketika harus segera dilaporkan dan dikubur langsung. Ini juga sebagai upaya un-

Miranda ... Istri dari mantan Wakapolri Adang Daradjatun ini diduga menjadi perantara dalam memberikan cek perjalanan sebagai suap. Miranda, menurut Abraham, dijerat dengan pasal 5 ayat 1 huruf b Undang-Undang (UU) Nomor 30 tahun 1999 sebagaimana diubah dengan UU Nomor 20 tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi (Tipikor). Dengan pasal tersebut mantan Deputi Gubernur Bank Indonesia ini terancam minimal satu tahun dan maksimal lima tahun. Tidak hanya itu, Miranda

Posisi Tak ... “Itu (upaya pelengseran) kan cerita di luar. Di dalam kami kompak, solid dan waras cara berpikirnya,” ujar Anas. Kemarin, Anas mengumpulkan jajaran pengurus inti Dewan Pengurus Pusat Partai Demokrat dalam sebuah rapat harian di Kantor DPP Demokrat, Jakarta. Turut hadir dalam rapat itu adalah Sekretaris Jenderal Demokrat Eddhie Baskoro Yudhoyono (Ibas). Rapat yang dipimpin Anas itu membahas tentang perbaikan dan penguatan partai. “Ka-

Yakin Tak ... ini,” tandas mantan Putri Indonesia tersebut. Angie yakin dirinya tidak akan ditangkap Komisi Pemberantasan Korupsi (KPK) terkait kasus ini. Sebab, dirinya yakin tidak terlibat dalam kasus mega korupsi ini. “Saya yakin KPK tak akan ‘memasukkan’ orang yang tidak terlibat, karena KPK profesional dan adil,” tegas perempu-

Bebaskan 53 Tahanan Selain membakar kantor bupati dan KPUD Bima, warga yang mengamuk juga membebaskan paksa 53 orang tahanan dari Lembaga Pemasyarakatan Raba, Kabupaten Bima. Saksi mata mengatakan, massa itu mendatangi Lembaga Pemasyarakatan (Lapas) Raba, Kabupaten Bima, dan meminta para tahanan titipan polisi terkait insiden berdarah di Pelabuhan Sape, 24 Desemer 2011, dilepas saat itu juga. “Massa mengancam jika tidak dilepas maka Lapas Raba Bima itu juga akan dibakar, sehingga petugas lapas memenuhi tuntutan tersebut, dan massa menyambut dengan kegembiraan,” kata Didin, seorang saksi mata aksi massa tersebut. tuk memutus mata rantai flu burung,” jelas Wahid. Kabid Kesehatan Hewan (Keswan) dan Kesehatan Masyarakat Veteriner (Kesmavet) Distanla Medan Dewi Nainggolan mengatakan, saat ini peralihan cuaca dari musim hujan ke musim kemarau perlu diwaspadai. Sebab pada saat peralihan ini, peluang penyebaran virus flu burung semakin besar. Untuk itu Distanla Medan sudah membentuk satgas Partisipan Desease Survailance Response (PDSR). Satgas ini kata Dewi, bertujuan merespon unggas yang ada di Medan. (m50) juga dijerat dengan pasal 13 UU Tipikor dan pasal penyertaan 55 ayat 1 dan 2 KUHP. Abraham mengatakan MSG membantu atau turut serta membantu NN melakukan Tindak Pidana korupsi memberikan cek perjalanan. Dengan pasal-pasal tersebut tersangka dapat dijatuhi hukuman lebih berat jika memang terbukti. Miranda: Saya terkejut Miranda mengaku terkejut telah ditetapkan tersangka . “Saya terkejut,” kata Miranda kepada wartawan di kediamannya di Jakarta. Kendati menghargai langkah yang ditempuh KPK kepada dirinya, Miranda mengaku tidak mi berbicara tentang perbaikan, penguatan dan penajaman partai. Tak menyinggung soal pelengseran,” kata Wakil Sekretaris Jenderal Demokrat Ramadhan Pohan secara terpisah. Isu pelengseran Anas muncul setelah Susilo Bambang Yudhoyon selaku ketua Dewan Pembina selama dua malam berturut-turut memanggil seluruh pengurus dan Dewan Kehormatan partai. Salah satu bahasannya adalah soal Anas. Bantah Terima Rp100 Juta Anas membantah telah menerima dana kampanye seperti an berdarah Manado tersebut. Sebagaimana diberitakan sebelumnya, nama Angelina Sondakh disebut Yulianis (saksi persidangan dan mantan anak buah Nazaruddin) telah menerima fee sebesar Rp5 miliar terkait proyek ini. Angie sebelumnya juga dituding telah terlibat percakapan berujung transaksi dengan Mindo Rosalina Manulang. Dari situlah istilah “Apel Malang” dan “ApelWashington” muncul. (okz)

Al Bayan ... yang mampu menghapus pahala amal ibadah. Hal ini dijelaskan Allah SWT dalam surah AlBaqarah (2) ayat ke-264, “Hai orang-orang yang beriman, janganlah kamu menghilangkan (pahala) sedekahmu dengan menyebut-nyebutnya dan menyakiti (perasaan si penerima), seperti orang yang menafkahkan hartanya karena riya kepada manusia dan dia tidak beriman kepada Allah dan hari kemudian. Maka perumpamaan orang itu seperti batu licin yang di atasnya ada tanah, kemudian batu itu ditimpa hujan lebat, lalu menjadilah dia bersih (tidak bertanah). Mereka tidak menguasai sesuatupun dari apa yang mereka usahakan; dan Allah tidak memberi petunjuk kepada orang-orang yang kafir.” Dosa lain yang mampu menghapus pahala amal ibadah manusia adalah perkataan kotor menghapuskan ibadah haji. Masih dalam surah Al-Baqarah (2), Allah SWT menegaskan hal tersebut, yakni ayat ke-197, “(Musim) haji adalah beberapa bulan yang dimaklumi, barangsiapa yang menetapkan niatnya dalam bulan itu akan mengerjakan haji, maka tidak boleh rafats, berbuat fasik dan berbantahbantahan di dalam masa mengerjakan haji. Dan apa yang kamu kerjakan berupa kebaikan, niscaya Allah mengetahuinya. Berbekallah, dan sesungguhnya sebaik-baik bekal adalah takwa dan bertakwalah kepada-Ku hai orang-orang yang berakal.” Ibnu Abbas sebagaimana dinukil Ibnu Katsir dalam kitab tafsirnya, mengartikan rafats dengan mengeluarkan kata sindiran yang mengandung arti persetubu-

Waspada/Abdullah Dadeh

DIRJEN PSDKP Syahrin Abdurrahman baju kuning (tengah) diapit Bupati Batubara H. OK Arya Zulkarnain (kanan) dan Wabup Deliserdang H. Zainuddin Mars (kiri) serta pejabat lainnya fhoto bersama para nelayan barisan depan.

‘’ Kami Pulang ... “Kami senang pulang kampung bisa masuk VIP room Bandara Polonia Medan layaknya seperti pejabat negara,” kata Budiono, 32, dan Amir, 22, keduanya nelayan asal Deliserdang. Bahkan Amir bin Rusli, 22, nelayan asal Pantailabu Deliserdang membenarkan, selama di penjara Pokok Sena Malaysia, semua nelayan Indonesia diperlakukan dengan baik. “Tidak ada penyiksaan bagi kami sejak ditangkap 23 Agustus 2011, ujarnya. Ke 11 nelayan, di antaranya empat nelayan asal Paluh Sibaji Pantailabu Deliserdang dan tujuh nelayan asal Batubara, antara lain Saan bin Rusli, Alwatan bin Baidi, Lukman bin Harun dan Amir bin Rusli, Sementara tujuh nelayan asal Medang Deras Batubara antara lain Riduan, Sholil, Budiono, Amrianto, Iwan, Ilham dan Dhaan. Begitupun, Syahrin Abdurrahman, Dirjen Pengawasan Sumber Daya Kelautan dan Perikanan (PSDKP) menyatakan, pihaknya setiba di Jakarta akan melapor kepada Menteri Kelautan dan Perikanan Sharif pernah menyangka bakal melalui proses hukum yang diakuinya sejak lama harus ditempuhnya. “Saya tidak menyangka akan melalui proses seperti ini,” kata Miranda. Dia berharap, status terakhir dirinya dari KPK membuat kasus ini akan segera terang dan berakhir, tidak lagi berlarut-larut. Miranda juga menyatakan tidak melihat KPK akan menahannya karena selama ini dia selalu kooperatif dengan selalu memenuhi panggilan KPK dan memberikan keterangan apapun yang diminta KPK. “Tak ada keperluan untuk menahan saya,” kata Miranda. (Ant/vvn) yang disebutkan oleh mantan Wakil Direktur Keuangan PT Permai Group, Yulianis dalam persidangan Rabu (25/1). Anas menegaskan tuduhan dia menerima dana Rp100 juta tidaklah benar. “Apa itu? Daun pisang kali ya,” kata Anas. Dalam persidangan,Yulianis menyebut adanya aliran dana ke kongres partai Demokrat di Bandung pertengahan tahun lalu. Dana berasal dari perusahaan milik mantan Bendahara Umum Partai Demokrat M Nazaruddin, Permai Group. Saat itu, terpidana kasus Wisma Atlet, Mindo Rosa Manulang berperan sebagai pengusaha. Mindo, kata Yulianis, bertindak sebagai bawahan Nazaruddin menyumbang sejumlah dana kepada Anas Urbaningrum dan Andi Mallarangeng. Menurut catatan Yulianis, saat itu Rosa mengajukan anggaran sejumlah Rp100 juta untuk Anas dan Rp150 juta untuk Andi. Tapi tudingan itu dibantah keras oleh Anas. “Saya kira tidak ada itu. Itu tidak benar,” tegas Anas. (vvn)

han. Ungkapan ini menurut orang-orang Arab dinamakan ‘irabah yang artinya ‘kata-kata yang jorok.’ Jadi rafats dapat diartikan dengan perkataan yang menimbulkan birahi yang tidak senonoh atau kotor. Dosa lain adalah mengeraskan suara di depan Rasulullah SAW (atau saat ini, ketika sabdanya disampaikan). “Hai orang-orang yang beriman, janganlah kamu meninggikan suaramu melebihi suara Nabi, dan janganlah kamu berkata kepadanya dengan suara yang keras, sebagaimana kerasnya suara sebagian kamu terhadap sebagian yang lain, supaya tidak hapus (pahala) amalanmu, sedangkan kamu tidak menyadari.” Demikian redaksi Firman Allah SWT dalam surah Al-Hujurat (49) ayat ke-2. Jelas dan tegas bahwa meninggikan suara di hadapan Rasulullah SAW akan menghapus seluruh amal ibadah. Selanjutnya beberapa hadis Rasulullah SAW menegaskan menyakiti tetangga dengan lidah menghapuskan pahala puasa dan shalat malam. Alquran menjelaskan agar menghindarkan diri dari menyakiti orang lain dan tidak memperbincangkan kebatilan bahkan diancam neraka, sebagaimana keterangan surah Al-Muddatstsir (74) ayat ke-42 sampai ke-47, “Apakah yang memasukkan kamu ke dalam Saqar (neraka)? Mereka menjawab: ‘Kami dahulu tidak termasuk orang-orang yang mengerjakan salat, dan kami tidak (pula) memberi makan orang miskin, dan adalah kami membicarakan yang batil, bersama dengan orangorang yang membicarakannya, dan adalah kami mendustakan hari pembalasan, hingga datang kepada kami kematian’.”

Cicip Sutarjo agar dapat disampaikan ke pejabat Malaysia, menyikapi penangkapan nelayan Indonesia khususnya dari Sumut. Setidaknya dari Indonesia meminta kepada pejabat Malaysia khususnya patroli laut agar jangan selalu menangkap nelayan-nelayan tradisional. “Mereka ini tidak memahami batas wilayah, kalau kedapatan sebaiknya dihalau saja balik ke Indonesia, jangan tangkap dan dipenjara,” kata Dirjen Bahkan menurutnya, pemulangan sebelas orang nelayan asal Sumut ini merupakan hasil dari kegiatan advokasi yang terus-menerus dilaksanakan Kementerian Kelautan dan Perikanan (KKP). Sebelumnya berturut-turut pada 25 November 2011 sebanyak 11 nelayan dipulangkan dan langsung diterima Menteri Kelautan dan Perikanan, 16 Desember 2011 sebanyak 11 nelayan asal Sumut yang ditangkap petugas kelautan Malaysia juga

berhasil dipulangkan. Sedangkan Bupati Batubara OK Arya Zulkarnain terlihat ceria atas bebasnya tujuh nelayan asal Medang Deras Batubara. Ke depan perlu langkah-langkah membantu mereka. Setiap pukat nelayan harus ditempel nomor selar, mendata keberadaan jumlah nelayan daerah asalnya. Sementara Pemkab Batubara akan bekerjasama dengan Angkatan Laut di Tanjungbalai mencetak peta tahan air agar nelayan memahami batas zona larangan atau global position systim (GPS). OK Arya mengatakan, dari 370 ribu penduduk Kab. Batubara, 30 persen diantaranya mengandalkan kehidupan di laut sebagai nelayan. Sementara program Pemkab Batubaru memperbaiki infrastruktur jalan-jalan di sekitar rumah nelayan di Pangkalan Dodek. Ke depan masih ada ratusan rumah nelayan di sana

Seychelles Dorong ...

bisa berhubungan. Bahkan negara ini bisa dimanfaatkan untuk memasuki pasar Afrika.” Dia mengatakan jumlah penduduk Afrika saja sekira 800 juta orang. “Jika ingin menggali pasar baru, Seychelles merupakan hub yang menguntungkan,” jelasnya. Kalaupun tidak mau ke Afrika, ada negara-negara kecil di kawasan Seychelles. Negara tetangga Seychelles ialah Mauritius dan Reunion di sebelah selatan, Komoro dan Mayotte di barat daya, dan Maladewa di timur laut. “Negara di kawasan tersebut butuh consumer goods yang banyak diproduksi di wilayah Sumut,” ungkapnya. Untuk tahap awal perkenalan produk dari Sumatera Utara diwakili Serdang Bedagai tahun ini, kata dia. “Selama ini kita hanya dengar di Serdang Bedagai ada sawit, karet dan consumer goods bahkan dodol. Maka dalam karnaval Seychelles yang mulai 2 Maret, Sergai ambil bagian,” jelasnya. Mana tahu setelah itu akan ada kontak bisnis sehingga hubungan pebisnis Sumut dengan Seychelles terjalin, jelasnya. Erry Nuradi mengungkapkan ini memang salah satu upaya daerahnya masuk ke pasar lain. “Sering kita lihat produk kita banyak yang bisa dijual ke negara lain. Inilah salah satu cara. Kita ikuti karnaval sehingga nanti ada promosi dan langkah apa saja yang bisa diambil untuk bekerjasama,” tuturnya. One village one product Selain kunjungan tersebut, Erry Nuradi seperti rutinitas setiap tahun juga menyerahkan buku edisi khusus perkembangan kabupaten yang dipim-

saat berkunjung ke gedung Bumi Warta Harian Waspada Medan, Kamis (26/1). Dia datang bersama Bupati Serdang Bedagai (Sergai) HT Erry Nuradi, Rachmad Karo-karo, staf ahli Bupati Sergai dan Mariyono, Kabag Humasy Pemkab Sergai. Mereka diterima Pemimpin Redaksi Harian Waspada Prabudi Said, Redaktur Pelaksana Berita Armin Nasution dan Redaktur Sumatera Utara T. Dony Paridi. Nico Barito yang dulu bertugas di PBB bercerita tentang Republik Seychelles. Ketika dia memperkenalkan negara tersebut baru ada pemahaman tentang letak negara. Dia mengatakan ini adalah negara kepulauan. Republik Seychelles berada di tengah Samudera Hindia, merupakan negara kepulauan di kawasan Afrika. Letak Seychelles strategis, berada sekitar 1.600 kilometer sebelah timur daratan Afrika dan timur laut Madagaskar. Penduduk Seychelles, menurut Nico, 85 ribu jiwa dengan pendapatan per kapita 28.000 dolar AS mewakili keragaman etnis seperti Eropa, Arab, China, India, dan dari sejumlah negara Asia lain, termasuk Indonesia. Dari Jakarta, saat ini, kata dia, ada penerbangan setiap hari dengan melintas ke Dubai. Jakarta-Dubai makan waktu tujuh jam, kemudian dari Dubai ke Seychelles sekira empat jam. “Negara ini setidaknya menjadi destinasi khusus. Juga menjadi financial hub. Bahkan bisa juga menjadi international business offshore,” tuturnya. “Saya melihat Seychelles dan Sumut

akan diperbaiki untuk siap huni. “Pemkab Batubara secara terus menerus berupaya meningkatkan kesejahteraan nelayan,” katanya. * Abdullah Dadeh

Ada-ada Saja ... farmasi yang diyakini merupakan pabrik obat yang tercemar itu. “Obat tersebut boleh jadi terkontaminasi metal berat yang menimbulkan satu reaksi reaksi obat merugikan,” kata Dr Javed Akram, dokter yang memimpin penyelidikan sampai menyebabkan kematian. Obat tersebut telah diberikan gratis oleh Institut Kardiologi yang dikelola pemerintah. Akram mengatakan para pasien yang memakan obat tersebut dilarikan ke rumah sakit dengan gejala turunnya tiba-tiba sel darah dan mengalami pendarahan dari berbagai bagian tubuh pasien. (cnn/m10) pinnya selama 2011. Dia menyatakan kalau selama ini Sergai sudah melakukan berbagai upaya untuk mendorong kemajuan daerahnya, tahun ini pun akan melanjutkan hal sama. “Dulu kita dikenal sebagai perintis one stop service perizinan. Lalu kita lanjutkan dengan program pendidikan serta pariwisata. Kalau tahun ini saya ingin fokus dengan program pemerintah one village one product (OVOP). Tiap kecamatan nanti ada produk unggulan,” jelasnya. Menurut Erry, seringkali produk Sumut atau juga Sergai tak dikenal setelah sampai di luar negeri. “Sebab sudah ganti kemasan. Itu sebabnya dengan OVOP kita ingin memperkenalkan secara maksimal ke luar negeri,” kata Erry Nuradi. Di kesempatan itu, Prabudi Said sedikit menyinggung tentang produk dari Sumut yang harus memperhatikan kualitas. “Saya punya pengalaman beli dodol untuk dibawa ke Amerika. Pertama dibawa enak. Tapi ketika beli lagi dan bawa ke sana rasanya sudah beda. Itu mengecewakan. Saya ingin pesankan kepada Pak Bupati untuk ikut memberi warning pada pengusaha kita mempertahankan kualitas produk,” tuturnya. Dalam pertemuan tersebut banyak sekali topik pembicaraan mengalir. Termasuk keberadaan Seychelles serta upaya Serdang Bedagai terus memajukan daerahnya. Di akhir pertemuan Erry Nuradi menyerahkan buku edisi khususnya kepada Prabudi Said dan Nico Barito. Kemudian secara khusus Prabudi Said menyerahkan buku sejarah peristiwa 60 tahun halaman satu Harian Waspada kepada Nico. (m06)

WASPADA Jumat 27 Januari 2012

Medan Metropolitan

A3

Ruko Agen Resmi Pertamina Terbakar MEDAN(Waspada): Satu rumah toko (ruko) di Jalan Sutomo, Medan Timur, Kamis (26/1) sekira pukul 11:00 terbakar. Api berasal dari lantai IV ruko yang dijadikan sebagai kantor pemasaran agen pelumas dan Elpiji oleh PT PT Pola Raya Jaya Sakti. Dari lantai IV terlihat kepulan asap hitam yang diikuti percikan api yang nyaris menghanguskan ruko dan isi dalamnya. Informasi diperoleh dikepolisian menyebutkan, kuat dugaan api berasal dari korsleting pada mesin kompresor alat pendingin ruangan. Api yang mulai membesar membuat karyawan agen pelumas dan Elpiji serta pemilik ruko panik. Dengan alat seadanya, sejumlah karyawan langsung memadamkan api di ruang sembahyang di lantai IV ruko milik Halim Jafar, 60. Selain ruang sembahyang yang dipenuhi dupa, satu ruang kerja lainnya di ruko tersebut juga ikut terbakar. Tak ada korban jiwa dalam kebakaran tersebut, namun kerugian ditaksir puluhan juta. Menurut saksi mata Sipon, 42, yang bekerja sebagai pembantu di ruko tersebut, dirinya saat itu baru pulang dari pasar, kemudian naik menuju lantai IV melihat asap hitam sudah mengepul. Dia dengan spontan Waspada/Surya Efendi

BEBAS MASUK: Satu truk pengangkut peti kemas melintas di Jln. Stasiun Kereta Api dekat lapangan Merdeka Medan, Kamis (26/1). Tidak hanya truk pengangkut material bangunan, truk pengangkut peti kemas juga bebas masuk ke inti Kota Medan tanpa ada penindakan dari pihak kepolisian dan Dinas Perhubungan.

Mental Calon Bobrok Picu Pilkada Curang MEDAN (Waspada): Tingginya potensi kecurangan Pemilihan Kepala Daerah (Pilkada) di Indonesia, karena bobroknya mental para calon kepala daerah yang tampil pada pesta demokrasi langsung tersebut. Di samping tidak ada sanksi pidana kuat dan mengikat terhadap pelakunya. “Para kandidat menyatakan siap bertarung, tapi kebanyakan tidak siap kalah, sehingga mereka melakukan segala cara agar bisa menang,” kata Pengamat Tata Negara Universitas Sumatera Utara (USU) Faisal Akbar

menjawab Waspada, Kamis (26/ 1), menanggapi pernyataan Ketua MK Mahfud MD yang menyebutkan semua Pilkada di Indonesia curang. Menurut Faisal, politikuspolitikus busuk sering memanfaatkan rendahnya pendidikan politik rakyat dengan merencanakan kecurangan seperti money politik, manipulasi data. “Rendahnya pendidikan politik masyarakat, membuat mereka dijadikan obyek demokrasi oleh calon-calon yang haus akan kekuasaan,” sebutnya. Faisal menyarankan agar tujuan tidak baik para politikus busuk tidak berjalan, maka masyarakat harus bisa membetengi diri dari godaan praktek money politik. Menurutnya, tidak sedikit dana dikucurkan untuk sebuah perhelatan demokrasi, na-

mun hasilnya tidak sebanding. Sebab, akibat kecurangan itu terjadi konflik baik secara hukum, maupun bentrok fisik. Disebutkannya, ketika arus reformasi menyentuh masyarakat akar rumput, kebebasan berkehendak tadinya yang terkungkung tiba-tiba menjadi bebas lepas. Agar berjalan baik, semua pihak harus menanamkan menerima pendapat orang lain dan legowo, menerima kekalahan. Begitu juga dengan para kandidat yang mencalonkan diri, semua harus siap kalah. “Kalau ini sudah berjalan kemungkinan kecurangan bisa diminimalisir,” tegasnya. Memang tidak semua Pilkada curang, lanjut Faisal, akibat politikus busuk semata, mental penyelenggaran dan pengawasan yang disinyalir juga belum

Kebijakan Pemerintah Belum Mampu Angkat Kesejahteraan Petani MEDAN (Waspada): Guru Besar Fakultas Pertanian dan Ekonomi Universitas Medan Area (UMA) Prof Ir Zulkarnain Lubis MS, Ph.D mengatakan, kebijakan pemerintah dan hasil pertanian belum mampu mengangkat kesejahteraan para petani. Hal tersebut diungkapkannya pada seminar nasional dan musyawarah nasional (Munas) ke IX Ikatan Senat Mahasiswa Pertanian Indonesia (ISMPI), di aula kampus UMA Jln. Kolam Medan Estate, baru-baru ini. Menurut Prof Zulkarnain, persoalan lain mengakibatkan petani sulit berkembang karena hanya memiliki lahan sempit, menggunakan teknologi tradisional, distribusi atau tata niaga sarana produksi pertanian belum sehat. “Kondis ini mengakibatkan gejolak harga yang tak sehat dilakukan para spekulan dan distributor lokal,” sebutnya dihadapan ratusan peserta seminar

dari 50 perguruan tinggi di Indonesia. Selain Zulkarnain, narasumber seminar dan Munas IX ISMPI yang dibuka Rektor UMA Prof Dr HA Ya’kub Matondang MA adalah Prof Dr Ir Hj Retno Astuti Kuswardani MS. Kata dia, lemahnya kelembagaan, manajemen penyuluhan, posisi tawar petani, dan rendahnya pendidikan, juga menjadi persoalan yang membuat petani terus terpuruk. Kesemua permasalahan itu diperlukan reorientasi tujuan pembangunan dari distorsi pasar, memberikan porsi politik pertanian yang lebih pada penanganan pasca produksi dan pemasaran serta pengembangan hasil produksi pertanian, tidak dalam bentuk barang mentah merupakan salah satu upaya mengantisipasi permasalahan yang terjadi pada petani. Sedangkan Prof Retno Astuti menyarankan, agar petani

menggunakan implementasi pertanian organik yang dapat meningkatkan kemandirian petani menuju terwujudnya ketahanan pangan. Ketahanan pangan merupakan kunci pokok kedaulatan pangan dengan sendi pokoknya pemantapan kedaulatan negara. Munas IX ISMPI Ketua Panitia Polindo Hendrik Pakpahan mengatakan, bertolak dari kondisi yang menimpa petani, maka ISMPI perlu menciptakan gagasan yang konseptual. ISMPI bekerjasama dengan PEMA Fakultas Pertanian UMA menyelenggarakan Munas ke IX di Medan. Dengan munas ini, ISMPI akan mencoba untuk menjalin silaturrahmi seluruh mahasiswa pertanian di seluruh Indonesia, untuk selalu berkreasi di bidang pertanian dan berjuang demi kesejahteraan petani yang mandiri. (m49)

baik membuat permainan kotor tumbuh subur. “Tidak jarang tudingan datang menyebutkan penyelenggara Pilkada bermain dengan para calon-calon yang maju dalam Pilkada,” ujarnya. Menurut Faisal Akbar pesta demokrasi bersih atau Pilkada bebas dari kecurangan terwujud ketika masyarakat bisa mencerna akibat dari pola-pola kotor seperti money politik yang dipertontonkan oknum tertentu. Kemudian orang-orang duduk di lembaga penyelenggara dan pengawasan Pemilu teruji integritas dan kredibelitasnya. Begitu juga, rekam jejak para kandidat terekspos ke publik. Secara terpisah, pengamat hukum Sumut Ibeng Syaruddin, SH mengatakan, kecurangankecurangan dalam Pilkada akibat dari tidak adanya sanksi pidana kuat dan mengikat terhadap pelakunya. “Semua aturannya bersifat administratif sehingga membuat orang tidak takut lagi,” sebutnya. Menurut Ibeng, pernyataan Ketua MK tersebut memang be-

nar dan fakta serta diakui, sekalipun ada pemenangnya. Sehingga hal itu membuktikan pentas demokrasi yang diusung melalui pemilihan langsung (Pilsung) penuh dengan manipulatif. Dia menyontohkan, melebihkan jumlah pemilih, penggelembungan suara, poltik uang (money politics), lalu tidak pula cuma uang melainkan dapat berupa barang serta adanya intervensi pimpinan lembaga kepada bawahan maupun karyawan. Sedangkan mantan Ketua Panwaslu Sumut Ikhwaluddin Simatupang SH menyebutkan, hampir seluruh calon kepala daerah yang ikut dalam Pilkada tidak percaya dan yakin dirinya bisa menang tanpa harus memberikan uang kepada pemilih (politik uang). Dikatakanya, kecurangan dalam Pilkadasung itu umumnya berupa politik uang, kampanye terselubung, penggunaan hak pilih atas nama orang lain pemilih yang berlum berhak, memilih dua kali, dan lainnya. (m49/m34).

Korban Penipuan Melalui Internet Ngadu Ke Polisi MEDAN (Waspada): Aksi penipuan melalui internet kembali lagi terjadi Medan. Kkorban Y Sianturi yang menderita kerugian uang tunai Rp2.650.000, melaporkan kasus tersebut ke Polsek Medan Helvetia, Kamis (26/1). Informasi yang diperoleh Waspada di lapangan,Y Sianturi, penduduk Jln. Plamboyan, Medan Helvetia, menjadi korban penipuan setelah membuka situs website www. Took Bagus. com untuk membeli handphone Black Berry Dakota. Dalam situs itu tertera jenis HP diinginkannya dijual seharga Rp2.650.000. Merasa tergiur, korban menghubungi nomor handphone si penjual HP bernama Gunawan, warga Tanah Enam Ratus, Medan Marelan,

yang dicantumkan di website tersebut. Melalui hubungan telepon itu, pelaku mengatakan untuk memperolehHPtersebut,korban harus mentransfer uang melalui rekening BRI. Selanjutnya korban mentranfer uang Rp600.000. Usai mentransfer uangnya, korban menghubungi pelaku memberitahukan uang sudah dikirim melalui ATM BRI di dekat Millinium Plaza Jln. Kapten Muslim Medan. Namun, pelaku minta korban agar melunasi sisanya dengan alasan bosnya minta dilunasi. Kemudian korban menuruti permintaan pelaku dengan mentransfer sisa yang diminta sehingga keseluruhan berjumlah Rp2.650.000. Setelah itu, korban menghubungi pelaku lagi dan pelaku menjawab bos ada masalah dengan istrinya, sekaligus minta kepada korban mengirimkan pulsa Rp200.000. Tapi ketika dihubungi lagi, handphone pelaku sudah tidak aktif. Merasa menjadi korban penipuan, Y Sianturi melaporkannya ke Polsek Medan Helvetia. Kapolsek Medan Helvetia Kompol Sutrisno Hady Siswanto SH, SIK, ketika dikonfirmasikan melalui telefon selular seputar kasus itu membenarkan. Kata Sutrisno, pihaknya menyelusuri rekening dan alamat pelakunya. “Dalam kasus ini, korban sudah diambil keterangannya,” ujarnya. Menurut dia, Polsek Medan Helvetia bekerjasama dengan PolrestaMedanmelakukanpengusutan kasus penipuan melalui internettersebut. “PolrestaMedan punya ahli di bidang informasi dan tehnologi (IT) untuk membongkarjaringanpenipuanmelalui internet,” sebut Sutrisno. Sebelumnya juga M Ilham menjadi korban penipuan melalui internet. Dia ditipu untuk membeli iPhone 4 dengan mentransfer uang Rp6.850.000 melalui rekening BCA atas nama Yayang Agung Sundawa. Dalam kasus Ilham tersebut, Polresta Medan belum mampu mengungkap sekaligus menangkap pelakunya. (m36)

berteriak kebakaran.”Saya baru pulang dari pasar, saya naik ke atas dan melihat sudah ada asap, ya saya teriak lah,” katanya. Dalam peristiwa itu, Polsek Medan Timur menurukan personel melakukan olah TKP dilokasi kebakaran dan mengamankan satu unit AC yang diduga menjadi penyebab kebakaran tersebut. Kanit Reskrim Polsek Medan Timur AKP Ridwan mengatakan, pihaknya masih melakukan penyelidikan atas kebakaran tersebut. “Masih kita lidik penyebab sebenarnya kebakaran tersebut. Api itu berasal dari lantai VI, api diduga dari korslet listrik. Kita mangamankan satu AC yang terbakar sebagai barang bukti serta memasang garis polisi di lokasi kebakaran,” sebutnya. Beberapa warga yang ditemui di lokasi kebakaran mengaku sedikit resah atas keberadaan usaha agen pelumas dan Elpiji tersebut. Ada jutga kantor perbankan yang takjauh dari lokasi kebakaran. “Takut juga la bang, banyak kali tabung gas di dalam, kalau meledak, kebakar semua ini,” ujar A Kiong dan beberapa pekerja lainnya di kawasan Jalan Sutomo, Medan Timur. Dinas Pencegah dan Pedaman Kebakaran (DP2K) Kota Medan menerjunkan tiga unit armadanya untuk memadamkan sijago merah di ruko tersebut. Kebakaran ini sempat membuat pusat perhatian warga sekitar dan pengguna jalan yang melintas. (h04)

Tunda Pembangunan Gedung DPRD Medan MEDAN (Waspada): Sampai saat ini, anggota DPRD Medan belum sepakat menunjuk lokasi sementara kantor mereka, menunggu pembangunan gedung baru selesai. Sesama anggota dewan terus berbeda pandangan tentang ini. Malah akhirnya sebagian dewan menolak pembangunan gedung baru DPRD Medan. Wakil Ketua Fraksi Patriot Persatuan Pembangunan (PPP) DPRD Medan Bangkit Sitepu, Kamis (26/1), malah meminta Wali Kota Rahudman Harahap menunda pembangunan gedung DPRD Medan hingga tahun 2014. Alasannya, belum ada gedung yang dianggap layak sebagai kantor sementara dewan. Menurut Bangkit, tarik menarik antara anggota dewan sangat tinggi dalam menentukan gedung mana yang dinilai layak. Beberapa gedung telah ditawarkan, antara lain gedung Bank Sumut, Paladium Plaza, Deli Plaza dan gedung PTPN IV. Alasannya macam-macam. Ada yang bilang akan berdampak kepada operasional bank, menyulitkan warga menyampaikan aspirasi dan sebagainya. Melihat perdebatan ini, kata Bangkit, ada baiknya wali kota menunda pembangunan gedung baru itu. Anggaran yang telah disediakan Rp90 miliar sebaiknya dialihkan untuk kepentingan lain. Dia menyarankan Pemko Medan membangun terminal di wilayah Medan Selatan, khususnya di Jln. Jamin Ginting. ‘’Sisanya, masih bisa digunakan untuk pembangunan infrastruktur, seperti jalan dan drainase,’’ katanya. Lagi pula, gedung DPRD Medan yang sekarang masih layak digunakan. Kalaupun membutuhkan perbaikan mungkin hanya kamar mandinya saja. Karena itu, lebih baik PemkoMedanmerenovasikamarmandidewan agar menjadi lebih nyaman. Dananya juga tidak terlalu besar yakni berkisar Rp200 juta. Dengan kondisi dewan yang berpolemik seperti ini, menurut Bangkit, sangat tidak baik bagi masyarakat. Kesannya dewan selalu saja

memperdebatkan fasilitas untuk dirinya dan tidak peduli dengan rakyat. Buktinya masih banyak infrastruktur yang belum baik. Di Jln. Letjen Suprapto Sementara itu, DPRD Kota Medan akan menempati kantor sementara di sebuah gedung tua di Jln. Letjen Suprapto. Bangunan milik Pemko Medan ini, pernah difungsikan sebagai kantor cabang salah satu partai politik. Alternatif ini dipilih di tengah sulitnya menentukan kantor sementara DPRD Medan karena kriteria dan persyaratan tertentu yang terkait dengan luas lahan dan lokasinya harus berada di Kota Medan. “Penentuan kantor sementara DPRD Medan harus mengutamakan gedung milik Pemko Medan. Kalau tidak ada, bisa disewa gedung milik Pemprovsu dan kalau tidak ada juga maka putusan terakhir gedung milik pemerintah pusat,” kata Wakil Ketua DPRD Medan H Ikrimah Hamidy. Saat ini, lanjut Ikrimah, yang diusulkan sebagai kantor sementara DPRD Medan yakni sebuah bangunan tua di Jln. Letjen Suprapto. Sedangkan alternatif lain yang sebelumnya dinilai tepat yakni Kantor Gubsu di Jln. Williem Iskandar, namun terkendala karena wilayah administrasi berada di Kabupaten Deliserdang. Sedangkan Kantor Dinas Perhubungan (Dishub) Sumut di Jln. Gaharu yang diusulkan sebagai alternatif, ternyata kepemilikannya sudah beralih ke pihak ketiga. “Jadi, gedung ini tidak mungkin difungsikan sebagai kantor sementara DPRD Medan,” papar Ikrimah seraya menambahkan, satusatunya alternatif yang mungkin disetujui adalah bangunan tua di Jln. Letjen Suprapto. Sementara itu, Sekretaris Dewan (Sekwan) DPRD Medan OK Zulfi mengatakan, pihaknya segera membentuk panitia tender terbuka untuk memperoleh kantor sementara DPRD Medan. Pembentukan panitia tersebut melibatkan Dinas Perumahan dan Pemukiman (Perkim), Dinas Tata Ruang dan Tata Bangunan (TRTB) dan lainnya. “Setelah panitia terbentuk, selanjutnya menjadi wewenang panitia. Sekwan hanya memantau perkembangannya saja,” ujarnya.(m12/m30)

Poldasu Tangkap Bandar Judi Samkwan Siantar MEDAN (Waspada): Petugas Polda Sumut menangkap seorang bandar judi samkwan (dadu putar) berikut 10 pemainnya dari Jln. dr Wahidin, Kota Pematangsiantar, Rabu (25/ 1) malam sekira pukul 23:00. Penangkapan pelaku judi dilakukan setelah polisi mendapat informasi dari masyarakat yang menyebutkan tentang keradaan lokasi perjudian di depan Pekong Saikon tersebut. Berdasarkan informasi itu, petugas melakukan penyelidikan dan menemukan adanya permainan judi. Setelah itu dila-kukan penggerebekan. Kepala Sub Direktorat Reserse Kriminal Umum III Polda Sumut AKBP Andry Setiawan kepada wartawan, di Mapoldasu, Kamis (26/

1), membenarkan pihaknya mengamankan seorang bandar judi samkwan dan 10 pemain bersama barang bukti dari lokasi perjudian tersebut. Bandar judi yang ditangkap, Halio alias Sugeng. Dari dia diamankan barang bukti 3 mata dadu, 6 set kartu remi, 5 lembar kertas warna coklat untuk dasar permainan, serta uang tunai Rp15 juta. “Bandar dan 10 pemain sudah diamankan, termasuk barang buktinya,” sebutnya. Andry menambahkan, pihaknya masih melakukan pengembangan untuk mencari bandar judi lainnya. “Saat ini sudah dilakukan proses penyidikan untuk pengembangan,” katanya menyebutkan, para tersangka akan dijerat Pasal 303 KUHPidana dengan ancaman hukuman maksimal lima tahun penjara.(m27)

Siswa SMAN-2 Kisaran Kunjungi Waspada MEDAN (Waspada): Sebanyak 100-an siswa/i SMA Negeri-2 Kisaran, melakukan kunjungan ke Redaksi Harian Waspada Jln. Suprapto No. 1 Medan, Kamis (26/1). Rombongan SMAN-2 Kisaran terdiri dari pelajar IPA dan IPS kelas III dipimpin koordinator Kamaluddin Marpaung S.Pd, Erna Sebayang S.Pd, dan Fitrowaty dterima Wakil PenanggungJawab(Wapenjab)HarianWaspada H. Sofyan Harahap S.Sos dan wartawan H Suyono,dilantai3ruangrapatRedaksiWaspada. Kata Marpaung, kunjungan ke Waspada yang merupakan surat kabar peduli terhadap pendidikan dan pembinaan umat, dalam rangka pendalaman materi pers mata pelajaran kewarganegaraan. Hal ini dinilai sangat penting karena didalam materi pers banyak terdapat ilmu pengetahuan secara umum yang wajib diketahui oleh para murid agar mereka tidak ketinggalan, terutama di era globalisasi yang serba canggih sekarang ini. “Dalam kunjungan ke

Kota Medan, kami memilih berkunjung selain Waspada juga ke TVRI Stasiun Medan dan SIB,” ujar Marpaung seraya mengucapkan terimakasih kepada pimpinan Waspada yang telah mengapresiasi kedatangan rombongan SMA Negeri-2 Kisaran. Dalam kesempatan tersebut H Sofyan Harahap memaparkan sejarah berdirinya Waspada yang kini sudah berusia 65 tahun, serta kegiatan HUT antara lain menggelar kegiatan road to dakwah Waspada termasuk ke kota Kisaran dan daerah tingkat II lainnya. Kemudian menggelar seminar nasional mengundang Menteri Pendidikan Prof Muhammad Nuh dengan tema karakter bangsa di Hotel Aryaduta Medan, dan pemberian anugrah Ani IdrusAward kepadasejumlahguruseSumateraUtara. Dalam perjalanannya Waspada sebagai koran perjuangan yang didirikan H Mohd Said dan Bunda Hj Ani Idrus, banyak menghadapi rintangan sehingga pernah dibredel. Namun dengan semangat pantang menyerah dari pendirinya yang dikenal idealis Waspada dapat terbit kembali hingga eksis sampai sekarang. (m24)

Waspada/Surya Efendi

SMA 2 KISARAN KUNJUNGIWASPADA:Wakil Penanggungjawab Harian Waspada Sofyan Harahap diabadikan bersama pelajar dan guru SMAN 2 Kisaran di gedung Bumi Warta Harian Waspada Medan, Kamis (26/1).

Medan Metropolitan

A4

WASPADA Jumat 27 Januari 2012

Pemimpin Di Daerah Pemekaran Seperti Raja Kecil MEDAN (Waspada): Anggota DPRDSU menilai pemekaran daerah terutama kabupaten/kota, sangat meguntungkan masyarakat. Hanya saja, bagaimana pemerintah dan para pemimpin di daerah pemekaran memaksimalkan potensi yang ada untuk meningkatkan taraf hidup masyarakatnya. Dua anggota Komisi A DPRDSU Alamsyah Hamdani dan Ahmad Ikhyar Hasibuan berbicara kepada Waspada di gedung dewan, Kamis (26/1). Mereka menanggapi adanya enam kabupaten di Sumut yang termasuk daerah tertinggal. Empat di antaranya merupakan kabupaten pemekaran seperti Nias Selatan, Nias Barat, Nias Utara dan Pakpak Bharat. Tentang pentingnya mengembangkan potensi daerah, menurut Hamdani, harus dilakukan para pemimpin di daerah pemekaran. “Saat ini, banyak para pemimpin di daerah pemekaran yang menganggap dirinya seperti raja-raja kecil dan harus dilayani. Seharusnya, mereka menjadi pelayan masyarakat,” tegasnya. Hamdani yang juga mantan ketua panitia khusus (Pansus) Pemekaran DPRDSUmengatakan,keuntunganyangdirasakanmasyarakatdalamhalpemekaran daerahadalahsemakindekatnyapelayaanpublik.‘’Saatkabupatenbelumdimekarkan, masyarakat sulit mengurus sesuatu di kantor pemerintahan,’’ ujarnya. Fakta masih ditemukannya kabupaten pemekaran yang tertinggal, menurut Hamdani, adalah suatu hal yang dapat dimaklumi. Karenanya dibutuhkan peran pemerintah pusat untuk membantu memajukan daerah itu. Pemerintah pusat, kata Hamdani, jangan berfikir untuk mengambil keuntungan saja dari daerah. Hasil-hasil daerah yang diangkut pemerintah ke pusat, harus dikembalikan lagi ke daerah, karena itu merupakan hak daerah. ‘’Itulah sebenarnya yang melatarbelakangi keinginan masyarakat untuk pemekaran. Saya pikir itu tidak salah. Buktinya masyarakat menikmati hasilnya dalam bentuk semakin dekatnya jalur birokrasi,’’ katanya. Bernuansa politik Sementara itu, anggota Komisi A lainnya Ahmad Ikhyar Hasibuan, sangat menyayangkan kalau semangat pemekaran daerah tidak diikuti dengan peningkatan etos kerja Pegawai Negeri Sipil (PNS) di daerah bersangkutan. Harusnya, dengan bertambahnya pejabat eselon II-IV di daerah pemekaran, akan semakin meningkatkan pelayanan kepada masyarakat. Senada dengan Hamdani, menurut Ikhyar Hasibuan, pemekaran daerah sangat positif bagi masyarakat. Adapun pengembangannya ke depan terletak

pada diri para pemimpin di daerah bersangkutan. ‘’Apakah dia mampu menggali potensi untuk menambah PAD. Tidak semata-mata hanya mengharapkan bantuan dari pemerintah pusat,’’ katanya. Mengapa daerah pemekaran masih ada yang tertinggal? Menurut Ikhyar, biasanya daerah pemekaran tidak maju karena dasar pemekarannya lebih bernuansa politik. Semangat berkuasa para elit-elit politik di daerah pemekaran membuat mereka lupa untuk menggali potensi yang ada. ‘’Jadi bukan karena daerah itu tidak memiliki potensi. Tapi karena tidak digali,’’ katanya. Memperburuk Di tempat terpisah, pengamatTata Negara USU Faisal Akbar menilai, pemekaran daerah sebagai implementasi dari desentralisasi adalah baik, tetapi pelaksanaanya cenderung tidak sebagaimana mestinya. Bahkan, tidak jarang akibat pemekaran daerah justru memperburuk kondisi perekonomian masyarakat. “Tingginya biaya pembangunan kantor baru bagi daerah pemekaran berdampak menurunnya kemampuan pembiayaan pelayanan publik secara keseluruhan. Jadi, jangan heran kalau sejumlah daerah mengalami defisit angaran yang begitu besar,” kata Faisal. Menurut Faisal, daerah yang lemah secara ekonomi akan sulit melaksanakan pembangunan pada jangka panjang. Sebab, tidak selamanya daerah otonom baru akan ditunjang oleh pemerintah pusat. “Sumber daya alam yang minim memicu menurunnya PAD. Akibatnya, biaya operasional birokrasi di daerah tidak bisa ditutupi,” tegasnya. Saat ini, tidak sedikit daerah pemekaran yang tidak mampu mensejahterakan masyarakatnya. Ini akibat buruknya tata kelola daerah. “Perhatian kepada program-program pengentasan kemiskinan, pemberdayaan masyarakat serta program lainnya yang memiliki dampak langsung terhadap kepentingan masyarakat menjadi terabaikan,” tambahnya. Ke depan, pelaksanaan proses pemekaran daerah harus didasarkan pada argumen yang rasional dan bukan emosional. Agar rasional, maka pemekaran harus melalui suatu studi kelayakan yang objektif dan independen. Objektif artinya dapat dipertanggunjawabkan secara ilmiah, bukan secara emosional. “Pemerkaran bisa gagal karena tidak melalui analisis yang sempurna dan mempertimbangkan potensi daerah itu. Disamping itu pemerintah daerah (eksekutif dan legislatif) harus bisa melaksanakan pembangunan secara merata,” demikian Faisal.(m12/m49)

Dirut RPH Tidak Punya Terobosan MEDAN (Waspada): Direktur Utama (Dirut) Rumah Potong Hewan (RPH) Medan Putrama Alkhairi tidak punya terobosan guna mengembangkan perusahaan daerah tersebut agar bisa bangkit dari keterpurukan. Bahkan, Putrama terkesan sibuk sendiri dengan kegiatannya di luar RPH, ketimbang memperkuat koordinasi dengan jajaran internal direksi perusahaan daerah itu. Terbuktinya, sejak dilantik beberapa minggu lalu hingga saat ini, belum terlihat adanya terobosan. Bahkan, suasana kerja di perusahaanitutetapsepertisebelumnya. Sejumlah karyawan di PD RPH mengeluhkan sikap direksi yang belum juga menentukan arah perusahaan ke depannya. Karyawan menilai koordinasi dan konsolidasi yang dilakukan belum menentukan sikap direksi khususnya direktur utama untuk membangun PD RPH. “Kita masih bingung bang. Seperti apa perusahaan ini dike-

lola ke depannya. Karena arahan dari direksi belum jelas sama sekali. Bahkan, direksi sendiri juga masih bingung seperti apa arahan Dirut RPH Medan untuk membangun perusahaan ini,” kata seorang karyawan PD RPH Medan yang tidak bersedia menyebutkan identitasnya kepada Waspada, Kamis (26/1). Dia mengaku belum ada arahan dari atasan tentang kebijakan untuk mengembangkan perusahaan. “Saya kerja seperti biasa. Potong hewan seperti biasa, tidak ada perubahan apapun. Kita kerja seperti biasa. Biasanya kalau ada arahan dari atasan, pasti langsung sampai ke kita. Tapi sampai saat ini, kita tidak pernah mendengar adanya arahan dari direksi baru. Bahkan saya mendengar sampai sekarang belum pernah direksi dan Dirut yang baru menggelar pertemuan atau rapat di kantor ini,” ujarnya. Sementara itu, Ketua Komisi C DPRD Medan Jumadi berpendapat, direksi harus secepatnya melakukan terobosan secara eksternal maupun internal di lingkungan PD RPH. Jangan sampai keluhan karyawan

14 FKG Dan PDGI Terima Dana Penelitian MEDAN (Waspada): Persatuan Dokter Gigi Indonesia (PDGI) dan Fakultas Kedokteran Gigi (FKG) USU mendapat bantuan dana penelitian dari Pepsodent sebagai brand pasta gigi terkemuka dari PT Unilever Indonesia, Tbk. “Selain FKG USU, pemberian bantuan juga diterima 14 Fakultas Kedokteran Gigi (FKG) di 10 kota di Indonesia, senilai Rp750 juta,” kata General Manager External Relations & Corporate Secretary PT Unilever Indonesia, Tbk Sancoyo Antarikso kepada pers, Senin (23/1). “Kami ingin mendorong semangat para rekan-rekan dokter gigi di FKG melakukan penelitian dan mengetahui kondisi permasalahan kesehatan gigi yang berkembang di masyarakat, agar hasilnya tepat guna dan dapat dimanfaatkan tidak hanya oleh Pepsodent namun juga oleh pemangku kepentingan lainnya. Inilah bukti komitmen berkelanjutan kami dalam meningkatkan kualitas kesehatan gigi masyarakat Indonesia”, ujar Sancoyo. Sementara itu, Drg Zaura Anggraeni MDS, selaku Ketua PB PDGI, menyambut baik dukungan yang diberikan kali ini. Melalui bantuan inidiharapkandapatmerintispenelitian-penelitianberbasismasyarakat di berbagai daerah, khususnya yang jauh dari jangkauan. “Diharapkan penelitian seperti ini dapat menggugah minat dokter gigi yang kesehariannya bekerja di lingkungan masyarakat. Dengan demikian, relevansi dari hasil penelitian terhadap pemotretan profil permasalahan gigi dan faktor-faktor sosial ekonomi masyarakat semakin tinggi, sehingga data yang diperoleh dapat membantu mengidentifikasi alternatif pemecahan masalah yang sesuai dengan masyarakat setempat,” katanya. Dana penelitian diberikan langsung kepada 14 Dekan FKG universitas peserta BKGN 2011 sebagai berikut: Universitas Indonesia, Universitas Trisakti, Universitas Prof Dr Moestopo (Beragama), Universitas Padjadjaran, Universitas Gadjah Mada, Universitas Muhammadiyah Yogyakarta, Universitas Hasanuddin, Universitas Sumatera Utara, Universitas Hang Tuah Surabaya, Universitas Mahasaraswati, Universitas Baiturrahmah, Universitas Jember, Universitas Airlangga, dan Universitas Sam Ratulangi. (m49)

muncul akibat tidak adanya koordinasi dan konsolidasi yang dilakukan direksi terutama Dirut PD RPH. “Kita mendorong Dirut RPH segera melakukan terobosan, termasuk yang paling penting di kalangan internal terlebih dulu. Jika sampai muncul keluhan dari karyawan seperti itu, patut dipertanyakan kemana saja direksi dan Dirut RPH Medan yang baru. Ini kan kondisi yang tidak mengenakan, harusnya sudah ada perbuatan atau tindakan yang dilakukan direksi setidaknya di kalangan internal sendiri,” tegasnya. Jumadi juga mempertanyakan konsep terobosan pengembangan perusahaan yang akan dilakukan direksi baru dan Dirut RPH Medan. Seperti yang sudah dilakukan Dirut PD Pasar Benni

Sihotang seperti penertiban PKL di sejumlah pasar tradisional di Medan untuk memaksimalkan PAD. “Terobosan PD Pasar kan sudah jelas, untuk menerima dan maksimalkan PAD dari retribusi pedagang. Seharusnya, PD RPH Medan juga seperti itu, karena sumber PAD kan dari retribusi pemotongan hewan di RPH. Makanya harus melakukan penertiban RPH liar yang ada di Kota Medan dan menjalin kerjasama dengan berbagai pihak. Ini kan bisa dimaksimalkan agar RPH bisa bangkit dari keterpurukan,” ungkapnya. Sementara itu, Dirut PD RPH Medan Putrama Alkhairi yang dikonfirmasi wartawan mengatakan, pihaknya terus melakukan konsolidasi internal termasuk perbaikan kantor dan

membersihkan RPH Medan. Saat ini, 162 karyawan RPH belum gajian selama empat bulan. “Karyawan tidak gajian, tapi mereka mau bekerja. Ini kan sudah baik. Karenanya, kita terus memotivasi karyawan agar menjadikan PD RPH menjadi perusahaan besar. Untuk penertiban RPH liar, kita sedang memikirkan formula yang baik agar efektif. Tidak seperti sebelumnya, dilakukan penertiban namun beroperasi lagi,” jelasnya. Putrama menegaskan kritikan dari Komisi C DPRD Medan itu menjadi motivasi bagi PD RPH Medan. Bahkan, dia mengaku senang diperhatikan dengan cara tersebut dan menjadikannya sebuah motivasi untuk lebih meningkatkan kinerja ke depan. (m50)

Wali Kota Lantik Kepala Kemenag Medan MEDAN (Waspada): Wali Kota Medan Rahudman Harahap melantik Kepala Kementerian Agama Kota Medan yang baru Iwan Zulhami, di Kantor Balai Kota Medan, Selasa (24/ 1). Pelantikan ini berdasarkan SK Menteri Agama RI nomor : B.II/3/15632 tanggal 29 Desember 2011. Rahudman mengatakan, Kementerian Agama lembaga berwenang yang mengawal eksistensi nilai-nilai agama untuk hidup dan berkembang di tanah air. Selain itu, memperkuat posisi pemerintah di daerah untuk mewujudkan masyarakat agamais yang berakhlak mulia, rukun dan damai. Untuk itu, diharapkan Kepala Kemenag yang baru dapat meningkatkan bimbingan dan pelayanan kehidupan beragama, pemahaman, pengamalan, dan pengembangan nilai-nilai agama, memperkokoh kerukunan umat beragama, meningkatkan kualitas pendidikan agama pada sekolah umum dan madrasah, serta meningkatkan penyelenggaraan ibadah haji. “Untuk mewujudkan pembangunan kota yang semakin baik selain pembangunan fisik, diperlukan juga pembangunan etika, moral serta spiritual kehidupan berbangsa dan bernegara. Inilah yang kita harapkan kedepan,” ujar Rahudman. Di tempat terpisah, kegiatan

temu ramah pisah sambut antara Kepala Kantor Kementerian Agama Kota Medan yang lama dan saat ini menjadi Kepala Kantor Kementerian AgamaWilayah Provsu Abd Rahim dengan Kepala Kantor Kementerian Agama yang baru Iwan Zulhami berjalan akrab. Kegiatan diselenggarakan di Hotel Dharma Deli Medan, dihadiri Ketua MUI Sumut Prof Dr Abdullah Syah, Ketua MUI Medan Prof HM Hatta, Pgs Kementerian Agama Kota Medan Drs H Al Ahyu MA, Al Ustadz Zulfiqar Hazar LC, Kabid Haji Kementerian Agama Provsu Drs H Abd Ramhan MA, serta undangan lainnya. Iwan Zulhami dalam sambutannya mengakui, jika selama ini bertugas di Kabupaten Langkat akan berbeda dengan mengemban tugas di Medan, yang penuh dinamika sebagai kota yang besar. Akan tetapi, sebut Iwan yang sudah pernah bertugas di Kantor Kementerian Agama Kota Medan dan di Kementerian Agama Provinsi Sumatera Utara, dan dipercara sebagai Kandepag di Deliserdang, semua tugas yang dia emban akan dijalankan sesuai amanah. “Insya allah dengan dukungan semua pihak, saya yakin akan mampu menjalankan amanah ini,”katanya sembari menambahkan akan menjalankan amanah yang disampai-

kan Wali Kota Medan Drs H Rahudman MM untuk menjadikan kementerian agama sebagai ujung tombak pembangunan bangsa ini kedepan, khususnya di Medan, agar semboyan hari ini lebih baik dari hari kemarin akan segera terwujud. Sedangkan Kepala Kantor Kementerian Agama Sumut Drs Abd Rahim M.Hum meminta agar Iwan Zulhami menjalankan tugas sebaik-baiknya dan selalu berjalan pada ketentuan yang ada. “Selama ini saya yakin bahwa saudara Iwan Zulhami memenuhi kriteria kinerja yang ditetapkan oleh pemerintah, sehingga mampu mengemban amanah sebagai pejabat di kementerian agama. Dengan banyaknya bertugas di berbagai kantor kementerian agama, insyaallah semakin memberi kemudahan untuk melaksanakan tugas di Medan, hal yang penting adalah selalu berkordinasi dalam melaksanakan berbagai tugas,” katanya. Prof HM Hatta yang mewakili masyarakat berharap hal yang sama, agar Iwan Zulhami dapat menjalankan tugas dengan baik dan tetap mengutamakan kedisiplinan dalam mengemban tugas. Sebagaimana yang pernah dilakukan Iwan Zulhami saat menjabat sebagai humas di Kementerian Agama Provsu, saat dirinya menjabat sebagai Kakanwil. (m50/m37)

Waspada/Amir Syarifuddin

DIRUT Bank Sumut Gus Irawan Pasaribu dan Kakanwil Ditjen Pajak Sumut II Harta Indra Tarigan menandatangani perjanjian kerjasama tempat penerimaan pajak, di Pematangsiantar, Kamis pekan lalu.

Bank Sumut Tempat Favorit Pembayaran Pajak MEDAN (Waspada): Bank Sumut masih menjadi salah satu tempat penerimaan setoran pajak favorit di Sumatera Utara, yang ditandai dari trend peningkatan jumlah Surat Setoran Pajak (SSP) setiap tahun. ”Hal ini tidak terlepas dari dukungan seluruh Wajib Pajak (WP) Badan dan WP orang pribadi di Sumatera Utara, untuk menyetorkan pajaknya ke BUMD terbaik di Indonesia ini,” ujar Dirut Bank Sumut Gus Irawan Pasaribu pada penandatanganan perjanjian kerjasama antara Kakanwil Ditjen Pajak Sumut II Harta Indra Tarigan dengan Dirut Bank Sumut Gus Irawan, di Pematangsiantar, Kamis pekan lalu. Hadir pada acara itu seluruh pemimpin cabang Bank Sumut dan Kepala KPP Pratama di wilayah Kanwil DJP Sumut II serta Wakil Wali Kota Pematangsiantar Koni Ismail Siregar. Menurut Gus Irawan, kesuksesan Bank Sumut sebagai bank persepsi menumbuhkan kepercayaan pemerintah untuk memperpanjang kerjasama dengan Bank Sumut, dalam pelayanan setoran pajak penghasilan (PPh), pajak pertambahan nilai (PPN), Pajak Bumi dan Bangunan (PBB), serta pajak lainnya. Dikatakannya, untuk memberikan pelayanan kepada WP, Bank Sumut sejak tahun 2008 telah bekerjasama dengan Kanwil DJP Sumut I dan II, untuk membuka payment point (loket) penerimaan setoran pajak di Kantor Pelayanan Pajak (KPP) Pratama antaralain empat di wilayah Sumut I, yakni di KPP Pratama Medan Timur, Medan Barat, Medan Belawan dan Binjai, serta delapan di wilayah

Sumut II yaitu KPP Pratama Pematangsiantar, Tebingtinggi, Rantauprapat, Padangsidempuan, Sibolga, Balige, Kabanjahe dan Kisaran. Dengan demikian, Bank Sumut merupakan satu-satunya bank di provinsi ini yang memiliki outlet SSP di KPP Pratama, selain membuka outlet layanan penerimaaan setoran pajak di sejumlah kantor cabangnya. ”WP yang menyetorkan pajaknya melalui Bank Sumut rata-rata per hari sebesar Rp3,3 miliar. Per November 2011, jumlah transaksi pembayaran pajak melalui Bank Sumut mencapai 283.402 SSP. Sedangkan per Desember 2010 mencapai 378.380 transaksi SSP di mana Kantor Cabang Utama Medan meraih pencapaian SSP terbesar yakni 113.233 SSP. Bank Sumut Cabang Utama Medan bahkan pernah meraih penghargaan Tax Award sebagai bank penerima SSP terbanyak pada tahun 2008 dengan melayani 60.990 SSP. Dan pada tahun 2010,” ujar Gus Irawan. Gus Irawan juga mengatakan, untuk mendukung realisasi pengalihan PBB sektor pedesaan dan perkotaan menjadi pajak daerah sebagaimana tertuang pada UU No 28/2005, Bank Sumut juga berkomitmen untuk menjadi mitra pemerintah daerah dalam penerimaan dan pengelolaan PBB sektor pedesaan dan perkotaan. Kakanwil Ditjen Pajak Sumut II Harta Indra Tarigan pada kesempatan itu mengingatkan seluruh WP Orang Pribadi untuk segera menyerahkan Surat Pemberitahuan (SPT) Tahunan PPh sebelum 31 Maret 2011. Untuk SPT tahunan PPh WP Badan pada 30 April 2011. Keterlambatan penyerahan SPT Tahunan akan dikenakan sanksi administrasi sebesar Rp1 juta untuk WP Badan dan Rp100 ribu untuk WP Orang Pribadi. (m28)

500 Pasutri Ikuti Program Inseminasi Kondisi Bayi Kembar Empat Sehat MEDAN (Waspada): Sedikitnya 300 sampai 500 pasangan suami istri per tahunnya di Sumut, mengikuti program inseminasi untuk memperoleh keturunan. Program ini dilakukan karena munculnya permasalahan mengenai ketidaksuburan, baik dialami istri maupun suami. “Ada beberapa faktor penyebab ketidaksuburan, untuk perempuan karena adanya masalah pada indung telur yang tidak berkualitas atau kualitas sel telurnya semakin menurun, ada masalah di saluran tuba, rongga perut yang menderita penyakit kista dan adanya tumor di dinding rahim seperti polip atau infeksi lainnya,” kata dokter kandungan RSIA Stella Maris dr. Binarwan Halim, SpOG (K), Selasa (24/1). Menurut Binarwan, sedangkan permasalahan yang dialami kaum pria, karena adanya infeksi dan varises di testis, sehingga tidak mampu memproduksi sperma. “Untuk normalnya, jumlah sperma 20 juta, tapi karena tidak mampu memproduksi sperma, maka jumlah spermanya dibawah 5 juta. Bagi laki-

laki mudah untuk memeriksanya, cukup dengan analisis sperma. Tapi, bagi perempuan perlu banyak pemeriksaan,” katanya. Mengenai program inseminasi ini, dia berharap menjadi unggulan di Sumatera Utara, sehingga bisa menarik pasien dari luar negeri. “Kita bisa menarik perhatian luar negeri. Di sini, selain biaya murah, kualitas juga baik. Jadi, kalau ada orang luar negeri yang ingin mengikuti program inseminasi ini, agar diberi kemudahan untuk memperoleh izin tinggal sementara dan adanya kemudahan penginapan dengan biaya terjangkau,” sebutnya. Sementara itu, kondisi bayi kembar empat hasil program inseminasi yang dilakukan pasutri Jon Piter Manik, 38, dan Sonta Ria Nababan, 39, penduduk Jln. Penerbangan Tani Baru I Medan, di RSIA Stella Maris cukup sehat. “Tidak ada yang berada didalam inkubator karena semuanya sehat,” ujarnya. Mengenai jadwal kepulangannya dari rumah sakit, dia mengaku menunggu persetujuan dari dokter. “Tentang kepulangan tergantung dokter dan menunggu istri saya benar-benar sehat dulu. Memang, kondisi istri saya sudah pulih, sudah bisa makan dan ngobrol,” katanya. (h02)

Seminar Gratis Rahasia Jadi Jenius Dalam 5 Menit MEDAN (Waspada): Seminar gratis “Rahasia Jadi Jenius Dalam 5 Menit”, kembali digelar, di Hotel Garuda Plaza Jln. SM Raja Medan, Jumat (27/1), karena seminggu sebelumnya pesertanya sangat banyak, sehingga ada yang tidak mendapat tempat. “Ini menunjukkan kepedulian masyarakat Medan dan sekitarnya yang luar biasa terhadap pendidikan dan masa depan anaknya,” kata Herri Komala, panitia seminar dari SOS, Kamis (26/1). Menurut Herri, seminar tersebut hanya satu kali digelar di tahun 2012 dan merupakan road show 40 kota di Indonesia. Kata dia, karena tempatnya di Garuda Plaza sangat terbatas, kepada peserta yang ingin mengikuti seminar gratis ini terlebih dahulu mendaftar melalui HP dengan mengirim SMS ke 085655550330 ketik SOS, nama orangtua, nama anak, sekolah, sesi/jam yang diinginkan yakni sesi 1 pu-

kul 13:50-15:00, sesi 2 pukul 16:00-18:00. Syarat anak usia 10-19 tahun. Disebutkannya, dalam seminar ini, pihaknya akan membagikan bagaimana caranya seorang anak bisa menjadi jenius dalam 5 menit, juga bisa lebih dari jenius, sehingga hidup anak bisa menjadi sukses dan bahagia. “Kami mengundang para orangtua dan anaknya yang datang lebih dahulu akan diprioritaskan untuk mengikuti seminar gratis ini,” sebut Herri. Selain itu, lanjutnya, bagi yang mengikuti program SOS ini, akan mendapatkan scan charader gratis kepada anak yang berguna untuk mengetahui titik kritis, juga potensi dan minatnya. Sementara itu, peserta program SOS Imam Syaviri, 17, siswa SMAN 2 Samarinda mengakui, sejak mengikuti program tersebut dirinya merasa lebih baik dari sebelumnya. “Saya ingat satu hal yang memotivasi saya yaitu tidak ada yang tidak bisa, yang ada hanyalah berusaha dan belajar,” ujarnya.(cwan)

WASPADA Jumat 27 Januari 2012

Medan Metropolitan

A5

WN Vietnam Selundupkan 1 Kg SS

Penjara 16 Tahun, Denda Rp1 Miliar MEDAN (Waspada): Nguyen Thi Tuyet Trinh, wanita asal Vietnam yang menyelundupkan sabu-sabu seberat 1000 gram atau 1 Kg dari Malaysia melalui Bandara Polonia Medan dijatuhi hukuman penjara 16 tahun dan denda Rp1 miliar pada sidang di Pengadilan Negeri (PN) Medan, Kamis (26/1). Dia dinyatakan terbukti bersalah memiliki narkotika golongan I jenis sabu-sabu sebagaimana diatur dalam Pasal 112 ayat (2) UU No 35 tahun 2009 tentang Narkotika.Vonis majelis hakim ini sama dengan tuntutan Jaksa Penuntut Umum (JPU) yakni 16 tahun penjara. Selain itu, Nguyen juga dihukum membayar denda Rp1 miliar yang dapat diganti dengan pidana kurungan selama lima

bulan penjara. “Hal-hal yang memberatkan, terdakwa merupakan warga negara asing yang membawa narkotika ke Indonesia dalam jumlah besar. Jika narkotika itu berhasil diloloskan terdakwa, semakin banyak korban dari kalangan generasi muda. Hal yang meringankan, terdakwa belum pernah dihukum,” kata Ketua Majelis Hakim SB Hutagalung. Dalam putusannya, Hutagalung mengatakan, terdakwa membawa sabu-sabu seberat 1000 gram dari Kualalumpur, Malaysia dengan menumpang pesawat Air Asia pada 7 Juni 2011 sekira pukul 08:30. Setelah mendarat di Bandara Polonia Medan, barang bawaan penumpang termasuk milik Nguyen berupa tas warna hitam diperiksa melalui X-Ray. Saat itu, petugas mencurigai Nguyen karena terlihat gelisah dan kebingungan ketika tas miliknya melewati mesin X-Ray. Dalam monitor terlihat tampilan mencurigakan sehingga Nguyen dan ba-

Waspada/gito ap

SEKCAM Medan Kota Soritua menyerahkan secara simbolis becak barang bantuan PNPM Mandiri kepada warga Sudirejo I, disaksikan Lurah Sudirejo I Ubudiah dan fasilitator PNPM Mandiri di kelurahan Sudirejo I, Rabu (25/1).

PNPM Mandiri Serahkan Bantuan Kepada Warga Sudirejo I MEDAN (Waspada): Warga Kelurahan Sudirejo I, Kecamatan Medan Kota menerima bantuan sosial Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri, Rabu (25/1), di Kantor Lurah Sudirejo I. Bantuan diserahkan melalui Koordinator Badan Keswadayaan Masyarakat (BKM) Maju Bersama Sudirejo I Burhanudin Aan diterima Sekretaris Kecamatan Medan Kota Soritua, disaksikan Lurah Kelurahan Sudirejo I Ubudiah dan para fasilitator PNPM Mandiri. Koordinator BKM Maju Bersama Burhanuddin Aan mengatakan, penyerahan bantuan kepada warga Kelurahan Sudirejo I sudah ketiga kalinyasejakprograminidiluncurkanpada2007.Diaberharapbantuan tersebut bermanfaat dan menjadi modal usaha berkelanjutan bagi yang menerima bantuan pendukung usaha. Lurah Kelurahan Sudirejo I Ubudiah juga mengharapkan bantuan yang telah disalurkan itu bermanfaat bagi warganya. “Saya berterimakasih atas bantuan yang diberikan dan berharap bantuan ini dapat dimanfaatkan dengan baik,” katanya. Bantuan yang disalurkan itu berupa seragam untuk 80 siswa SD dan SMP, termasuk tas dan sepatu, satu becak barang, satu steling untuk berjualan serta 53 paket santunan untuk jompo berupa susu dan selimut. Sementara, Penanggungjawab Operasional PNPM Mandiri Medan Kota Syahnan didampingi Senior Fasilitator PNPM Mandiri Kelurahan Sudirejo I, Kecamatan Medan Kota Rugun menjelaskan, bantuan yang disalurkan itu bernilai keseluruhan Rp38,5 juta berasal dari APBD Kota Medan. “Program ini, ditargetkan berakhir hingga 2014 dan berharap nantinya dapat mendorong masyarakat perkotaan menjadi pemrakarsa dan inovasi dalam upaya penanggulangan kemiskinan yang berkelanjutan,” ujar Syahnan.(m27)

KH Zulfiqar Hajar Gelar Syukuran MEDAN (Waspada): Al-Ustadz KH Zulfiqar Hajar Lc, Mli (foto) menggelar acara syukuran di kediamannya, Rabu (25/1) malam, sekaitan dengan penghargaan yang diperolehnya dari Yayasan Pendidikan Shafiyyatul Amaliyah (YPSA) sebagai Tokoh Masyarakat Peduli Pendidikan YPSA pada HUT ke-14, dan pernghargaan “Pesantren Best Executive Awards 1433 H/2012 M” dari Yayasan Baiturrahman Internasional (Baiturrahman International Foundation) Bandung. Hadir dalam acara itu, Asisten III Kessos Pemko Medan Drs H Musaddad Nasution MSi, Kakanwil Kemenagsu Drs H Abdul Rahim MHum bersama istri, Kakan Kemenag Medan H Iwan Zulhami SH. MAP bersama istri, Kajari Medan H Raja Nofrizal SH, MH, Wakapolresta Medan AKBP Pranyoto, dan Dirut PDAM Tirtanadi Ir Azzam. Ketua Umum MUI Medan Prof Dr HM Hatta bersama istri, Ketua Umum Majlis Zikir Tazkira Sumut KH Amiruddin MS, Drs H Amhar Nasution MA, H Ali Amran Lc, Pimpinan Ponpes Babussalam Pekanbaru (Riau) Khalifah H Ismail Rokan Datuk Adil, mantan Wali Kota Medan Drs H Abdillah Ak MBA, H Syahrial Ams SH MH, Pembina YPSA Drs H Sofyan Raz Ak MM, Drs HJ Abdullah, Bahar Siregar SH, Drs HM Zaki Abdullah, Ir H Erwin, dan Drs H Jumiran Abdi. Selain itu hadir Ketua Partai NasDem Sumut H Ali Umri SH MKn, Ketua Partai Golkar/AMPI Medan H Syaf Lubis, pengurus PW Al-Washliyah Sumut Drs H Yulizar Parlagutan Lubis, Prof Dr H Pagar Hasibuan MA (NU Sumut), serta pengurus LDII dengan Ketuanya Ir H Agus Purwanto. KH Zulfiqar Hajar dalam sambutannya merasa gembira dan terharu atas menerima dua penghargaan tersebut. Hal ini mungkin disebabkan keteguhannya dalam prinsip membela kebenaran dan keadilan, kepeduliannya dalam pendidikan, keagamaan, dan sosial-kemasyarakatan. Menurutnya, pemberian penghargaan itu karena ia dianggap sebagai tokoh yang perduli terhadap masyarakat. “Setiap menyambut Hari Raya Idul Fitri, Jabal Noor selalu membagi-bagikan Sembako kepada fakir miskin. Pada penghujung bulan suci Ramadhan 1432 H/2011, kita salurkan sebanyak 7.500 paket Sembako. Insya-allah, pada tahun ini jumlah bantuan akan kita tingkatkan,” sebutnya. Menurut dia, itu semua karena rezeki dari Allah SWT melalui jamaah Jabal Noor. “Saat liburan sekolah kita juga melaksanakan khitanan massal,” kata Zulfiqar yang juga Ketua Komisi Dakwah dan Pemberdayaan Masyarakat. Dia menyebutkan sangat membenci perbuatan tentara zionis Israel terhadap rakyat Palestina yang ingin menguasai Baitul Maqdis. (m37)

rang bawaannya dibawa ke ruang pemeriksaan Bea Cukai Terminal Kedatangan Bandara Polonia Medan. Selanjutnya, petugas mengeluarkan seluruh isi tas milik Nguyen. Namun tas tersebut masih terasa berat sehingga kembali diperiksa menggunakan X-Ray. Hasilnya, pada layar monitor terlihat tanda-tanda mencurigakan. Setelah itu, petugas merobek bagian dalam tas Nguyen dan ditemukan satu bungkusan berisi serbuk warna putih.

Petugas kembali merobek tas tersebut dan kembali menemukan satu bungkusan berisi serbuk warna putih. Masingmasing bungkusan memiliki berat 530 gram dengan total keseluruhan 1.060 gram atau berat bersih 1.000 gram. Nguyen mengaku sabu-sabu tersebut diterimanya dari seorang lakilaki turunan Afrika bernama Uche di salah satu warung kopi di Kota Bangkok, Thailand. Menanggapi vonis majelis hakim tersebut, Jaksa Penuntut Umum (JPU) dan penasihat hu-

kum terdakwa menyatakan pikir-pikir. Majelis memberi waktu tujuh hari untuk mempertimbangkan putusan tersebut. Sementara Jaksa Penuntut Umum (JPU) Nova menyatakan tuntutan tersebut sudah maksimal sesuai dengan aturan. “Jika barang bukti tersebut di atas lima kilogram, maka tuntutan maksimal adalah hukuman mati atau paling lama seumur hidup. Namun karena barang bukti di bawah lima kilogram maka tuntutan hanya 16 tahun,” ujarnya. (m38)

BKP Sidak Ke Sekolah Siswa SD Keracunan Sudah Masuk Kelas MEDAN (Waspada): Badan Ketahanan Pangan (BKP) Medan, datang ke Sekolah Dasar (SD) Negeri No. 066650 di Jalan Bahagia By Pass Medan, Kamis (26/1),gunasidakdanmemeriksa seluruh jajanan yang dijual pedagang di areal sekolah tersebut. Mereka berjumlah lima orang mengenakan pakaian batik, melihat langsung layak atau tidaknya jajanan yang dijual, dan meminta pedagang lebih selektif menjual dagangannya. “Pemeriksaan bertujuan agar masyarakat (orangtua siswa) tidak lagi merasa was-was dengan jajanan sekolah. Kita lakukan pemeriksaan, kalau tidak layak dikonsumsi akan dikoordinasikan kepada kepala sekolah agar pedagang tidak diperbolehkan menjual dagangan itu,” sebut petugas BKP Jauhari. Dia juga menyebutkan, kehadiran BPK ke SDN itu sekaligus sosialisasi tentang panganan apa yang layak dikonsumsi

para siswa SD. “Kita datang bukan hanya karena kasus dugaan keracunan, tetapi memang sudah ada program ke sekolah-sekolah untuk sosialisasi masalah panganan yang sehat,” katanya. Masuk sekolah Sementara itu, belasan siswa SD yang diduga keracunan setelah meminum air nira yang dijual pedagang keliling di luar pagar sekolah itu, sudah kembali masuk ke kelasnya, Kamis. “Mereka sudah masuk semua, termasuk tiga siswa yang sempat di infus di RS Bahagia,” sebut seorang guru di sekolah itu. Kepala Sekolah SDN No. 066650 Hj Sahrita juga membenarkan semua siswa yang sempat muntah-muntah dan pingsan sudah kembali masuk sekolah. “Sudah masuk semua kok,” katanya menjelaskan, semua biaya perawatan para siswa itu ditanggung pihak sekolah. Sementara untuk mengantisipasi terjadinya hal serupa,

pihak sekolah mulai mendata semua pedagang yang berjualan di sekitar sekolah, termasuk jenis jajanan apa saja yang dijual. Pihak sekolah juga tidak memperbolehkan para siswanya keluar dari sekolah selain jam pulang. “Pendataan pedagang dan jenis jajanan yang dijual dilakukan agar ada rasa tanggungjawab para pedagang terhadap jajanan yang dijual. Apabila terjadi sesuatu, pihak sekolah bisa langsung meminta pertanggungjawaban,” ujarnya. Kasus dugaan keracunan terjadi Rabu (25/1) siang saat istirahat jam kedua, mengakibatkan 13 siswa dirawat di rumah sakit. Para siswa mengaku pusing, muntah dan pingsan setelah minum air nira yang dibeli Rp1000 dari pedagang air nira. Setelah kejadian itu, pedagang kabur dan hingga kini masih diburon pihak kepolisian untuk dimintai kerterangannya.(m27)

HNSI Dan PP Kawal Sidang Pembunuhan Awie-Dora MEDAN (Waspada): Sedikitnya 50 orang yang berasal dari Himpunan Nelayan Seluruh Indonesina (HNSI) dan Pemuda Pancasila (PP) Medan mengawal persidangan Sun An Anlang dan Ang Ho, terdakwa pembunuh pasangan suami istri Kho Wito alias Awie dan Dora Halim di Pengadilan Negeri (PN) Medan, Kamis (26/1). “HNSI merasa terpanggil untuk mengawasi persidangan terhadap terdakwa Sun An Anlang dan Ang Ho. Jangan sampai ada pihak tertentu mengintervensi jalannya persidangan tersebut sehingga meringinkan hukuman para pembunuh itu,” ujar Ketua HNSI Medan Zulfahri Siagian di PN Medan, Kamis (26/1). Semasa hidupnya, menurut Zulfahri, korban Awie menjabat sebagai Ketua Harian HNSI Medan dan perusahaan korban menghidupi ratusan karyawan. Jika mereka punya dua anak, berarti ribuan orang bergantung pada perusahaan korban. Tapi sekarang korban telah tiada, ratusan nelayan yang menjadi anggota HNSI itu mulai kehilangan nafkah. “HNSI menilai kedua ter-

dakwa patut dihukum mati. Mereka menembak mati pasangan suami istri itu ketika masih berada di dalam mobil. Tidak hanya itu, terdakwa juga diduga melibatkan sindikat pembunuh asing,” ujarnya. Menurut Zulfahri, indikasi keterlibatan pembunuh bayaran asing terungkap dari keterangan saksi Toni (anak terdakwa Sun An) dan Ketua RT Acuan yang disebut-sebut menyelamatkan empat eksekutor dari kejaran aparat kepolisian. Sampai kini tidak diketahui keberadaan Toni dan Acuan tersebut. Kabarnya mereka sudah kabur ke Malaysia, karena jarak tempuh dari rumah mereka ke Malaysia hanya butuh waktu 30 menit menggunakan speedboat. Begitu juga Acui (rekan Sun An)danAngHo selakuperencana pembunuhan itu, belum diketahui keberadaannya. Jika sindikat pembunuhbayaranitutidaksegera“dipatahkan” kita khawatir Medanbakaljadisasaranmerekauntukmelakukankejahatan.“Hakim harus berani menghukum mati kedua terdakwa pembunuhan sadis itu,” ujar Zulfahri. Hal senada dikatakan Wakil

Ketua PP Medan AR Batubara dan B Gultom yang ikut mengawal persidangan terdakwa Sun An dan Ang Ho tersebut. “PP memberi dukungan moral kepada majelis hakim agar berani memberi hukuman maksimal kepada dua terdakwa pembunuhan sadis,” ujar AR Batubara. Hukuman mati Di tempat terpisah, Wakil Direktur LBH Medan Muslim Muis, SH berpendapat, mengingat sadisnya pembunuhan yang melibatkan orang asing itu, maka terdakwa harus dihukum mati agar peristiwa keji serupa tidak terulang lagi. Menurutnya, pembunuhan suami-istri itu tergolong sadis dan keji. Korban harus meregang nyawa lantaran tindakan pembunuh bayaran. Pelakunya harus dihukum maksimal, hukuman mati, seumur hidup atau 20 tahun penjara. Wibawa hukum harus ditegakkan, siapapun yang melakukan pembunuhan berencana harus mendapatkan ganjaran maksimal. “Kita tidak ingin rendahnya hukuman membuat semakin suburnya pembunuhbayaranasing di negeri ini,” tegasnya. (m38)

Mahasiswa UMSU Kunjungi Waspada MEDAN (Waspada): Puluhan mahasiswa semester lima Fakultas Pertanian Universitas Muhammadiyah Sumatera Utara (UMSU) mengunjungi redaksiharian Waspadagunamemperdalam mata kuliah komunikasi agrobisnis, Rabu (25/1). Rombongan mahasiswa UMSU yang dipimpin staf pengajar Fakultas Pertanian UMSU Bustami Harahap diterima Humas Harian Waspada Drs H Erwan Effendi. Menurut Bustami, audiensi dilakukan dalam rangka implementasi mata kuliah komunikasi agrobisnis. “Para mahasiswa ingin me-

ngetahui lebih dalam tentang pengelolaan media untuk menyampaikan informasi kepada masyarakat, guna memberi pembelajaran dan meningkatkan pembangunan secara maksimal untuk bangsa,” katanya. Bustami yang pernah menulis artikel sejak tahun 1990 hingga 1995 mengatakan, teknik penulisan berita di media cetak sangat penting bagi mahasiswa yang mendalami ilmu komunikasi, karena informasi agrobisnis lebih efektif dan efisien disampaikan ke masyarakat melalui media. Humas Harian Waspada

Drs H Erwan Effendi secara ringkas menjelaskan tentang sejarah berdirinya Harian Waspada untuk menyampaikan berita kemerdekaan, sekaligus menghempang masuknya agitasi serta provokasi penjajah pada tahun 1947. Erwan juga menjelaskan fungsi media dalam menghadapi perkembangan globalisasi serta menyebarkan informasi yang bersifat membangun, di antaranya melakukan pencerahan dan pendidikan kepada masyarakat, pembangunan serta hiburan, dan menjaga kondusifitas negara. (m40)

Waspada/Sahrizal

MAHASISWA Fakultas Pertanian UMSU bersama staf pengajar audiensi ke Redaksi Harian Waspada.

Waspada/Surya Efendi

PENDEMO TERBAKAR: Unjukrasa yang diwarnai aksi bakar ban bekas di depan gedung Bank Danamon Jln. Diponegoro Medan, Kamis (26/1), menyebabkan seorang pengunjukrasa mengalami luka bakar pada kakinya. Peristiwa tersebut dialami seorang ibu yang ikut berunjukrasa. Dia terjatuh setelah kaki kanannya terbakar.

Rumah Dibongkar Maling, Rp45 Juta Raib MEDAN (Waspada): Rumah milik Marasi Dewi SPd, 42, PNS, warga Jalan Rotan 12, Perumnas Simalingkar, Kec. Pancur Batu, dibongkar maling, mengakibatkan sejumlah perhiasan emas dan berlian senilai Rp42 juta serta uang tunai Rp3 juta raib. Pencurian itu diketahui korban, Rabu (25/ 1) siang pukul 13.00. Selanjutnya korban membuat laporan pengaduan ke Polsek Pancurbatu. Dalam laporannya, korban mengatakan, pagi hari seperti biasa dia meninggalkan rumah pergi kerja. Namun, pada Rabu siang,

saat dirinya pulang ke rumah melihat pintu kamarnya sudah rusak. Ketika korban memeriksa lemarinya yang berada di dalam kamar juga telah dirusak, sedangkan isi lacinya sejumlah perhiasan emas dan berlian yang seluruhnya bernilai Rp42 juta serta uang Rp3 juta telah hilang. Kapolsek Pancurbatu Kompol Ruruh Wicaksono melalui Kanit Reskrim Iptu Gunawan saat dikonfirmasi membenarkan pengaduan PNS tersebut. Kata Gunawan, petugas masih terus melakukan pengembangan untuk mengungkap kasus tersebut.(m40)

Warga Jalan Jati Mengadu Ke KY Dan DPR MEDAN (Waspada): Meski lahan dan bangunan telah dieksekusi, warga Jalan Jati, Kel. Pulo Brayan Bengkel, Kec. Medan Timur, masih melakukan gugatan dan perlawanan atas eksekusi yang dilakukan oleh PN Medan. Selain itu, warga juga telah melaporkan kasus tersebut ke Komisi Yudisial (KY) dan Komisi III DPR RI. Djonggi M Simorangkir kepadaWaspada, Selasa (24/1) mengatakan, pihaknya terus melakukan gugatan dan peralawan atas eksekusi yang dilakukan pihak PN Medan yang memenangkan gugatan atas nama Abdul Kiram Cs.”Sidang atas nama penggugat Demak Tobing digelar Selasa. Selanjutnya Kamis mendatang persidangan gugatan dan perlawanan akan kembali digelar atas nama Sukisno,” ujarnya. Menurut Djonggi, mulai dalam sidang sebelumnya, majelis hakim tidak menghadiri pihak Abdul Kiram Cs di dalam persidangan sehingga membuat pertanyaan yang besar. “Aneh saya melihat sidang ini, sudah

beberapa kali persidangan berlangsung, pihak majelis hakim tidak pernah menghadiri Abdul Kiram Cs. Padahal saya ingin mempertanyakan dimana sebenarnya letak tanah yang dimiliki Abdul Kiram Cs sesuai dengan sertifikat tanah yang kita miliki,” sebutnya sembari mengharapkan majelis hakim untuk menghadirkan Abdul Kiram Cs dalam persidangan selanjutnya. Selain itu, lanjut dia, pihaknya juga melaporkan kepada KomisiYudisial sehingga putusan terhadap eksekusi yang dilakukan beberapa bulan yang lalu kembali lagi dikaji ulang, mengingat warga memiliki sertifikat yang sah. “Kita sudah melaporkan putusan eksekusi ini ke Komisi Yudisial sepekan yang lalu dengan buktibukti yang ada dan kita miliki. Kita meminta Komisi Yudisial untuk kembali melihat putusan yang dilakukan PN Medan atas eksekusi yang dilakukan,” katanya. Djonggi juga akan membawa permasalahan tersebut ke Komisi III DPR RI untuk memanggil pihak terkait dalam kasus itu, agar terlihat lebih jelas dihadapan wakil rakyat. (h04)

Menjelang Muswil PP Sumut

Dukungan Kepada Aweng Mengalir MEDAN (Waspada): Dukungan kepada Anuar Shah, SE yang akrab disapa Aweng untuk memimpin MPW Pemuda Pancasila Sumut periode 2012-2017 terus mengalir. Dukungan datang dari Ketua Majelis Pimpinan Cabang (MPC) PP Tebingtinggi H. Syafri Chap, Ketua MPC PP Padanglawas Afner Aziz Hasibuan, Ketua MPC PP Samosir Saborang Nainggolan, Ketua MPC PP Dairi Selamat Ujung dan Ketua MPC PP Langkat Terbit Rencana PA, SE. Syafri Chap menyatakan dukungannya dan siap memenangkan Aweng dalam pelaksanaan Muswil PP Sumut ke 12 yang akan dilaksanakan di Kota Padangsidempuan pada Februari mendatang. Penegasan dukungan tersebut disampaikan H. Syafri Chap melalui telefon kepada panitia Muswil PP Sumut di kantor Jln. Thamrin No. 95 A Medan, baru-baru ini. Sebagai salah satu Ketua MPC PP paling senior di Sumatera Utara, Syafri Chap punya penilaian tersendiri tentang kepemimpinan Aweng. Menurutnya, kemajuan Pemuda Pancasila ini tidak terlepas dari kepiawaian Aweng dalam menjalankan roda organisasi. Aweng sangat kredibel sebagai seorang pemimpin dan memiliki loyalitas terhadap organisasi serta peduli terhadap para kader. Selama kepemimpinan Aweng, terjadi perubahan sangat menonjol yakni kader-

kader intelektual PP tampil memimpin MPC PP kabupaten/kota di Sumatera Utara. Bahkan selama masa kepemimpinannya, Aweng mampu mengikis kesan premanisme pada Pemuda Pancasila dan mengarah kepada dunia usaha. Dukungan senada juga disampaikan oleh Ketua MPC PP Samosir, Saborang Nainggolan. Menurutnya, Aweng memiliki kemampuan membangun komunikasi antara MPW PP Sumut dengan jajaran MPC PP kabupaten/kota. “Jadi bagi kami tidak ada pilihan lain selain meminta kesediaan Bung Aweng untuk tampil kembali memimpin MPW PP Sumut,” kata Saborang Nainggolan. Sedangkan Ketua MPC PP Dairi Selamat Ujung mengatakan, Aweng senantiasa melibatkan MPC PP kabupaten/kota dalam berbagai kegiatan di MPW PP Sumut. Yang pasti menurut Ketua MPC PP Langkat Rencana PA, SE saat ini ketokohan Aweng sebagai lokomotif Pemuda Pancasila harus tetap berlanjut untuk masa mendatang. Aweng sosok pemimpin yang tegas, namun tetap sopan menghadapi siapa saja. “Berbagai masalah yang pernah terjadi dalam tubuh Pemuda Pancasila mampu diselesaikannya,” ujar Cana. Sebelumnya, Ketua MPC PP Padanglawas menyatakan dukungannya karena Aweng mampu membangun dan memajukan Pemuda Pancasila di Sumatera Utara. “Program anti narkoba yang diterapkan Bung Aweng saat ini perlu didukung oleh seluruh kader karena hal ini merupakan musuh kita bersama,” tegas Afner.(m08)

Nusantara

A6 Korban Tabrakan Xenia Disantuni Mensos JAKARTA (Waspada): Korban musibah ‘Xenia maut’ yang dikendarai Afriyani Susanti Minggu (22/1) lalu, mendapat simpati dari Menteri Sosial Salim Segaf Al Jufrie. Selain korban yang dirawat di RSPAD, bocah Kenny dan Siti Mukharomah dapat kunjungan simpati dari Mensos. Demikian juga keluarga korban meninggal dunia, diantaranya Bukhari, 16, ikut disambangi Mensos di kediamannya di Kelurahan Tanah Tinggi, Kecamatan Johar Baru, Jakarta Pusat, Kamis (26/1). Mensos yang langsung mendatangi kamar almarhum Bukhari yang pengap dan sempit menyatakan simpati kepada ayah Bukhari,Yadi. Tidak hanya Bukhari, musibah ini juga merenggut nyawa tiga warga Kelurahan Tanah Tinggi, Kecamatan Johar Baru. Selain Bukhari, korban tewas lainnya adalah Akbar, Firmansyah dan Huzaifah atau biasa dipanggul Ujai. Menurut Mensos, kedatangannya mengunjungi keluarga almarhum selain simpati, juga memberikan santunan sebesar Rp5 juta untuk masing-masing korban. Tidak hanya korban yang meninggal, yang masih dalam perawatan dan mengalami luka-luka pun diberi santunan. Seluruh bantuan diberikan kepada 12 keluarga korban tabrakan Xenia di Tugu Tani. Khusus almarhum Bukhari, tabungan Program Kesejahteraan Sosial Anak (PKSA) sebesar Rp,5 juta langsung diberikan kepada ayahnya Yadi. “Ternyata rekan Bukhari

yang selamat, yakni Lutfie dan Indra merupakan warga binaan rumah singgah yang mendapat bantuan PKSA atau Program Kesejahteraan Sosial Anak. Setelah ditelusuri relawan Kemensos, mereka benar anak jalanan yang mendapat bantuan PKSA,” kata Mensos. Salah satu pendamping PKSA, Maya M Rio mengatakan, firasat kepergian Bukhari juga dirasakannya. Karena sebelumnya, Bukhari yang tidak sekolah dan biasa ngamen di jalanan ini rencananya Maret nanti akan mengikuti program Paket C di rumah singgahnya. Karena mau meneruskan pendidikannya, Bukhari kemudian mendapat bantuan PKSA yang setiap tahunnya diberikan sebesar Rp1,5 juta. “Uang tersebut oleh Bukhari ingin dibelanjakan sekaligus untuk keperluan celana, baju dan sepatu baru. Saya bilang, tidak bisa diambil sekaligus karena hanya bisa diambil setiap bulan saja sebesar Rp125.000. Sebelum keinginannya mendapatkan barang tersebut, Bukhari terlanjur tewas oleh musibah tabrakan,” katanya. Menurut Mensos, pemerintah tidak bisa diam saja menghadapi musibah ini. Dirinya berharap, warga di Johar Baru yang tinggal di daerah kumuh dan miskin serta padat penduduk ini, diberikan bantuan modal usaha. Agar anak-anaknya tidak lantas menjadi pengamen untuk keperluan hidup sehari-hari namun bisa kembali ke sekolah seperti niat almarhum Bukhari yang ingin melanjutkan

Dalam hal ini, Rahmat mendesak tanggung jawab dan keterlibatan aktif PTPN II maupun BPN untuk menuntaskan permasalahannya. Dia juga menyebutkan, hal itu respon DPD RI terhadap tuntutan masyarakat Sumut guna penuntasan masalah tanah yang ada. Rahmat yang juga Ketua Tim Kerja RUU Pertanahan DPD RI mengatakan, Komite I menaruh perhatian dan mengikuti perkembangan penyelesaian masalah tanah di di Sumut, baik eks HGU PTPN II maupun masalah lainnya. Dia juga menyatakan, DPD RI menjadi garda terdepan

Jumat 27 Januari 2012

Kasus Century

pendidikan SMP-nya. Mensos juga mendukung upaya penertiban pengemudi dengan pemeriksaan kadar alkohol maupun barang Napza. Sebab barang haram tersebut, jelas-jelas hanya berdampak negatif dan membahayakan lingkungan masyarakat. Dijenguk Linda Agum Sehari sebelumnya, Menteri Negara Pemberdayaan Perempuan Linda Amalia Sari Agum Gumelar juga menjenguk korban Xenia maut di RSPAD. Salah satu ibu yang menjadi korban Siti Mukaromah, 30, telah menjalani operasi di bagian pinggang dan kaki. Siti adalah seorang ibu dari salah satu korban meninggal dalam kecelakaan maut tersebut.Yusuf, anak tunggalnya yang berusia 2,5 tahun ini meninggal dalam kecelakaan tersebut dan meninggalkan trauma yang mendalam bagi Siti. Namun Siti selalu diberikan pengertian oleh sang suami,Teguh, yang juga menjadi korban kecelakaan, agar tetap mementingkan proses kesembuhan Siti. Rasa haru pun seketika hadir saat Meneg PP & PA yang didampingi oleh Kepala Rumah Sakit RSPAD Gatot Subroto, mengunjungi Siti saat itu telah dipindahkan dari ruang ICU ke rawat inap Bedah lantai 4 RSPAD Gatot Subroto. Terkait pelaku, Linda menegaskan harus dihukum sesuai dengan perbuatannya. Apalagi jika menghilangkan nyawa banyak orang, sebaiknya tidak pandang bulu, apakah dia pria atau wanita. (dianw)

Semua Pihak Harus Aktif Tuntaskan Masalah Tanah Di Sumut MEDAN (Waspada): Anggota DPD RI Rahmat Shah meminta semua pihak terkait dalam masalah pertanahan di Sumatera Utara aktif mendukung upaya Pemerintah Provinsi Sumatera Utara menuntaskan eks HGU PTPN II seluas 5.873,06 hektar. Rahmat menyampaikan pernyataannya kepada media melalui siaran pers yang diterima Waspada di Medan, Rabu (25/1). Sebelumnya telah dilakukan Rapat Dengar Pendapat (RDP) Komite I DPD RI dengan Plt. Gubsu di Ruang Rapat Komite I Gedung B DPD RI, Senayan, Jakarta, Selasa (24/1).

WASPADA

solusi kasus-kasus pertanahan di Indonesia termasuk di Sumatera Utara. Khusus masalah tanah eks HGU PTPN II, Rahmat mengingatkan masalah ini telah berlangsung sejak 2002 hingga sekarang tanpa ada penyelesaian tuntas dan transparan. Karenanya dituntut komitmen kesungguhan sikap dan fokus pihak terkait dan berwenang dengan target 2012 masalahnya tuntas dengan baik dan damai. Menurut dia lagi, masalah ini bila tidak ditanggapi dan diselesaikan dengan serius maka akan menjadi bom waktu yang merusak sendi-sendi kehidupan berbangsa dan bernegara. (m34)

Direksi Tidak Pernah Minta Pinjaman Rp6,7 Triliun JAKARTA (Waspada): Terdakwa kasus bailout Bank Century, Robert Tantular menegaskan Direksi Bank Century tidak pernah meminta Fasiltas Pinjaman Jangka Pendek (FPJP) sebesar Rp6,7 triliun, tetapi hanya minta bantuan likuiditas sebesar Rp1 triliun kepada Bank Indonesia. “Jadi saya sampai sekarang belum bisa mengerti alasan di

balik keputusan Bank Indonesia memberi bailout hingga Rp6,7 trilliun. “Saya harap Tim Pengawas (Timwas) DPR untuk kasus Bank Century bisa menyelidiki keanehan itu,” kata Robert dalam keterangannya pada rapat Timwas DPR RI, Kamis, (26/1) di Gedung DPR, Jakarta, yang dipimpin Wakil Ketua DPR Taufik Kurniawan. Robert menjelaskan, pada September 2009, dirinya baru

Mobil Esemka Direncanakan Sejak Lima Tahun Lalu JAKARTA (Waspada): Wali Kota Solo Joko Widodo mengungkapkan, proses pembuatan mobil Esemka sudah dirancang dari lima tahun yang lalu. Keputusan merancang pembuatan mobil terlebih dahulu melihat potensi yang ada dan kemudian bersama Direktur Pembinaan SMK, Kementerian Pendidikan Nasional mendeklarasikan Solo sebagai kota vokasi atau kejuruan. Menurutnya, dalam konteks pembangunan mobil Esemka ini, ada dua wilayah yang dikembangkan. Pertama, untuk pembelajaran di Sekolah Menengah Kejuruan (SMK). Kedua, untuk menyiapkan produksi yang bersifat komersial di PT Solo Manufaktur Kreasi dan Solotehcnopark. Setelah mendapatkan hasil maka pada 2 Januari 2012 mobil Esemka ini dijadikan mobil dinas oleh wali kota Solo. Dari sini, akhirnya isu mobil Esemka ini menjadi wacana publik dan ramai dibicarakan. ”Sudah dua tahun kita pamerkan di Jakarta, Bandung, Surabaya dan Solo, tidak ada yang lirik dan perhatikan. Ini mobil bagus dan generasi ketiga. Jelek-jelek diperbaiki dan hasilnya yang terakhir, kita memiliki tiga prototipe, double cabin, SUV dan pick up,” ujar Jokowi pada rapat dengar pendapat dengan Komisi VI DPR di ruang rapat Komisi VI, DPR RI, Jakarta, Rabu (25/1). Dia meyakinkan, jika diberi kesempatan pihaknya bisa melakukan produksi massal mobil Esemka ini.”Kami ingin tindakan action dan langsung dipasarkan. Yang pesan sudah 5.000-an. Kalau mau pesan ke Solotechnopark dan PT SMK, jangan ke wali kota Solo dan SMK,” tukasnya. Ditambahkan, manufaktur yang dibangun nanti bukanlah manufaktur raksasa, tetapi komponen dari home industri yang ada di Pulau Jawa. Misalnya, velg dari Tegal, mesin dari Sidoarjo, knalpot dari Purbalingga. PT Solo Manufaktur Kreasi sebagai pemegang prinsipal belum bisa memproduksi ribuan atau puluhan ribu unit mobil. Rata-rata produksi mobil saat ini hanya 200 sampai 300 unit mobil. Dan kalau dibantu, bisa mencapai 500 unit per bulan. Wakil Ketua Komisi VI Aria Bima mengatakan komisinya akan minta insentif-insentif seperti pajak, bahan baku, dan regulasi yang tidak mempersulit terwujudnya Mobnas. Hasil rapat dengar pendapat ini, sambung anggota Fraksi PDIP ini, akan dibawa ke rapat kerja dengan Menteri Keuangan, Menteri BUMN, Menteri Perindustrian, Menristek dan Menteri Perhubungan. ”Saya berharap semangat stakeholder yang kami undang tadi senyawa dengan keinginan masyarakat Indonesia pangsa pasar 240 juta sangat tidak nalar kalau kita ini sampai tidak punya satu mobil produk nasional,” kata Aria Bima. Dukungan politik dan keputusan politik, menurut Aria Bima, salah satunya menekan bank-bank milik negara untuk mengucurkan dana bagi program Mobnas. Untuk itu Komisi VI DPR sepakat membentuk Panja Pengembangan Industri Otomotif Nasional. Keputusan itu dibuat dalam rapat dengar pendapat yang dihadiri pejabat eselon dari Kementerian Pendidikan dan Kebudayaan, Kementerian Perindustrian, Kementerian BUMN dan Wali Kota Solo Joko Widodo. (aya)

tahu kalau dana yang digelontorkan LPS sudah mencapai Rp6,7 triliun. “Dibuat persepsi seolah-olah Rp6,7 triliun ini saya yang ambil. Saya tidak tahu. Saya sudah dipenjara. Rp6,7 triliun itu tidak pernah dibuka ke mana angka-angka itu. Permintaan direksi cuma Rp1 triliun. Ini benar-benar jadi pemikiran saya selama 3,5 tahun dipenjara,” tukas Robert. Robert Tantular juga mengeluhkan proses hukumnya dicicil-cicil, berbagai kasus perbankan yang dituduhkan padanya, selain kasus Bank Century. “Saya dikenakan sembilan perkara, ada juga perkara yang dicicil tidak tahu kelangsungannya sampai kapan. Saya sudah kena sembilan tahun, masih ada yang sedang disidang, ada yang masih di P19 di Mabes Polri dan masih ada juga yang sedang di BAP. Ini sudah tiga tahun pak.

Saya minta keadilan di sini,” tutur Robert. Menurut pengacaranya Deni Kailimang, Robert sudah jenuh dan tertekan menghadapi kasus Bank Century, masih pula ditambah dengan delapan kasus lain yang dicicil satu-satu oleh penegak hukum. Pernyataan Robert dan pengacaranya itu mendapat tanggapan dari anggota Timwas Century dari Fraksi Partai Golkar Chairuman Harahap. Menurut Chairuman, apa yang dialami oleh Robert Tantular sudah melanggar azas hukum. “Satu catatan perkara Rober Tantular dicicil-cicil, ini sudah melanggar azas hukum karena dalam KUHP ada gabungan tindak pidana dan hak itu harus diberikan ke terdakwa, terpidana. Kasus ini harus dibuka agar utuh. Ini yang berlaku di negara kita,” kata wakil rakyat

dari daerah pemilihan Sumut II ini. Chairuman Harahap juga meminta Robert memberi penegasan pemberian FPJP itu bukan atas permintaan Robert Tantular karena direksi Bank Century hanya meminta bantuan likuiditas sebesar Rp1 triliun. “Kalau begitu siapa sebenarnya yang merampok?” tanya Chairuman. Menindaklanjuti hasil audit forensik BPK, Timwas Century DPR RI akan menjadwalkan rapat dengan memanggil BPK pada pekan mendatang, dengan agenda utamanya mencocokkan keterangan Robert dan Lucas menyangkut kasus Century dengan pemahaman BPK. “Kita akan hadirkan BPK pekan depan untuk dikombinasikan data rapat hari ini,” kata Taufik. (aya)

Wapres Buka Rembug Nasional Saudagar NU:

Teladani Prinsip Rasulullah Agar Sukses SURABAYA (Antara): Wakil Presiden Boediono mengatakan meneladani prinsip Rasulullah SAW yakni jujur (siddiq), tanggung jawab (amanah), transparan (tabligh) dan bersikap profesional (fathonah) adalah kunci agar sukses dalam setiap bidang kehidupan. “Prinsip-prinsip (Rasulullah SAW) ini sebenarnya adalah rahasia sukses dalam kehidupan di bidang apapun,” katanya dalam sambutan pada pembukaan Rembug Nasional Saudagar Nahdlatul Ulama dan NU Expo 2012 di Surabaya, Kamis (26/1). Wapres mengajak masyarakat, khususnya pada warga NU dan peserta rembug untuk meneladani prinsip-prinsip yang dipegang Nabi Muhammad SAW tersebut. “Apapun kiat-kiat yang digunakan dalam berusaha, prinsip dari Rasulullah SAW yaitu jujur, tanggung jawab, amanah, dan profesional ini harus selalu dipedomani,” katanya. Wapres yakin kaum Nahdliyin sebagai santri sudah terlatih dan terbiasa dengan sikap

istiqomah, teguh dan konsisten dalam menjalankan agama. “Disiplin yang sama ini bisa diterapkan dalam berusaha,” kata Wapres dan menyatakan, kunci sukses lainnya adalah sikap membuka diri terhadap ide-ide baru dan mau belajar dari mereka yang berhasil. Dalam kesempatan tersebut, Wapres mengatakan pengalaman menunjukkan bahwa salah satu upaya untuk memperbaiki kesejahteraan yang paling efektif dan cepat adalah melalui jalur pengembangan kewirausahaan. Mendorong kewirausahaan berarti menciptakan kemandirian. “Warga NU sesungguhnya tidak asing dengan kemandirian umat secara ekonomi. Contohnya adalah pesantren yang merupakan pondasi kaum Nahdliyin mampu berdiri di atas kaki sendiri dalam memenuhi kebutuhannya,” katanya. Menurut Wapres, NU memiliki modal dasar yang luar biasa untuk mengembangkan pengelolaan usaha yang sukses. Modal dasar itu adalah jaringan raksasa pondok pesantren, ser-

ta alumni yang begitu banyak. “Jika dapat memilih bidang usaha yang tepat, dan dikelola dengan tepat, dengan modal dasar jaringan yang luar biasa ini, saya sangat yakin para saudagar NU ini akan sukses dan berhasil,” kata Wapres. Dalam acara rembug nasional, Wapres didampingi Ibu Herawati. Turut hadir dalam acara tersebut, Ketua Umum PBNU KH Said Aqil Siradj, Menteri Pendidikan dan Kebudayaan Mohammad Nuh, Menteri Lingkungan Hidup Balthasar Kambuaya, Gubernur Jawa Timur Soekarwo. Sedangkan PWNU Sumatera Utara mengirim tiga utusan yakni Ketua PWNU Sumatera Utara H Ashari Tambunan, Sahrul ‘Ayun’ Yunan dan Upar Pulungan. “NU Expo 2012” yang akan berlangsung hingga 29 Januari diikuti 256 stand dari seluruh Tanah Air yakni 206 stand bersifat in door dan 50 stand bersifat “out door” serta dimeriahkan dengan “Nyantri in Mall” yang menampilkan sejumlah kiai dan penyanyi religi.

Dugaan Korupsi Di PTMSI Akan Dilaporkan ke KPK

Waspada/Ist

ANGGOTA Komisi VI Fraksi Partai Golkar DPR RI Idris Laena (paling kanan) saat peluncuran album perdana duet Astrid Laena (dua dari kanan) dengan Samuel Zylgwyn (dua dari kiri) bertajuk ”Untuk Kamu” dengan produser Lili Idris Laena (paling kiri) di Hard Rock Café, Jakarta, Minggu (22/1).

Regulasi RBT Diharap Tak Merugikan Industri Musik JAKARTA (Waspada): Anggota komisi perindustrian dan perdagangan DPR RI Idris Laena menyambut positif rencana pemerintah untuk memberlakukan regulasi Ring Back Tone (RBT) mengingat banyak kasus pencurian/pemotongan pulsa tanpa seizin atau sepengetahuan pemilik ponsel. Adanya regulasi yang lebih baik dari pemerintah agar RBT tidak dianggap merugikan pihak musisi dan kalangan masyarakat. Dia mengemukakan pendapatnya di sela-sela peluncuran album perdana duet Astrid Laena dengan Samuel Zylgwyn bertajuk Untuk Kamu hasil karya pencipta lagu andal Wahyu WHL di Hard Rock Café, Minggu (22/1). Peluncuran Album perdana Untuk Kamu duet Samuel dan Astrid mengambil lokasi syuting video klip single perdana Untuk Kamu di San Diego Hills, Karawang, Jawa Barat. Konsep video klip percintaan dan kesetiaan sepasang kekasih, disesuaikan dengan lirik lagu dengan menampilkan pasangan yang terlihat romantis dengan nuansa serba putih. Samuel memakai kemeja dan celana panjang putih dengan ciri khas rambut gondrongnya yang ditata rapi dengan bando. Sementara Astrid tampil cantik dengan kulit cokelatnya yang dibalut dengan gaun putih. Idris berharap regulasi

pemerintah Badan Regulasi Telekomunikasi (BRT) nantinya tidak sembrono dalam mengambil keputusan pada kisruh premium content dan tak merugikan kelangsungan hidup sebuah musik atau label yang mengandalkan hidup dari RBT sebagai sumber penghasilan. Agar pelanggan/pemilik ponsel tak merasa dirugikan, seluruh content provider juga harus memudahkan proses UNREG dan menjelaskan risikonya bagi pengguna RBT setelah pelanggan melakukan register RBT. “Dalam regulasi mestinya konsumen jangan sampai dirugikan. Harus diatur adanya sistem potong pulsa otomatis. Jangan sampai pengguna ponsel tidak tahu mengapa pulsanya dipotong. Harus ditawarkan ulang, apakah pengguna ponsel itu mau atau tidak. Jadi seperti reset ulang saja,” kata politisi Partai Golkar seraya mengatakan pemotongan pulsa tanpa seizin atau sepengetahuan pemilik ponsel tetap merupakan pencurian dan wajib diusut oleh pihak kepolisian. Idris sepakat penggunaan RBT dipertahankan, karena bagaimanapun RBT menjadi satu-satunya tumpuan penghasilan musisi, penyanyi dan pelaku industri musik setelah rendahnya ekspetasi terhadap penjuangan kaset dan kepingan

CD akibat maraknya bajakan. Di sisi lain, jika pemerintah menutup RBT, justru akan mematikan industri musik di tanah air yang bakal terus berkembang setiap saat. Sebab RBT menjadi satu-satunya tumpuan penghasilan musisi, penyanyi dan pelaku industri musik di tanah air. “Penutupan RBT justru akan membuat para pelaku industri musik tanah air kesulitan mencari sumber penghasilan. Karena selama musisi dan penyanyi mengandalkan RBT. Bisa dibayangkan berapa kerugian jika RBT ditutup,” ujar politisi dari daerah pemilihan Riau itu. Idris Laena tak mengelak rencana penghentian sementara RBT mencuat setelah heboh pencurian pulsa dan penipuan pesan singkat (SMS) yang mencuat akhir-akhir ini. Pemerintah melalui BRTI kemudian bersepakat dengan Asosiasi Telekomunikasi Seluler Indonesia (ATSI) menghentikan layanan SMS premium termasuk layanan RBT mulai 18 Oktober 2011 lalu. Politisi dari Fraksi Partai Golkar itu mendorong pengetatan layanan RBT diterapkan terhadap layanan pesanan singkat bidang untuk perbankan atau bursa efek. “BRT mesti memasukan layanan RBT ke dalam beberapa layanan yang dibiarkan berjalan seperti perbankan, bursa efek,” ujarnya. (j07)

JAKARTA (Waspada): Komite Penyelamat Tenis Meja Indonesia (KPTMI) akan melaporkan dugaan penyalahgunaan uang negara oleh oknum petinggi Pengurus Besar Persatuan Tenis Meja Seluruh Indonesia (PB PTMSI). “Dugaan penyalahgunaan uang negara sebesar Rp3 miliar tersebut akan dilaporkan pekan depan ke Komisi Pemberantasan Korupsi (KPK) dan meminta Badan PemeriksA Keuangan (BPK) melakukan audit investigasi,” kata juru bicara KPTMI Peter Layardi didampingi ketua Ketua KPTMI DKI Jakarta Arifin Tahie kepada wartawan di Jakarta, Kamis (26/1). Para tokoh tenis meja dari berbagai daerah yang merupakan pengurus Pengprov, ujar Peter, juga telah membentuk KPTMI untuk membongkar berbagai kejanggalan di PB PTMSI. Termasuk keabsahan kepengurusan PB PTMSI periode 2011-2014. Sedang KONI (Komite Olahraga Nasional Indonesia) sendiri, menurutnya, saat ini sedang menginvestigasi kekisruhan di tubuh PB PTMSI dan menunda pengesahan kepengurusan yang baru terpilih tersebut. Secara terpisah, Ketua Harian Pengprov PTMSI Lampung Busman Zainudin dan Ketua Pengprov PTMSI Kepri Juradis membenarkan rencana Komite Penyelamat Tenis Meja Indonesia (KPTMI) melaporkan dugaan penyalahgunaan uang negara ke KPK dan BPK untuk mengaudit. (aya)

Program Rumah FLPP Terancam Mandek JAKARTA (Waspada): Program rumah bersubsidi dengan menggunakan Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) terancam tidak mencapai sasaran alias mandek (stagnan), disebabkan belum adanya kesepakatan baru soal suku bunga antara bank penyalur dengan Kementerian Perumahan Rakyat (Kemenpera). Ketua DPP Asosiasi Pengembang Perumahan dan Permukiman Seluruh Indonesa (Apersi) Eddy Ganefo, memperkirakan pasokan rumah untuk rakyat ini bisa anjlok 50% dari 80.000 yang mampu. Tertundanya program Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) akibat tarik ulur suku bunga antara pemerintah dengan bank penyalur, membawa dampak buruk bagi Masyarakat Berpenghasilan Rendah (MBR) yang pantas dapat rumah layak huni di 2012. “Suplai tadinya bisa mencapai 80.000. Tapi karena belum ada kesepakatan baru akan turun 50%, bahkan prediksi saya bisa drop menjadi 30.000. Karena permintaan rumah ini melalui FLPP semakin tidak jelas dan berpotensi tidak terserap pasar. Hal ini karena MBR tidak mungkin membeli dengan mengikuti suku bunga konvensional,” ungkapnya di Jakarta, akhir pekan kemarin. Pemerintah menghendaki penurunan suku bunga kredit FLPP hingga 5-6% dari kesepakatan tahun lalu yang mencapai 8,15%, dengan alasan mulai turunnya suku bunga kredit perumahan komersial lainnya. Menurut Dirut Bank Tabungan Negara (BTN) Tbk, Iqbal Latanro, belum adanya titik temu lagi soal Perjanjian Kerjasama Operasional (PKO) yang baru antara bank penyalur dengan Kemenpera akan menimbulkan hambatan pasokan. “BTN sendiri sudah menurunkan target rumah pola FLPP menjadi 100 ribu unit, dari semula 130 ribu unit per tahun,” katanya. (j03)

Waspada/Ist

REKTOR Universitas Syiah Kuala Prof Dr. Darni M Daud, MA meresmikan Rumah Riset Tahan Gempa di halaman kantor TDMRC di Jl. Tgk. Abdur Rahman Gampong Pie Meuraxa Ulee Lheue Banda Aceh, Rabu (25/1).

TDMRC Unsyiah Resmikan Rumah Riset Tahan Gempa BANDA ACEH (Waspada): Tsunami Disaster Mitigation Research Center (TDMRC) Universitas Syiah Kuala meresmikan Rumah Riset Tahan Gempa, Rabu (25/1) di halaman kantor TDMRC di Jl. Tgk. Abdur Rahman Gampong Pie Meuraxa Ulee Lheue Banda Aceh. Acara ini dihadiri perwakilan lembaga pemerintah di tingkat Provinsi dan Kabupaten, perwakilan LSM, akademisi dan pemerhati penanggulangan bencana. Turut hadir Profesor Masyhur Irsyam sebagai Ketua Tim 9 Penyusun Revisi Peta Zonasi Gempa Indonesia. Rumah riset tahan gempa ini merupakan bagian dari kegiatan Disaster Risk Reduction for Aceh yang didanai Multi Donor Fund/UNDP. Dr. Ir. Abdullah, M.Sc selaku pemimpin rumah riset tahan gempa mengatakan, ide pembuatan rumah riset tahan gempa ini diinspirasi oleh keadaan yang dia lihat pada saat pembuatan rumah bantuan masa rehab-rekon tsunami. Banyak bahan bangunan yang mahal dan harus dikirim dari luar. Jadi inilah yang membuat Tim Riset TDMRC ingin menciptakan sendiri bahan bangunan. Kalau biasanya beton yang digunakan untuk membuat rumah biasa memiliki

berat 2,4 ton/meter kubik, tapi beton yang ditemukan Dr. Abdullah memiliki berat jenis hanya 1,2 ton/meter kubik. Jadi material konstruksi ini hampir setengahnya lebih ringan dari beton biasa, katanya. Disebutkan Abdullah, rumah riset tahan gempa ini merupakan salah satu dari beberapa produk penelitian kebencanaan yang digagas oleh TDMRC melalui kegiatan Peer Group risetnya. Saat ini terdapat 12 Peer Group peneliti kebencanaan yang meneliti tidak saja dari segi ancaman, namun juga meneliti bagaimana menurunkan kerentanan masyakarat dan wilayah terhadap bencana. Rumah riset tahan gempa ini diresmikan oleh Rektor Universitas Syiah Kuala Prof Dr. Darni M Daud, MA. Dalam sambutannya beliau mengatakan, kita bisa bangkit dengan langkah-langkah yang interaktif dan inovatif. “Hampir setiap minggu gempa terjadi di Aceh. Namun terkadang ada yang tidak terasa oleh kita. Nah, untuk itu kita butuh bangunan rumah yang harus kita persiapkan yang tahan gempa dan bisa menjaga penghuni rumahnya. Jadi kami keluarga besar Unsyiah menyambut baik dan memberikan apresiasi yang besar kepada

launching rumah riset tahan gempa ini,” ujar rector. Dalam kesempatan yang sama Direktur TDMRC Dr. Ir. M. Dirhamsyah mengungkapkan, TDMRC bertekad memberikan pelayanan kepada masyarakat dan pemerintah dalam bidang penanggulangan bencana berdasarkan ilmu pengetahuan dan teknologi sembari berujar. “Bangsa yang besar adalah bangsa yang menghargai riset,” sebutnya. Yang tidak kalah menarik adalah presentasi yang disampaikan Prof Masyhur Irsyam yang menyatakan beberapa kekhawatiran terhadap potensi gempa darat yang ada di Indonesia termasuk di Aceh. Hal penting yang menurut Masyhur perlu diwaspadai adalah tidak bergeraknya patahan Aceh dan Seulimum dalam kurun waktu yang cukup lama. Ini mungkin saja indikasi bahwa patahan tersebut telah menyimpan energi yang cukup besar dan berpotensi memicu gempa daratan yang besar. Oleh karena itu, lanjutnya, upayamitigasibencanatermasuk rumahtahangempayangdigagas oleh TDMRC adalah hal penting yang perlu ditindaklanjuti agar upaya melindungi masyarakat di kawasan rawan gempa ini akan semakin optimal. (m08)

Pentas Demokrasi Aceh

WASPADA Jumat 27 Januari 2012

Gubernur Aceh Minta Maaf

Wali Kota Langsa Dilaporkan Ke Polisi LANGSA (Waspada): Akibat dugaan melakukan pelanggaran terhadap tahapan Pemilukada, Wali Kota Langsa Drs. Zulkifli Zainon, MM berurusan dengan polisi. Panitia Pengawas Pemilu (Panwaslu) Kota Langsa, Kamis (26/1), menyerahkan berkas pelanggaran kampanye calon wali kota Langsa incumbent Drs Zulkifli Zainon, MM kepada tim Penegakan Hukum Terpadu (Gakkumdu) Polres Langsa guna diproses lebih lanjut. “Berkas pelanggaran kampanye calon incumbent ini kita limpahkan ke polisi setelah sebelumnya kita plenokan di tingkat Panwaslu Langsa,” demikian dikatakan Ketua Panwaslu Kota Langsa M Khairi kepada wartawan, Kamis, (26/1). Menurut M Khairi, sebelumnya Panwaslu Kota Langsa telah melakukan pengkajian dan verifikasi alat bukti terhadap kampanye yang digelar calon wali kota Langsa incumbent pada 18 Januari lalu di Gampong Jawa Langsa, yang menyimpulkan kasus tersebut masuk dalam kategori tindak pidana Pemilu. Dasar konsiderannya, kata dia, keputusan KPU no 14 tahun 2010 pasal 5 ayat 3, agar bisa dikatagori kampanye harus memenuhi unsur komulatif yaitu, pertama dilakukan pasangan calon, kedua menyampaikan visi dan misi dengan mengajak pemilih untuk memilih dan yang ketiga memasang alat peraga berupa baliho atau atribut lainya, kata M Kahiri. Atas hal tersebut Panwaslu juga berpedoman pada UU No

32 tahun 2004 tentang pemerintah daerah pasal 116 ayat 1, setiap orang yang melakukan kegiatan diluar waktu yang telah ditetapkanolehKPUD/KIPuntuk masing-masing pasangan calon dapat dikenakan sanksi pidana. “Jadi setelah melalui kajian yang mendalam, akhirnya Rabu (25/1) kemarin kita limpahkan kasus ini ke Polres Langsa dan saat ini sudah ditangani polisi,” ujar Khairi seraya berharap agar kasus ini tuntas, sehingga tidak timbul prasangka buruk terhadap Panwaslu. Diakuinya, sebelumnya Divisi Penanganan Kasus dan Tindak Lanjut Panwaslu Langsa ada menemukan beberapa buk-ti di antaranya, ada panggung yang latar belakang balihonya bergambar calon wali kota incumbent dengan wakilnya. Selain itu calon juga menyampaikan visi dan misi bahkan mengajak massa yang datang untuk memilih. Ditandai dengan teriakan yel yel yang jadi icon incumbent yaitu “lanjutkan”. Dan jumlah massa yang hadir kurang lebih 300 orang diduga keras adalah pendukung yang sengaja didatangkan. Sementara itu, Kapolres Langsa AKBP Drs Yosi Muhamartha melalui Kasat Reskrim AKP Warosidi, SH, mengatakan pihaknya sudah menerima berkas limpahan dari Panwaslu dan saat ini sedang mempelajari berkas bahkan sudah mulai kita panggil pihak-pihak terkait serta para saksi. “Intinya kita akan serius menanggani perkara ini dengan cepat,” kata Kapolres. (b20)

Coffee Morning Libatkan PNS Abdya BLANGPIDIE (Waspada): Para pegawai dan pejabat di Kab. Aceh Barat Daya (Abdya) saat ini mulai mendapat tugas baru yang bertolakbelakang dengan fungsi utamanya sebagai seorang PNS. Tugas itu berupa sebagai peserta coffee morning dengan agenda politik yang digelar tim sukses incumbent yang menjadi calon Bupati Abdya saat ini. Akibatnya, sejumlah PNS mulai mengeluh. “Hampir setiap hari kami ikut coffee morning dengan lokasi berbeda-beda, padahal ada banyak kegiatan lain yang harus kami kerjakan, tapi saat ini terpaksa harus ikut karena yang hadir calon incumbent yang juga atasan kita saat ini,” kata salah seorang pejabat di salah satu badan di Abdya, Rabu (25/1). Diakuinya, acara coffee morning bernuansa politik yang diadiri calon incumbent tersebut biasanya dilakukan di beberapa tempat, selain beralasan sebagai acara temu ramah dan silaturahmi, agenda coffee morning tersebut lebih dominan diisi

dengan dialog antara calon incumbent dengan para pendukungnya. Namun yang lebih memberatkan para PNS adalah acara tersebut sering menggiring mereka untuk memobilisasi massa ke pusat acara. “Hal-hal seperti itu semestinya jangan dibebankan ke kita, karena persoalan politik tentu menjadi kewenangan tim sukses,” kata PNS tadi. Terkait persoalan tersebut, salah seorang pengurus posko tim sukses calon incumbent membantah adanya intervensi dan intimidasi terhadap para PNS untuk kepentingan politik incumbent, namun pihaknya menilai adanya keikutsertaan pegawai dalam beberapa acara seperti coffee morning hanya sebatas sukarelawan dan tanpa pemaksaan. Ketua Panwas Pilkada Abdya Edy Faisal yang dikonfirmasi Waspada mengaku belum mendapatkan laporan tersebut, namun pihaknya siap melakukan tindakan tegas jika memang ada laporan yang diberikan secara resmi. (cb05)

IDI ( Waspada): Tujuan Gubernur Aceh H. IrwandiYusuf melakukan Kunjungan Kerja (Kunker) secara maraton menjelang akhir jabatannya 8 Februari adalah untuk meminta maaf kepada seluruh rakyat Aceh. Termasuk Kunker ke Aceh Timur, Kamis (26/1). “Selama saya pimpin Aceh hampir 5 tahun atau satu periode yakni 2007-2012, saya atas nama Gubernur Aceh meminta maaf kepada seluruh rakyat Aceh, karena mungkin selama di bawah kepemimpinan saya ada yangtersinggungdengantingkah, sikap, kata ataupun ada yang sakit hati,” ujar Irwandi Yusuf. Di hadapan ratusan masyarakat dan alim ulama serta pejabat daerah, Irwandi Yusuf tak hanya sebatas meminta maaf, tetapi menginginkan rakyat Aceh Timur untuk menjawabnya. “Apakah sudah dimaafkan?” ujar Irwandi Yusuf. Lalu, para hadirin yang hadir dalam peresmian PPP Idi di Kuala Idi kemarin menjawabnya secara serentak, sudah. “Alhamdulillah,” sambung Irwandi lagi. Menurut Irwandi, hal itu perlu diucapkan langsung di hadapan rakyatnya, karena dirinya meyakini selama memimpin Aceh selama lima tahun banyak

Waspada/Mustafa Kamal

BENDERA Partai Aceh dengan ukuran lebih kurang 3x5 meter dipasang di tepi jalan Medan-Banda Aceh, Desa Meuria Paloh, Kec. Muara Satu, Lhokseumawe. Berkibarnya bendera tersebut setelah PA mendaftarkan calonnya ke Komisi Independen Pemilihan (KIP) mulai 19 Januari lalu. Foto ambil Kamis (26/1).

Keterlibatan PA Sulit Dibuktikan BANDA ACEH (Antara): Peneliti senior dari Lembaga Centra Politika Mashudi SR menilai adanya sinyalemen Partai Aceh (PA) ikut bermain untuk mendorong calon independen mendaftar pada Pilkada Aceh sulit untuk dibuktikan. “Sinyalemen ke arah sana ada bahwa dua pasangan calon independen yang maju merupakan ‘setting’ dari Partai Aceh guna membuat KIP kelimpungan, sehingga Pilkada bergeser jadwal pelaksanaannya. Tapi ini hanya sebatas praduga dan hal itu sulit dibuktikan,” katanya di Banda Aceh, Rabu (25/1). Mashudi menjelaskan, tentu adalah hal yang merepotkan bagi Komisi Independen Pemilihan (KIP) Aceh untuk melakukan proses verifikasi terhadap para

kandidat independen. “Calon independen itukan harus diverifikasi faktual atas dukungan yang mereka sertakan, nah dengan munculnya dua pasangan calon baru yang mendaftar sebagai kandidat gubernur tentu hal tersebut membuat KIP membutuhkan waktu ekstra untuk melakukan verifikasi,” jelasnya. Lebih lanjut Mashudi menambahkan, jikapun kemudian dua pasangan calon yang men-

daftar sebagai kandidat gubernur dan wagub adalah merupakan bagian dan strategi politik PartaiAcehtentutidaksertamerta hal tersebut dapat dibuk-tikan. Terlepas dari hal apapun dan juga tanpa calon independen mendaftar, KIP Aceh tidak mungkin dapat menggelar Pilkada pada 16 Februari,” ujarnya. Ditambahkannya, hal yang paling penting untuk dilakukan KIP Aceh dan juga semua

Kandidat Aceh Singkil Bertambah SINGKIL (Waspada): Pasangan Rudy Rizal-Syahrima dari jalur Independen mendaftar sebagai peserta Pilkada ke kantor KIP Singkil, Selasa (24/1) malam. Pasangan Rudy Rizal-Syahrima merupakan pasangan kedua yang mendaftar Selasa (24/1) malam. Sore sebelumnya pasangan Jaminuddin B-Sopian Pohan, SH mendaftar sebagai kandidat bakal calon (Balon) bupati/wakil bupati Kabupaten Aceh Singkil periode 2012-2017. Darman Manik, personel sekretariat KIP Aceh Singkil yang dihubungi Waspada, Rabu (25/1) melalui telefon membenarkan kedua pasangan tersebut telah mendaftar. Informasi lain yang diperoleh Waspada menyebutkan, pasangan Jaminuddin-Sopian Pohan dilengkapi data pendukung 4.320 lembar copy kartu tanda penduduk (KTP) sedangkan pasangan Rudy Rizal-Syahrima didukung data 3.615 lembar copy KTP sebagai syarat dari jalur independen (perseorangan) Delapan pasangan Cabup/Cawabup yang telah ditetapkan nomor urutnya sebelumnya masing-masing, nomor urut 1, pasangan H Sapriadi, SH-Dulmusrid, 2 H Syamsul Bahri, SHAsbaruddin, STP, M.Eng, 3. Drs H Burhanuddin Berkat, SH, MHH Rafi,I Munir, SAg, MAg. Kemudian nomor 4 H Sajali, SSos-Drs Saiful Umar, 5 Hj Cut Khairana, SPd-Ranto, SE, 6 Subkiyadi-Zainal Abidin, 7 H Syafril Harahap, SH-Juliyardin, SAg dan nomor urut 8 H Muhammaddin, SPd-Mansurdin. (b27)

Tindakan Sekdako Langsa Menuai Kritik

Waspada/Ibnu Sa’dan

KETUA Ormas Nasdem Lang-sa H Jauhari Amin menyerahkan bantuan sampan kepada dua nelayan miskin Gampong Kuala Langsa, Kartini dan Sal-biah, janda miskin yang seharihari bekerja sebagai pencari tiram. berikan tidak seberapa, namun kita berharap bantuan diterima nelayan yang benar-benar miskin dan butuh bantuan. Sehingga bantuan yang kita berikan akan bermanfaat bagi mereka,” kata Adi Marbun. Sementara itu, dua nelayan miskin yang menerima bantuan sampan, Kartini dan Salbiah, terlihat sangat terharu ketika menerima bantuan sampan tersebut. Bahkan kedua janda pencari tiram itu, dengan mata berkaca-kaca mengucapkan terima kasih berkali-kali kepada Ormas Nasdem Langsa yang telah peduli dengan kehidupan mereka yang sangat sulit. “Kami sangat berterima kasih kepada Bapak H Jauhari Amin selaku Ketua Nasdem yang telah membantu kami. Dengan adanya bantuan sam-

kesalahan yang dilakukan secara tidak sengaja ataupun secara sengaja. “Mungkin juga ada janji yang belum saya tepati ke rakyat. Ada visi dan misi ketika mencalonkan diri dulu yang belum terlaksana. Itu semuanya hari ini saya minta maaf kepada seluruh rakyat,” kata Irwandi Yusuf seraya mengatakan, Kunker kali ini ke Aceh Timur adalah Kunker Irwandi sebagai Gubernur Aceh yang terakhir kali sebelum jabatannya berakhir 8 Februari 2011. Lawan Kejahatan Gubernur IrwandiYusuf dalam sambutannya juga meminta agar masyarakat Aceh untuk melawan setiap aksi kejahatan, baik itu intimidasi dan provokasi yang dilakukan kelompokkelompok tertentu menjelang Pemilukada 2012. “Jangan biarkan darah tumpah di bumi Serambi Makkah,” katanya. Gubernur Aceh H. Irwandi Yusuf juga memaparkan, cukup sudah derita yang dialami rakyat Aceh, baik saat konflik yang berkepanjangan ataupun derita tsunami. “Sekarang, jika ada pihak yang mengintimidasi ke arah yang jahat, maka rakyat harusbangkituntukmelawannya dantetapmempertahankanyang benar,” tandasnya. (b24)

Cawabup Simeulue Akhirnya Ikut Tes Kesehatan

Jauhari Amin Serahkan Dua Sampan Untuk Nelayan LANGSA ( Waspada): H. Jauhari Amin, SH, MH atas nama Ketua Ormas Nasional Demokrat (Nasdem) Langsa, menyerahkan bantuan dua unit sampan kepada nelayan miskin di Gampong Kuala Langsa, Selasa (24/1). Dua sampan bantuan tersebut diserahkan di lintasan Kilometer 8 Kuala Langsa dan diterima dua orang janda nelayan yang selama ini bergantung hidup hanya dengan mencari tiram, masing-masing Kartini dan Salbiah. Salah seorang pengurus Ormas Nasdem Langsa Adi Marbun, kepada wartawan mengatakan, bantuan tersebut diserahkan pihaknya kepada warga miskin dalam rangka bakti sosial dan menjalin keakraban antara masyarakat dengan ormas Nasdem. Sebelum bantuan itu disalurkan, katanya, Ormas Nasdem Langsa terlebih dahulu mengidentifikasi masyarakat nelayan miskin di Gampong Kuala Langsa, agar bantuan yang diberikan benar-benar tepat sasaran. Setelah melalui proses konsultasi dengan aparat gampong Kuala Langsa dan penjaringan nelayan miskin, maka didapatlah dua orang nelayan Gampong Kuala Langsa yang benarbenar miskin dan membutuhkan bantuan tersebut. Kedua nelayan yang dipilih untuk menerima bantuan sampan dari Ormas Nasdem Langsa itu adalah Kartini dan Salbiah. Mereka adalah janda miskin yang sehari-hari bekerja sebagai pencari tiram. Selanjutnya bantuan itu langsung diserahkan Ketua Ormas Nasdem Langsa H Jauhari Amin, SH kepada dua nelayan tersebut yang dinilai layak mendapatkannya. “Meski bantuan yang kita

A7

pan ini, kami bisa bekerja lebih baik dan bisa mencukupi kebutuhan hidup kami,” kata Kartini yang juga diamini Salbiah. Selain itu, Kartini dan Salbiah juga mengatakan bantuan yang diterimanya sangatlah berarti, mengingat kehidupan mereka selama ini sangat sulit. Kepada Ketua Ormas Nasdem Langsa H Jauhari Amin yang juga calon Wali Kota Langsa, Kartini dan Salbiah berharap agar program bakti sosial Ormas Nasdem Langsa terus dilanjutkan, karena memang benar-benar diharapkan oleh masyarakat terutama para ekonomi lemah. “Sekali lagi kami sangat berterima kasih kepada bapak H Jauhari Amin, dan semoga beliau selalu dalam lindungan Allah SWT serta tercapai segala yang dicita-citakannya.” (b20)

LANGSA (Waspada): Tindakan Wali Kota Langsa Drs. Zulkifli Zainon, MM yang diduga telah mengangkangi aturan Pemilukada dengan melakukan kampanye dini, terimbas juga kepada Sekda Kota Langsa Muhammad Syahril. Dia dikritik telah berlaku tidak netral dalam eforia Pemilukada dengan mendukung salah satu pasangan calon. Kritikan tersebut antara lain disampaikan LSM Aceh Human Foundation (AHF), yang meminta pihak berwenang agar mencopot M Syahril dari jabatan Sekda Kota Langsa. Karena, yang bersangkutan terindikasi terlibat dalam kampanye calon Wali Kota Langsa incumbent pada 18 Januari lalu, hingga membuat netralitasnya sebagai seorang PNS dan pejabat daerah dipertanyakan. “Dalam UU No 43 tahun 1999 tentang pokok-pokok kepegawaian, khususnya pasal 3 ayat (2) dan ayat (3), sudah jelas diatur soal netralitas PNS dalam Pemilu. Kalau seorang pejabat setingkat Sekda melakukan pelanggaran, maka sudah sepantasnya dicopot dari jabatannya,” demikian dikatakan Ketua Umum Aceh Human Foundation Abdul Hadi Abidin, Selasa (24/1). Dikatakannya, kasus dugaan pelanggaran kampanye yang dilakukan calon wali kota Langsa incumbent, yang kini berkasnya sudah dilimpahkan Panwaslu Kota Langsa kepada polisi secara nyata telah melibatkan sejumlah pejabat Pemko Langsa terutama Sekda dan sejumlah kepala dinas serta kepala bagian (Kabag). Kondisi ini, sebut Abdul Hadi Abidin, membuktikan para pejabat Pemko Langsa sudah tidak netral dan melanggar UU No 43 tahun 1999, menjelang pesta demokrasi Pemilukada di Aceh. Bahkan dalam Peraturan KPU No 273 tahun 2008 disebutkan, apabila PNS ikut mendukung atau terlibat dalam permainan politik seperti mendukung atau mengarahkan rakyat ke salah satu calon, maka diancam hukuman penjara maksimal 12 bulan penjara serta denda Rp12 juta. Seharusnya, kata Abdul Hadi Abidin, sebagai PNS dan aparatur pemerintahan, para pejabat Pemko Langsa tidak boleh larut dalam eforia politik calon wali kota Langsa incumbent. Para PNS dan pejabat Pemko harus bisa membatasi diri untuk tidak terjerumus kedalam politik praktis. (b20)

elemen penyelenggara adalah upaya untuk menciptakan pilkada di Aceh lebih berkualitas. “Jadi tidak ada persoalan kalaupun kemudian jadwal pencoblosan bergeser sebagai implikasi atas putusan Mahkamah Konstitusi, namun yang terpenting adalah bagaimana kemudian Pilkada di Aceh itu dapat dilaksanakan lebih berkualitas,” ujarnya. Menurut Mashudi, bergesernya jadwal Pilkada yang kemudian diiringi dengan peningkatan kualitas pelaksanaannya jauh lebih penting untuk difikirkan oleh KIP Aceh. “Makna berkualitas tentu dalam tataran partisipasi masyarakat, pelaksanaan yang jujur, adil, bebas dan rahasia sesuai dengan azas Pemilu,” katanya.

BANDA ACEH (Waspada): Cawabup Simeulue, Rahmad, SH yang dinyatakan gagal ikut tes kesehatan Senin (23/1) lalu, mendapat kesempatan tes kesehatan, Kamis (26/1). Rahmad datang bersama pasangannya Cabup Simeulue dari PA, Aliasnudin yang ternyata juga tidak melakukan pemeriksaan kesehatan pada Senin lalu karena menunggu Rahmad. Pasangan ini menjalani tes kesehatan di RSUZA Banda Aceh diikuti empat kandidat yang mendaftar di akhir masa pendaftaran, Selasa (24/ 1) malam besama satu kandidat pengganti. Empat kandidat yang melakukan pemeriksaan kesehatan kemarin adalah calon wali kota dan wakil wali kota Lhokseumawe dari jalur perseora-

ngan Alfian, S.HI-Amri Bin Imni sertacalonbupatidanwakilbupati Singkil dari jalur perseorangan Rudi Rizal, S.Ag-Sahrima. Sementara satu lagi calon wali kota yang diusung Partai Aceh TB Herman, MM menggantikan Tengku Azkia Abu Bakar yang seelumnya sudah mengikuti tes kesehatan. Pemeriksaan tes kesehatan bagi para kandidat itu secara umum kemarin berjalan lancar. Namun ada sedikit perbedaan dengan para kandidat yang tes kesehatan Senin lalu. Untuk kegiatan psikotes/ tes kejiwaan para kandidat sebelumnya dilakukan di RSUZA sementara para kandidat yang ikut tes kemarin dilakukan di Rumah Sakit Jiwa Banda Aceh. Ini karena, menurut petugas, terbatasnya dokter jaga. (b04)

Waspada/Zafrullah

CABUP Simeulue dari Partai Aceh Aliasnudin (kiri) dan Rahmad, SH menandatangani hasil tes kesehatan mereka yang dilakukan oleh IDI Aceh, Kamis (26/1).

Putusan MK Harus Bernuansa Damai LHOKSUKON (Waspada): Keputusan Mahkamah Konstitusi terkait Pemilukada Aceh yang rencananya diputuskan Jumat (27/1) hari ini, diharapkan bernuansa damai dan mampu menyejukkan semua pihak di Tanah Rencong. “Jangan sampai putusan MK menuai polemik baru.

Kalaupun MK memutuskan Pemilukada ditunda, idealnya masa tunda maksimal hanya dua bulan, sehingga tidak ada kandidat yang merasa dirugikan,”saran Ar yos Nivada pemerhati masalah politik dan keamanan Aceh, kemarin. Menurut Mahasiswa pasca Sarjana ilmu Politik UGM

Yogyakarta ini, jika MK memutuskan Pemilukada Aceh ditunda lebih dua bulan, kandidat dari jalur independen yang selama ini sudah menge-luarkan finansial banyak, dipastikan akan protes dan ini bisa memicu konflik politik baru di Serambi Makkah. (b19)

Dari Rakyat Biasa Menuju Pilkada USAI shalat zuhur, sejumlah wartawan yang mangkal di gedung DPRK Aceh Utara mendapat informasi Misbahul Munir akan mengembalikan mobil dinas. Posisinya sebagai Wakil Ketua DPRK segera digantikan. Hari itu, Selasa (24/1) terakhir wartawan bisa mewawancarai dia dalam kapasitas sebagai wakil rakyat, karena setelah itu dia juga menjadi rakyat biasa karena telah direcall oleh partainya. Masih seperti biasa, beberapa menit menempelkan badan di kursi ruang kerja Wakil Ketua DPRK Aceh Utara, belasan wartawan disuguhi minuman kopi oleh yang empunya ruang. Hampir semua wartawan tidak menolak, mereka tidak fokus dengan minuman itu meskipun aromanya menggoda selera. Sambil menunggu proses administrasi pengembalian mobil Pajero Sport kepada sekretaris dewan, Rahul (panggilan untuk Misbahul) menjelaskan berbagai hal tentang keputusannya memilih ikut sebagai calon Bupati Aceh Utara untuk Pilkada mendatang. Setelah itu, mantan gerilyawan Gerakan Aceh Merdeka (GAM) ini bercerita kembali, ketika meninggalkan pendidikannya untuk bergabung dengan kombatan lainnya di hutan Aceh Utara. Sekitar tahun 1997, putra mantan Komandan Koramil Kuta Makmur ini mendapat beasiswa ikut pendidikan di Cijantung, Jawa Timur. Namun

Waspada/Zainal Abidin

MISBAHUL Munir menjamu para wartawan di kamar kerjanya, Selasa (24/1). kesempatan untuk ikut pendidikan formal di luar daerah ditinggalkannya. Dia memilih bergabung bersama para pemuda dari daerahnya untuk menentang sisa ketidakadilan masa Orde Baru. Selama bergabung dengan pasukan gerilyawan, hariharinya dihabiskan mengikuti berbagai strategi perang. Posisi terakhir, dia diangkat sebagai Komandan Pasukan Cobra untuk memimpin para anggota GAM di hutan Kuta Makmur. “Saya tidak menyesal meninggalkan kesempatan belajar melalui beasiswa di luar daerah,” tegasnya sambil menghirup kopi yang masih mengepulkan asap. Di atas tempat dia duduk, tampak bergantung lambang Burung Garuda yang diapit foto Presiden Susilo Bambang Yudhoyono dan wakilnya. Setiap kali mengambil keputusan berat, Rahul mengaku

tidak pernah merasa salah. Sama dengan ketika dia memilih mendaftar sebagai balon Bupati Aceh Utara melalui jalur independen. Namun dia menyesali, niat baiknya ikut Pilkada salah diartikan rekan-rekan dari Partai Aceh. “Padahal, saya mendaftar karena tidak ada mantan GAM yang ikut Pilkada Aceh ketika itu,” jelasnya. Sampai menjelang akhir penutupan pendaftaran tahap dua, calon dari mantan GAM tidak mendaftar di KIP Aceh Utara. Akhirnya, dia memutuskan mendaftar. Akan tetapi, Rahul berjanji dalam Pilkada nanti tidak akan bersaing dengan calon dari PA. “Saya akan mundur setelah masalah regulasi selesai dan PA mendaftar,” kalimat itu kembali diulanginya. Kalimat tersebut juga pernah diucapkan ketika dia mendaftar. “Lima hari setelah saya mendaftar, langsung datang surat pemecatan,” kata Misbahul. Ternyata, niat baiknya tidak mendapat respon positif. Karena merasa tidak dihargai, akhirnya pria yang baru saja menyelesaikan pendidikan di Fakultas Teknik Unimal Lhokseumawe ini memutuskan melanjutkan ikut pilkada melalui jalur perseorangan. Dengan merangkul wakil dari persatuan para geusyik (kepala desa) se-Aceh Utara dia melangkah maju menuju kursi Bupati Aceh Utara. “Besok saya akan menjadi rakyat biasa, bukan Wakil Ketua DPRK Aceh Utara lagi,” ucap Misbahul Munir. Zainal Abidin

Ragam

A8

WASPADA Jumat 27 Januari 2012

Lemahnya Matahari Tidak Akan Tunda Pemanasan Global MELEMAHNYA matahari dalam kurun waktu 90 tahun ke depan tidak akan menunda naiknya suhu bumi secara global yang disebabkan gas rumah kaca, demikian menurut satu hasil penelitian. Laporan dari Kantor Meteorologi Inggeris dan Universitas Reading menyatakan, produksi matahari akan berkurang sampai tahun 2100, namun fenomena ini hanya menyebabkan turunnya suhu bumi sekitar 0,08 derajat Celsius. Para ilmuwan telah mengingatkan bahwa cuaca lebih ekstrim akan terjadi di seluruh penjuru bumi pada abad ini seiring dengan iklim Bumi yang menghangat. Dunia diperkirakan malah akan bertambah panas sampai lebih 2 derajat Celsius pada abad ini akibat meningkatnya emisi gas rumah kaca. Janji para pemimpin dunia untuk mengurangi kadar karbon dioksida (CO2) dan emisi gas rumah kaca lainnya dianggap tidak cukup untuk menghentikan pemanasan planet ini melebihi 2 derajat, ambang ba-

tas yang menurut para ilmuwan menimbulkan resiko terjadinya iklim yang tidak stabil yang menyebabkan cuaca ekstrim semakin sering terjadi. “Penelitian tersebut menunjukkan perubahan produksi matahari tidak akan menimbulkan dampak besar pada suhu bumi global atau berperan untuk memperlambat pemanasan global yang disebabkan gas rumah kaca,” kata Gareth Jones, ahli deteksi perubahan iklim di Met Office. “Penting untuk ditekankan penelitian ini dilakukan berdasarkan model iklim tunggal, bukan model yang beragam yang akan menunjukkan hasil kurang pasti dalam system iklim,” tambahnya. Selama abad 20, aktivitas matahari meningkat ke level maksimum dan penelitian terakhir menunjukkan level akti-

vitas ini telah mencapai atau mendekati akhir. Para ilmuwan memanfaatkan level maksimum tersebut sebagai titik awal untuk memproyeksikan kemungkinan perubahan dalam aktivitas matahari pada abad ini. Penelitian ini juga menunjukkan, jika produksi matahari di bawah ambang batas yang dicapai antara tahun 1645 dan 1715 – disebut Maunder Minimum ketika aktivitas matahari berada pada level observasi terendah – suhu global akan menurun 0,13 derajat Celsius. “Skenario yang paling mungkin terjadi adalah kita akan menyaksikan pengurangan secara menyeluruh aktivitas matahari dibanding ke abad 20, seperti produksi matahari menurun sampai pada nilai Dalton Minimum (sekitar tahun 1820),” kata Mike Lockwood, pakar peneliti matahari di Universitas Reading. “Kemungkinan aktivitas matahari menurun sampai serendah Maunder Minimum – atau kembali ke aktivitas tinggi abad 20 – sekitar 8 persen.”

SOLAR FLARES MATAHARI GELOMBANG Medan magnet Bumi melindungi dari angin panas matahari, menciptakan gelembung memutar yang harus diikuti angin panas itu

Matahari Sebagian besar terbuat dari hidrogen, sangat panas hingga kandungan gasnya berbentuk plasma Kromosfer Korona

Gelombang Alfven Gelombang magnet kuat yang pada dasarnya dapat mentransfer energi dari permukaan matahari menuju angin panas

Bumi

Permukaan Matahari ANGIN PANAS Gelombang terus menerus dari gas alektrik yang mengalir dari matahari ke semua penjuru

Syafri/reuters

Gangguan satelit, arus daya, dan komunikasi di Bumi

Kecepatan: 400 km/s Temperatur: 1 juta derajat Celsius

TERBENTUKNYA PANCARAN SINAR MATAHARI Arah rotasi

Jalur medan magnet

1

Great Horned Beetle (coprophanaeus Lancifer) merupakan spesies kumbang terbesar di kawasan Neotropis dan ditemukan di pedalaman hutan Suriname.

Spesies Baru Ditemukan Di Hutan Amerika Selatan SPESIES baru ikan lele ditemukan di satu sungai di dalam hutan Amerika Selatan punya cara unggul untuk menghindar jadi santapan ikan piranha raksasa. Bukan dengan berkamuflase, tapi tubuhikaninidipenuhidengan tulang berduri untuk membuat keder para pemangsa. Diberi julukan ‘lele lapis baja’, ikan tersebut termasuk satu dari 46 spesies yang menurut para peneliti merupakan spesies baru bagi komunitas ilmiah, menurut satu laporan baru dari Conservation International. Dalam tiga proyek di tahun 2010, para ilmuwan dibantu penduduk asli dari desa di sebelah baratdaya Suriname untuk mendokumentasikan hampir 1.300 spesies di sepanjang Sungai Kutari dan Sipaliwini yang mengalir di salah satu hutan paling sulit dimasuki di dunia. Bersama lele lapis baja (yang terselamatkan dari menjadi santapan makan siang salah seorang juru pandu para ilmuwan), seekor katak pohon besar, delapan ekor ikan air segar dan puluhan serangga baru juga ditemukan. Spesies lain yang ditemukan dan diperkirakan termasuk unik di wilayah itu, termasuk ‘Great Horned Beetle’, seekor kumbang berwarna biru yang ukurannya sebesar

jeruk keprok, dan ‘Pac-Man Frog’, katak yang memiliki mulut selebar tubuhnya. “Wilayah tersebut merupakan surga bagi ahli entomologi (ilmu tentang hewan khusus serangga) karena serangga spektakuler dan unik ada di manamana,” kata Dr. Leeanne Alonso, dari Global Wildlife Conservation, yang juga bagian dari tim peneliti. “Saya bahkan tidak perlu mencari semut karena semutsemut tersebut melompat ke arah saya. Ilmuwan lain sama terkesannya dengan beragam unggas dan mamalia yang menakjubkan yang ada di kawasan itu. Anda bisa berada sangat dekat dengan hewan-hewan liar di sini – satu kamera berhasil merekam seekor jaguar yang berada ratusan kaki dari kemah mereka.” Penelitian tersebut meru-

pakan bagian dari Conservation International Rapid Assessment Program (RAP) yang ditujukan untuk mencatat beragam hayati dan mempromosikan konservasi (penangkaran) di seluruh dunia. Dr. Trond Larsen, direktur RAP mengatakan “Sebagai seorang ilmuwan, adalah hal yang sangat menantang dan menyenangkan mempelajari hutan terpencil di mana ditemukan spesies-spesies baru, terutama karena kami meyakini perlu melindungi lanskap ini agar tetap asli sehingga memberi peluang terbesar untuk mempertahankan beragam hayati yang pentingbagi dunia dan ekosistem yang dibutuhkan manusia bagi kehidupan beberapa generasi mendatang.” Syafri/CNN

LELE lapis baja yang ditemukan di Sungai Sipalwini di Suriname.

KATAK Pac-Man adalah predator yang bersifat diam dan menunggu. Dia bisa menelan tikus dan katak lainnya.

Jalur medan magnet bergerak dari selatan ke utara diantara dua kutub

Titik kritis

2

Injeksi massa Korona Lompatan korona

3

Rotasi menyebabkan jalur medan magnet meregang, apalagi di equator yang berputar lebih cepat dibanding daerah kutub

4

Jalur ini menjadi terpuntir, beberapa diantaranya akan pecah di permukaan untuk membentuk lompatan

Saat lompatan berkembang melewati titik kritis, maka ia akan meledak menjauh dari matahari, membentuk badai matahari

Zona Eksklusif Fukushima Jadi Kota Hantu

INILAH satu set topeng kematian Stalin.

Topeng Kematian Stalin Dilelang TOPENG kematian diktator Uni Soviet, Josef Stalin dile-lang di Inggris pada Selasa (24/1). Harga awal bagi satu set cetakan perunggu topeng wajah Stalin dan kedua tangannya berkisar antara tiga ribu hingga lima ribu poundsterling yang setara dengan 4.600 hingga 7.700 dolar AS, kata pernyataan rumah lelang asal Inggris Mullock’s dalam lamannya. “Hal itu merupakan upaya terdekat untuk memiliki Stalin di ruang keluarga anda,” kata pakar dokumen sejarah rumah lelang tersebut, Richard WestwoodBrooks seperti dikutip Daily Mail. Cetakan tersebut merupakan sejumlah salinan yang didapat dari gips asli yang diambil setelah wafatnya Stalin pada 1953. Sejumlah penjelasan dari Mullock’s mengatakan terdapat 12 salinan cetakan itu, namun Daily Mail melaporkan Westwood-Brooks hanya memiliki sebanyak sembilan. Sebanyak dua salinan dibawa ke Barat pada 1990 oleh pengumpul seni James Birch sebagai orang pertama yang berhasil menembus pasar seni yang muncul dari negara Tirai Besi itu. Cetakan gipsum yang asli masih dipajang di Museum Stalin di tempat asalnya Gori, Georgia. Topeng kematian perunggu Stalin pernah dijual di Sotheby pada 1999 dengan harga awal 1.000 hingga 1500 poundsterling, demikian lapor laman Newstatement pada saat itu. Stalin wafat pada usia 74 tahun setelah lebih dari dua dasawarsa memimpin Uni Soviet. Penyebab resmi kematian Stalin adalah karena pendarahan di selaput otak namun teori lain menduga Stalin wafat akibat diracun oleh rekannya. Penjualan itu bukanlah kerjaan pertama Mullock’s yang menjual benda kenangan dari diktator yang telah wafat. Pada 2009 dan 2010, rumah lelang itu menyediakan dua set lukisan akuarel Adolf Hitler untuk dijual. (ant)

BERIKUT adalah cerita dari Kyung Lah untuk CNN tentang kondisi zona ekslusif di Fukushima. Bila Anda ingin melewati jalan menuju zona eksklusif Fukushima, di jalan masuknya Anda akan bertemu dengan enam orang polisi yang menjaga kawasan itu dan spanduk besar dihiasi lampu merah. Spanduk itu bertuliskan “Menjauhlah. Jangan Masuk’. Inilah zona eksklusif Jepang. Tidak ada denyut kehidupan di sana, tempat di mana 78.000 orang pernah tinggal. Hampir setahun setelah bencana gempa bumi dan tsunami menyebabkan reaktor nuklir Fukushima Daiichi mengalami kebocoran, zona eksklusif tersebut masih tetap tidak boleh dimasuki karena tingginya pencemaran radioaktif dari reaktor nuklir tersebut. Salah satu kota yang masuk zona ekslusif tersebut adalah kota Tomioka, satu komunitas pertanian dan pabrik yang terletak di selatan zona eksklusif. Kota tersebut pernah dihuni 52.000 orang. Sepanjang kami berjalan memasuki pusat kota itu, sulit kami bayangkan kalau kota ini pernah didiami banyak orang. Itulah yang pertama kali terlintas dalam benak ketika memasuki zona eksklusif tersebut – Anda tidak akan bertemu manusia. Meskipun Anda tahu bahwa penduduk di sana telah dievakuasi, namun perasaan aneh tetap muncul di kota di mana sepertinya manusia lenyap begitu saja. Sejumlah sepeda terlihat tergeletak begitu saja, seolah-olah pemiliknya lupa untuk mengambilnya

kembali. Mobil-mobil masih terduduk di satu pusat perbelanjaan, sepertinya tengah menunggu untuk diisi barang belanjaan. Kota ini layaknya kota hantu, dan waktu membeku bersamanya. Tanda-tanda kehidupan hanya ditemukan pada binatang ternak yang berseliweran di kawasan itu. Kami mendatangi beberapa ekor lembu yang tengah menyantap rumput di satu bukit. Hewan mamalia tersebut menatap kami yang mendekat, namun kemudian kembali menikmati rerumputan. Kami berada di kawasan pertanian yang telah dirambah rerumputan. “Saya membawa dua alat pengukur radiasi, satu untuk mengukur radiasi di kawasan itu dan satu lagi untuk mengukur akumulasi tubuh saya. Alat pengukur radiasi kawasan langsung bergerak naik ketika kami melewati jalan masuk, meskipun saya tidak mendekatkan alat tersebut ke permukaan yang terkontaminasi, yang diharapkan penduduk di

sana akan segera bebas dari pencemaran dalam beberapa tahun.” “Dari hasil pengukuran, radiasi dari reaktor nuklir tersebut lebih besar menutupi kawasan bagian utara reaktor tersebut. Tomioka yang berada di ujung selatan zona eksklusif, terkontaminasi radiasi dengan level lebih rendah dibanding kota di bagian utara dan baratlaut reaktor tersebut. Namun, dengan kadar radiasi lebih rendah bukan berarti aman untuk berlama-lama di sana. Kami berhenti di satu kawasan pemukiman untuk mengukur kadar radiasi. Di jalanan, terbaca kadar radiasi 0,042 millisievert per jam, 10 kali lipat dari sinar x yang Anda terima ketika periksa gigi. Sebenarnya jumlah tersebut tidak masalah besar karena kami berada di sana sebentar saja dan kami mengenakan baju pelindung. Namun, bila Anda tinggal di sana, maka Anda akan menghapi resiko kesehatan jangka panjang, khususnya bagi anak-anak. Syafri

KYUNG LAH saat berada di zona ekslusif Fukushima yang menjelma jadi kota hantu. /CNN

WASPADA Jumat 27 Januari 2012

Luar Negeri

A9

Dua Tewas, Tujuh Cedera Dalam Serangan Roket Di Afghanistan

Papua Nugini Hadapi Pemberontakan Militer

KABUL, Afghanistan (Antara/Xinhua-OANA): Dua warga sipil tewas dan tujuh lainnya terluka ketika dua roket ditembakkan oleh gerilyawan Taliban menghantam sebuah rumah di Provinsi Kapisa, Afghanistan. “Seorangibubersamadengananaknyaberumurtigatahuntewas dan tujuh anggota keluarga yang sama terluka pada saat dua roket ditembakkan oleh musuh-musuh perdamaian dan menghantam rumah mereka di Kabupaten Alasay, Provinsi Kapisa, pagi ini,” kata Kementerian Dalam Negeri dalam satu siaran pers Rabu (25/1). Insiden itu terjadi sekitar pukul 11:30 waktu setempat Rabu, kata siaran itu dan menambahkan bahwa semua korban luka dibawa ke rumahsakitolehpolisiAfghanistantaklamasetelahseranganitu.Siaran pers menyalahkan gerilyawan Taliban atas serangan itu. Sebanyak 1.462 warga sipil Afghanistan telah tewas pada paruh pertama tahun 2011 yang menunjukkan kenaikan 15 persen dalam kematian non-tempur dibandingkan dengan periode yang sama tahun 2010, menurut laporan pertengahan tahun PBB yang dikeluarkan di Kabul pada Juli, 2011. Laporan mencatat 80 persen kematian warga sipil dalam enam bulan pertama 2011 disebabkan serangan gerilyawan Taliban dan kelompok bersenjata lainnya yang menentang pemerintah Afghanistan, namun klaim ditolak oleh Taliban sebagai tak berdasar. Sekitar 14 persen kematian lainnya dikaitkan dengan pasukan Afghanistan dan asing yang dipimpin NATO sedangkan enam persen sisanya tidak disebutkan dalam laporan.

CANBERRA, Australia (Antara/Xinhua-OANA): Satu kelompok tentara di Papua Nugini (PNG) menangkap panglima pasukan pertahanan di negeri itu, demikian laporan Australian Broadcasting Corporation (ABC), Kamis (26/1). Satu sumber senior pasukan pertahanan PNG mengatakan kepada ABCNews sekelompokantara12dan20prajuritmenaklukkan penjaga di barak Taurama di Port Moresby, PNG, sekitar pukul 03:00 waktu setempat Kamis. Kelompok itu menawan perwira yang menjadi panglima, lalu bergerak ke barak Murray dan mengenakan tahanan tahanan rumah atas panglima pasukan pertahanan, Jend. Francis Agwi. Menurut ABC News sebagaimana dikutip Xinhua tidak jelas apakah peristiwa tersebut berkaitan dengan konflik antara Peter O’Neill dan Sir Michael Somare mengenai jabatan perdana menteri di negeri itu. Sir Michael digulingkan sebagai perdana menteri dan diganti oleh O’Neill Agustus 2010, setelah kursinya dinyatakan kosong selama dia menjalani perawatan medis di Singapura. Pada Desember, Mahkamah Agung PNG memerintahkan pengangkatan kembali Sir Michael sebagai perdana menteri dan anggota parlemen. Tapi meskipun ada instruksi tersebut, O’Neill tetap menjadi perdana menteri de fakto dengan dukungan pegawai pemerintah, polisi, pasukan pertahanan dan sebagian besar anggota parlemen. Pertengahan Januari, terjadi kegaduhan di parlemen, ketika Sir Michael memasuki gedung parlemen untuk melaksanakan instruksi Mahkamah Agung dan menuntut pengangkatan kembali dirinya.Dia diperingatkan oleh O’Neill bahwa ia dapat ditangkap jika ia mengulangi perbuatannya.

Pasukan Syria Gempur Pinggiran Kota Damaskus BEIRUT, Lebanon (AP): Para aktivis mengatakan pasukan Syria menggempur satu kawasan pinggoran Damaskus yang padat penduduk, kawasan yang ditinggalkan pasukan pemerintah awal pekan ini, setelah terjadi bentrokan sengit dengan para pejuang. Aktivis dan penduduk setempat Mohammed al-Saeed mengatakan ribuan pasukan, sebagian besaR mengenakan pakaian sipil, menyebar ke berbagai arah di seluruh kawasan Douma Kamis (26/1) pagi, tanpa menghadapi perlawanan. Syrian Observatory for Human Rights yang bermarkas di London mengatakan ‘satu pasukan besar’ memasuki Douma. Pasukan rezim sebelumnya meninggalkan Douma Minggu menyusul bentrokan dengan tentara pembelot. Douma telah menjadi saksi terjadinya aksi protes keras terhadap rezim Presiden Bashar Assad tidak lama setelah pergolakan terjadi di negeri itu Maret lalu. Satu penumpasan terhadap pemrotes telah menewaskan lebih dari 5.400 orang, demikian menurut PBB. Revolusi Syria telah tumbuh dengan terjadinya pembelotan dari beberapa kekuatan militer dalam beberapa bulan terakhir. (m10)

Pesawat Tempur Iran Jatuh Di Selatan, Dua Pilot Tewas TEHERAN, Iran (AP): Kantor berita setengah resmi Iran Fars mengatakan satu pesawat tempur F-16 Iran buatan AS jatuh di provinsi Bushehr di Iran Selatan. Gubernur provinsi Mohammad Hossein Jahanbakhsh mengatakan dua pilot yang mengemudikan pesawat yang jatuh Kamis (26/1) itu tewas. Fars melaporkan pesawat tempur itu jatuh karena mengalami gangguan teknis dan pihak berwenang telah menemukan reruntuhannya di luar Bushehr, satu kota pelabuhan yang bernama sama dengan provinsinya. Bushehr dikenal sebagai satu lokasi pembangkit nuklir pertama Iran. Iran telah membeli banyak pesawat buatan AS, termasuk F-14 sebelum meletusnya Revolusi Islam 1979 dan pada saat Iran masih dikuasai oleh Shah Mohammad Reza Pahlavi yang pro-Barat. (m10)

Iran: Ancaman Obama ‘Propaganda’ TEHERAN,Iran(Antara/Xinhua-OANA):JurubicaraKementerian Luar Negeri Iran Ramin Mehmanparast mengatakan bahwa ancaman Presiden AS Barack Obama untuk menggunakan kekuatan militer terhadap Iran atas program nuklir damainya hanya dimaksudkan untuk propaganda, kata televisi satelit lokal Press. Mehmanparast mengatakan pernyataan Obama dalam pidato tahunan State of the Union adalah bagian dari kampanye pemilu menjelang pemilihan presiden Amerika Serikat mendatang. Pernyataan permusuhan Presiden AS terhadap Iran itu berusaha untuk menutupikegagalankepresidenannyadenganmengalihkanperhatian kepada Iran, kata Mehmanparast. Selasa, Presiden AS Barack Obama berjanji untuk menggunakan semua pilihan yang mungkin untuk menghentikan upaya Iran dalam mengembangkan senjata nuklir, namun tidak menutup kemungkinan penyelesaian damai. “Biarlah ada keraguan: Amerika bertekad untuk mencegah Iran mendapatkan senjata nuklir, dan saya tidak akan mengambil pilihan selain meja (perundingan) untuk mencapai tujuan itu,” kata Obama dalam pidato State of the Union di depan Kongres.

PM Australia ‘Terbirit-birit’ Diserbu Para Demonstran CANBERRA, Australia (Waspada): PM Australia Julia Gillard dan pemimpin oposisiTony Abbott terpaksa harus dikawal puluhan polisi untuk keluar dari sebuah restoran di ibukota Canberra Kamis (26/1). Pasalnya, restoran tersebut dikepung oleh ratusan demonstran anti Abbott. Seperti diberitakan BBC Kamis, Gillard dan Abbott saat itu sedang menghadiri upacara penganugera-han National Emergency Medals di restoran Lobby. Lalu sekitar 200 demonstran dari Aboriginal Tent Embassy datang mengepung sambil memukuli jendela restoran dari luar, meneriakkan kata-kata ‘memalukan’ dan ‘rasis.’ Para demonstran disinyalir marah akibat pernyataan Abbott di sebuah siaran televisi nasional beberapa waktu sebelumnya. Dia mengatakan kini saatnya pemerintah Australia mengabaikan keberadaan Aboriginal Tent Embassy dan melanjutkan rancangan konstitusi yang mengakui masyarakat pribumi. Untuk menghindari amuk massa, Gillard dan Abbott harus dikawal oleh sekitar 50 orang polisi, keluar dari restoran. Sebelumnya, mereka harus menunggu selama 20 menit sampai pasukan polisi datang. Dalam adegan penyelamatan tersebut, Gillard sempat tersandung saat tubuhnya ditarik oleh pengawal pribadinya. Akibatnya, dia kehilangan sebelah sepatunya. Demonstran tidak berhenti sampai disitu. Mereka memukuli mobil Gillard dan Abbott hingga kendaraan itu melaju.(vn)

Reuters

ASAP mengepul di angkasa dari satu ledakan bom mobil bunuhdiri di provinsi Helmand, Afghanistan, Kamis (26/1). Empat warga

sipil Afghanistan tewas dan 31 lainnya cedera, termasuk di antaranya tiga warga asing, dalam serangan bom mobil Kamis yang ditujukan pada satu kantor bantuan di kota Lashkar Gah, di selatan provinsi Helmand, kata Dawood Ahmadi, seorang jurubicara gubernuran.

AS Ingin Militernya Hadir Lagi Di Filipina MANILA, Filipina (Waspada): Filipina disinyalir tengah berunding dengan AS terkait rencana Washington untuk menempatkan kembali militernya di negara Asia Tenggara itu. Namun, pemerintah Filipina tidak mau membenarkan spekulasi yang sudah beredar di media massa itu. Menurut harian The Washington Post edisi Kamis (26/1), seperti yang dikutip Reuters, sudah ada perundingan tahap awal antara AS dan Filipina menyangkut kerjasama militer yang lebih luas. Perundingan ini kemungkinan membicarakan rencana kehadiran kembali pangkalan AS

di Filipina. Media Amerika itu menyebutkan bahwa akan ada lagi perundingan bilateral pada 26-27 Januari 2012 di Washington DC. Setelah itu akan digelar pertemuandenganmelibatkanpejabat yang lebih tinggi dari kedua negara pada Maret mendatang. “Kita bisa libatkan negaranegara lain: Australia, Jepang, Singapura,” tulis koran itu dengan mengutip seorang pejabat senior Filipina, yang tidak disebutkan namanya. “Kami bukan satu-satunya pihak yang menerapkan langkahini,danuntuktujuanyang baik. Kami hanya ingin kawasan yang damai dan stabil. Tidak ada yang ingin berhadapan dengan Chinaatauberkonfrontasidengan China,” lanjut pejabat itu. Dalam beberapa bulan terakhir, AS sudah menyatakan keinginan untuk memperkuat militernya di Asia Pasifik. Berbagai

rencana pun telah digulirkan, yaitu mengirim 2.500 pasukan Marinir secara bertahap ke Australia bagian utara dan menempatkan kapal-kapal perang di Singapura. Kendatitidakdinyatakansecara resmi,langkahASinidiyakiniuntuk membendung manuver China, yang memperkuat kemampuan militernyadalambeberapadekade terakhir.Apala-gi,Chinabelakangan ini berseteru dengan sejumlah negaramenyangkutklaimteritorial diLautChinaSelatan,yangmenjadi salah satu perairan strategis bagi perdagangan dunia. Bantahan Filipina Sementara itu, jurubicara Departemen Pertahanan Filipina PeterPaulGalvezmenepisspekulasi mengenai kehadiran kembali pangkalan militer AS di negaranya. Galvez menyatakan bahwa perundingan kedua negara saat ini tidak lebih dari memperkuat kerjasama latihan militer, yang

terselenggara setiap tahun. “Perundingan itu membicarakansoalpeningkatkanfrekuensi latihan. Jadi pokoknya adalah frekuensi. Latihan ini akan menguntungkanpasukankamiuntukmenambah pengetahuan, teknikteknikbarumemerangiterorisme, antiperompakan,danbagaimana mempelajariperalatanbaru,”kata Galvez kepada Reuters. Selama sekitar 40 tahun sejak berakhirnyaPerangDuniaKedua, ASmemilikiduapangkalanmiliter di Filipina, yaitu Clark dan Subic. Namun pada awal 1990-an AS mengosongkan pangkalan itu. Seorang panglima militer yang menjaga keamanan di kawasan barat Filipina pernah menyatakan bahwa kian besarnya kehadiranmiliterASdiLautChina Selatan akan meningkatkan keamanan. Filipina pun berseteru dengan China soal klaim batas maritim di perairan itu. (vn)

Obama Terlibat Konflik Dengan Gubernur Arizona WASHINGTON (Waspada): Presiden AS Barack Obama dan Gubernur Arizona Jan Brewer terlibat ketegangan di landasan pacu negara bagian tersebut. Dalam sebuah foto, terlihat Brewer menunjuk batang hidung Obama, menunjukkan kemarahan. Menurut Reuters, peristiwa yang terjadi Rabu (25/1) itu dimulaisaatObamamengomentari tulisanBrewerpadabukunyayang berjudul Scorpions for Breakfast: My Fight Against Special Interests, LiberalMediaandCynicalPoliticos toSecureAmerica’sBorder.Menurut Obama,Brewersalahpahamdalam menggambarkan pertemuan keduanya di Gedung Putih dua tahun lalu. “Dia sedikit terganggu dengan buku saya. Saya bilang saya menyesal jika dia merasa seperti itu,” kata Brewer kepada wartawan. Adegan ketegangan keduanya berhasil ditangkap oleh kamera sebuah media internasional. Dalam gambar, Brewer terlihat menunjuk Obama yang sedikit menunduk.

The Associated Press

PM AUSTRALIA Julia Gillard (kedua dari kiri) memeluk seorang petugas, yang terdiri dari pengawal pribadi dan polisi, yang melindunginya menghadapi para pemrotes ketika berlangsung satu upacara yang menandai Hari Nasional Australia di Canberra, Australia, Kamis (26/1). Kira-kira 200 pendukung pembela hak masyarakat asli mengepung satu restoran dan menggedor-gedor jendelanya Kamis pada saat Gillard dan pemimpin oposisi Tony Abbot berada di dalamnya.

Obama dan Brewer memang terlibat ketidaksepahaman soal undang-undangimigrasiArizona. Dalam bukunya, Brewer menceritakan soal pertemuannya denganObamadiGedungPutihuntuk membicarakan undang-undang tersebut. Melaluitulisan,BrewermembantahucapanGedungPutihyang mengatakan pertemuan itu berlangsung baik dan lancar. Brewer menuliskan, pertemuan itu hanyalah basa-basi. Dalam perte-

muan, kata Brewer, Obama lebih terlihat menggurui dan merendahkan dirinya. Brewer juga mengomentari keamanan Gedung Putih yang menurutnya berlebihan. Ketika memasuki Gedung Putih untuk menuju Ruang Oval, ponsel dan kamera milik Brewer dan stafnya disita pasukan keamanan. Seteru keduanya dimulai saat Brewer menandatangani undang-undang kontroversial soal imigran ilegal di Arizona 2010 lalu.

Undang-undang tersebut menyerukan polisi di Arizona untuk menyelidiki status imigrasi setiap orang yang dicurigai sebagai pendatang ilegal. Obama mengatakan bahwa undang-undangitutelahsalaharah. Diamengatakan,undang-undang imigrasiArizonaakanmemicukonflikrasial.NamunBrewerbersikeras halituperludilakukanuntukmencegah imigran gelap menyabot pekerjaanrakyatASditengahkrisis ekonomi sekarang ini.(vn)

Gedung Bertingkat Ambruk Di Rio De Janeiro, Sejumlah Tewas RIO DE JANEIRO, Brazil (AP): Satu gedung bertingkat banyak ambruk di pusat kota Rio de Janeiro, Brazil, Rabu malam, yang menyebabkan reruntuhannya menyebar ke satu kawasan luas namunmembingungkantentang angka kemungkinan korban tewas dan sebab terjadinya peristiwa itu. Debu tebal dari reruntuhan gedungtersebutmenutupsejumlah mobil dan sepedamotor. Satu tetangganya mengalami kerusakanseriusakibatkejadiantersebut dan televisi menunjukkan sekurang-kurangnya dua orang di atas atap bangunan tampaknya menunggu bantuan dari regu pemadam kebakaran. Ada laporan yang saling bertentangan tentang kemungkinan kematian.Seorangjurubicaradari Departemen Pertahanan Sipil mengatakanduaorangdipastikan mati, namun para pejabat dari Balaikota dan departemen kesehatan kemudian mengatakan tidak ada korban tewas sampai Kamis (26/1) dinihari. Tidak jelas berapa angka korban cedera. Regu pertolongan terus melakukan pencarian korban di tengah reruntuhan beberapa jam setelah terjadi ambruk. Tercium bau gas alam yang keras di kawasan itu, namun walikota Rio mengatakan diragukan terjadinya kebocoran gas akibat kejadian

itu.

“Tampaknya tidak ada ledakan. Keruntuhan itu disebabkan kerusakan struktur,” katanya. “Saya kira tidak ada kebocoran gas.” Saksimata melaporkan tentangpendengaranmerekaadanya

Perundingan Palestina-Israel Berakhir Tanpa Kemajuan RAMALLAH, Palestina (Antara/Reuters): Pembicaraan Palestina-Israel yang bertujuan menghidupkan kembali perundingan perdamaian berakhir di Jordania pada Rabu (25/1) tanpa mencapai kemajuan.Presiden Mahmoud Abbas berencana berkonsultasi dengan pemimpin lain Arab mengenai tindakannya selanjutnya, kata beberapa pejabat Palestina. Pilihan yang sedang dipertimbangkan oleh Palestina meliputi upaya menggolkan keanggotaan PBB dan perujukan dengan kelompok pesaingnya, HAMAS —tindakan yang ditentang oleh Israel. “Israel tak membawa sesuatu yang baru dalam pertemuan ini,” kata seorang pejabat Palestina yang dekat dengan pembicaraan tersebut, demikian laporan Reuters. “Kami sekarang sedang mempertimbangkan pilihan kami dan akan berkonsultasi dengan saudara kami di Liga Arab pada 4 Februari.” Pembicaraan itu dilakukan sebagai bagian dari usul penengah Kuartet Timur Tengah —Amerika Serikat, Uni Eropa, Rusia dan PBB— yang pada Oktober lalu menetapkan tenggat tiga-bulan bagi kedua pihak untuk mengajukan usul mengenai masalah wilayah dan keamanan. Tujuannya ialah untuk mencapai kesepakatan perdamaian paling lambat pada akhir tahun ini. Kepala Kebijakan Luar Negeri Uni Eropa Catherine Ashton sedang melakukan kunjungan regional guna mendorong para pejabat Israel dan Palestina agar mempertahankan pembicaraan tersebut, yang dimulai pada Januari.

Perompak Somalia Tebas Tangan Kapten Kapal MOGADISHU, Somalia (Waspada): Bajak laut Somalia mulai menerapkan cara kekerasan demi memperoleh uang tebusan yang mereka inginkan. Salah satu korbannya adalah seorang kapten kapal Vietnam yang kehilangan tangannya, ditebas parang perompak. Menurut harian Daily Mail Rabu (25/1), aksi sadis ini dilancarkan oleh para perompak di Haradhere, Somalia, Jumat pekan lalu. Kapten kapal nelayan FV Shiuh Fu-1, Chao-I Wu, kehilangan tangan kanannya setelah permintaan tebusan sebesar AS$3 juta (Rp26,8 miliar) tidak dipenuhi oleh keluarga korban dan perusahaan pemilik kapal. Lalu, para perompak memerintahkan para awak kapal yang lain untuk menelepon keluarga mereka. Langkah ini diambil para perompak agar keluarga sandera mengetahui perihal amputasi ta-ngan sang kapten. “Mereka lalu memohon sambil menangis kepada keluarga untuk membayar tebusan. Jika pemilik kapal dan keluarga sandera tidak membayar uang yang kami minta, maka kami akan melukai awak yang lain,” kata salah seorang perompak. HarianVietnam Tuoi Tre me-nuliskan seorang awak kapal bernama Tran Van Hung menelefon ayahnya dan mengatakan bahwa dia melihat adegan pemotongan tangan kapten tersebut. Para pe-rompak juga memukulinya dan para awak lainnya. Taktik baru mereka ini dimulai saat seorang turis Prancis, Marie Dedieu, 66, tewas setelah diculik perompak Somalia di pulau Manda, Kenya, Oktober lalu. Suami seorang warga negara Inggris, Judith Tebbutt, 56, juga tewas ketika perompak menyerang mereka di Kiwayu, Kenya. Hingga saat ini, Tebbutt masih berada di tangan para perompak. Wartawan diculik Sementara itu, seorang warga asing yang diculik pada akhir pekan di Somalia Tengah adalah wartawan dan penulis AS, kata organisasi hak asasi dan lingkungan regional. Kelompok perompak Somalia Sabtu menculik Michael Scott Moore — yang juga dikabarkan memiliki kewargane-garaan Jerman — di jalan menuju bandara Galkayo dan memba-wanya ke sebuah hutan terpencil, kata Ecoterra International. “Negosiasi sesepuh Somalia dalam kasus penyanderaan penulis AS Michael Scott Moore... belum berhasil membebaskan sandera,” kata Ecoterra dalam sebuah pernyataan. Moore ditahan bersama dua sandera dari Israel dan Seychelles yang ditangkap dari sebuah kapal motor berbendera Seychelles yang dibajak, katanya.(vn)

suara keras bagai letusan beberapa saat sebelum gedung itu jatuh dan bau keras gas tercium di kawasan tersebut. Polisi segera menutupkawasanitukarenakhawatir akan menimbulkan korban lain. (m10)

Pemberontak Lancarkan Pengeboman Di Irak, 10 Tewas BAGHDAD, Irak (AP): Para pemberontak melancarkan pemboman ke satu rumah milik dua polisi dan keluarga mereka di Irak pusat Kamis (26/1) pagi, menewaskan 10 orang yang berada di dalam rumah tersebut dalam serangan nekat terbaru, kata para pejabat. Rumah tersebut di mana dua bersaudara yang bertugas sebagai polisi tinggal terletak di kawasan Hamia, sekitar 50 km di selatan Baghdad, kata polisi. Rumah tersebut rata dengan tanah setelah pemberontak meledakkan bom yang mereka tanam di sana pada pukul 1:00 dini hari. Kedua polisi itu, dua anak berusia di bawah satu tahun dan empat wanita termasuk sebagai korban tewas, tambahnya. Seorang dokter di rumahsakit terdekat membenarkan jumlah korban tewas. Dalam pesan audio yang disiarkan Rabu, seorang jubir Negara Islam Irak-nya Al-Qaida yang menyebut dirinya Abu Mohammed al-Adnani mengatakan, meskipun pasukan AS telah meninggalkan Irak “tentara kami masih ada dan jumlah bertambah dari hari ke hari’. Al-Qaida merupakan musuh utama AS di Irak. Pasukan militan tersebut dituding sebagai pihak di belakang sejumlah serangan mematikan terhadap tentara AS, pasukan keamanan Irak dan lembaga pemerintah dukungan AS. Al-Adnani mengklaim, AS menarik mundur pasukannya dari Irak karena perekonomiannya runtuh dan negaranya perlu menghemat uang. Sementara itu, dia mengatakan tentara sucinya, atau ‘Mujahidin memegang kepemimpinan’ dan bisa ‘menyerang dan muncul kapan saja’.(m23)

Reuters

DIKELILINGI PENGAWAL PRIBADI. PM Thailand Yingluck Shinawatra (tengah), yang dikelilingi sejumlah pengawal pribadi, berjabatan tangan dengan rekan sejawatnya dari India, Manmohan Singh (kedua dari kiri), sementara Presiden India Pratibha Patil (ketiga dari kanan) menyaksikan parade Hari Republik India di New Delhi, Kamis (26/1). Shinawatra berada di India untuk melakukan kunjungan tiga hari dan dia merupakan tamu istimewa Hari Republik India ke-63 Kamis.

Sport

A10

WASPADA Jumat 27 Januari 2012

Final Aneh Bagi Bellamy Singkirkan Citizens Jumpa Cardiff

AP

PAHLAWAN Liverpool Craig Bellamy berlari merayakan golnya ke gawang Manchester City di Anfield Stadium, Kamis (26/1) dinihari WIB.

Madrid Salahkan Wasit MADRID (Waspada): Real Madrid menyalahkan keputusan wasit Fernando Teixeira sebagai penyebab mereka tersingkir di babak perempatfinal Copa del Rey. Melalui entrenador Jose Mourinho dan kapten Iker Casillas, Madrid mengklaim mestinya mereka mampu menaklukkan Barcelona pada leg kedua. Namun keberpihakan wasit kepada tim tuan rumah di Camp Nou, Rabu (KamisWIB), membuat El Real hanya bisa meraih hasil 2-2. Pemuncak klasemen La Liga itu akhirnya tersingkir dengan agregat 3-4, setelah kalah 1-2 pada leg pertama di Santiago Bernabeu, 18 Januari lalu. “Teixeira, sekarang kamu bisa merayakan (kemenangan) dengan klub itu. Bila kita bertemu dengannya, kita selalu tidak berdaya,” sesal Casillas melalui Marca, Kamis (26/1). “Saat saya mencoba memisahkan pemain (yang bersitegang) saya malah mendapatkan kartu kuning. Padahal, saya bermaksud membantu dirinya melerai pemain,” keluh kiper Los Blancos dan Timnas Spanyol tersebut. Selain kartu kuning tersebut, Casillas menjadikan kartu merah Sergio Ramos dan gol

Hasil Rabu (Kamis WIB) Barcelona vs Real Madrid Barca lolos agregat Mallorca vs Ath Bilbao Bilbao lolos agregat

2-2 4-3 0-1 3-0

Hasil Selasa (Rabu WIB) Mirandes vs Espanyol Mirandes lolos agregat

AP

BEK Real Madrid Sergio Ramos dan pelatih Jose Mourinho (kanan) memprotes wasit Fernando Teixeira di Stadion Camp Nou, Barcelona, Kamis (26/1) pagi WIB. Madrid yang dianulir sebagai sasaran serangannya terhadap wasit Teixeira. “Real Madrid tetap bangga dengan skuad ini. Kami telah tersisih, sekarang saatnya bagi kami untuk kembali fokus pada dua kompetisi (La Liga dan Liga Champions) yang menunggu di depan,” pungkas Casillas. Setelah kalah 1-2 di kandang sendiri pekan lalu, Madrid sepertinya bakal menjadi bulanbulanan gol El Barca di Camp Nou. Apalagi saat memasuki

rehat, Kleber Pepe cs sudah tertinggal 0-1 akibat gol Pedro Rodriguez menit 43 dan Daniel Alves menit 45. Tapi strategi Mourinho memasukkan Esteban Granero, Karim Benzema dan Jose Callejon untuk menggantikan Lassana Diarra, Gonzalo Higuain dan Ricardo Kaka, langsung menuai hasil di babak kedua. Cristiano Ronaldo mempertipis kekalahan dengan golnya menit 68. Hanya berselang empat menit, Benzema menya-

makan kedudukan sekaligus membuat suhu laga menjadi sangat memanas. Gol Sergio Ramos dianulir wasit, bek Spanyol itu juga diusir karena mendapat kartu kuning kedua. “Saya dengar di ruang ganti bahwa mustahil bisa menang di sini (Camp Nou),” sindir Mourinho, seperti dikutip dari Goal. “Saya bermain di sini bersama Chelsea, Inter (Milan) dan dengan Real Madrid di Liga Champions. Situasi seperti ini

2-1 4-4

sudah biasa bagi saya,” pungkas pelatih asal Portugal itu. Mourinho yang memasuki usia ke-49 pada 26 Januari 2012, akhirnya menerima kado kekalahan dari lawatan pasukannya. Nasib dia beda dengan playmaker Barca Xavi Hernandez, yang malam itu genap berumur 32 tahun. “Kami menderita lebih dari yang kami bayangkan melawan sebuah tim super, sekalipun kami mendominasi hingga 15 menit babak kedua,” ucap Xavi. “Setelah gol Madrid, tim menjadi tidak terhubung dan kehilangan kontrol. Beruntung, suporter bersama kami dan mosaik yang mereka perlihatkan di awal tampil lagi dalam bentuk yang spektakuler,” ujarnya lagi. Khusus mengenai wasit yang menjadi kambing hitam kekalahan Madrid, gelandang Spanyol itu enggan berkomentar. “Isu wasit adalah relatif. Ketika kamu menyelesaikan laga, kamu pikir dia merugikan kamu,” dalihnya. “Madrid juga berpikir seperti itu. Saya pikir wasit bertindak cukup adil,” katanya menambahkan. (m15/afp/marca/goal)

Mourinho Langgar Perintah Mainkan Pepe MADRID (Waspada): Jose Mourinho kembali menunjukkan sikap kontroversialnya ketika menentukan formasi pemainnya melawan Barcelona pada leg kedua perempatfinal Copa del Rey di Camp Nou. Menurut TribalFootball, Kamis (26/1), Mourinho sebenarnya dilarang petinggi Madrid untuk memainkan Pepe. Sebab bek Portugal itu bakal rawan, setelah menerima banyak kecaman akibat menginjak tangan Lionel Messi pada leg perBOMBER Barcelona Lionel Messi (kanan) bentrok lagi dengan bek Madrid Kleber Pepe di Camp Nou. -AP-

tama di Santiago Bernabeu, 18 Januari lalu. Namun Mourinho melanggar perintah dan dikabarkan sempat bersitegang dengan para petinggi Los Blancos. Entrenador asal Portugal itu berkeras memainkan Pepe, yang kemudian mendapat cemoohan dari fans El Barca. Saat menguasai bola dalam laga yang berakhir 2-2 itu, Pepe selalu mendapat teriakan “Asesino” alias “Pembunuh.” Barcelonista juga kompak bersorak “Pisalo” atau “Injak” ketika Pepe dilanggar anggota pasukan Pep Guardiola. Salah satunya dari Messi di penghujung babak pertama.

Momen Mengesankan Guinea Khatulistiwa B A T A , Guinea Khatulistiwa ( Waspada): Guinea Khatulistiwa membukukan momen mengesankan di Piala Afrika 2012, Rabu (KamisWIB), ketika mengalahkan Senegal 2-1 untuk maju ke babak perempatfinal. Tembakan jarak jauh yang dilancarkan bek David Alvarez pada menit akhir, membuat Guinea Khatulistiwa naik ke puncak klasemen Grup A. Para pendukung tim negara kecil itu pun larut dalam pesta merayakan kemenangan pasukan Gilson Paulo. Iban Iyanga, dikenal para penggemarnya dengan nama Randy, membuka keunggulan tim tuan rumah menit 62 pada matchday 2 Grup A tersebut. Senegal mencetak gol balasan menit 89 melalui Moussa Sow, sehingga laga sepertinya akan berakhir seimbang.

2 2 2 2

2 1 0 0

0 1 1 0

0 0 1 2

3-1 4-3 2-3 2-4

1 1 0 0

0 0 0 0

0 0 1 1

2-1 1-0 1-2 0-1

6 4 1 0 3 3 0 0

Klasemen Grup C Gabon Tunisia Moroko Niger

1 1 1 1

1 1 0 0

0 0 0 0

0 0 1 1

2-0 2-1 1-2 0-2

3 3 0 0

Klasemen Grup D Mali Ghana Botswana Guinea

1 1 1 1

1 1 0 0

0 0 0 0

0 0 1 1

1-0 1-0 0-1 0-1

3 3 0 0

Namun Alvarez melakukan gerakan spektakuler dari luar kotak penalti ketika injury time sudah berlangsung empat

AP

STRIKER Napoli Edinson Cavani (atas) melewati hadangan kiper Inter Milan Luca Castellazzi di San Paolo Stadium, Naples, Kamis (26/1) dinihari WIB.

Inter Minta Keadilan Dua Penalti Cavani Loloskan Napoli ROMA (Waspada): Allenatore Inter Milan Claudio Ranieri, meminta keadilan setelah timnya dipecundangi Napoli 2-0 lewat dua gol penalti yang diborong striker Edinson Cavani pada babak perempatfinal Coppa Italia. Ranieri mengklaim, I Nerazzurri pun pantas mendapatkan hadiah penalti saat Diego Milito dilanggar Christian Maggio di dalam kotak terlarang I Partenopei. “Seharusnya ada dua tim dapat penalti. Tapi malah hanya satu yang diberikan oleh wasit dan itu lah yang menentukan hasil duel ini,” sindir Ranieri melalui Football Italia, Kamis (26/1). “Tidak hanya penalty, seharusnya Maggio juga dikeluarkan dari lapangan sebagai pemain yang telah melanggar Milito,” tambah mantan pelatih Juventus, Chelsea dan Valencia tersebut. Seusai laga di Stadion San Paolo, Rabu (Kamis WIB) tersebut, Ranieri pun langsung menjumpai wasit Domenico Celi untuk meminta keadilan bagi skuadnya. “Benar, saya telah menemui wasit usai laga dan melakukan pembicaraan dengannya mengenai pendapat saya. Hal itu sangat disayangkan, karena kami sudah bermain sangat baik terutama di babak kedua,” beber Ranieri. Mendengar komentar tersebut, pelatih Napoli Walter Mazzarri spontan membalasnya. “Ranieri pelatih yang saya kagumi dan hormati. Tetapi apabila dirinya berkata seperti itu, seha-

Hasil Rabu (Kamis WIB) Napoli vs Inter Milan Chievo Verona vs Siena

2-0 0-1

Hasil Selasa (Rabu WIB) Juventus vs AS Roma

3-0

rusnya dia mengerti kalau dua pemainnya layak diusir dari lapangan,” tegasnya. “Wesley Sneijder seharusnya diganjar kartu merah saat melanggar Walter Gargano dengan sangat keras. Cristian Chivu juga layak diberikan kartu kuning kedua. Jadi saya rasa tim yang pantas diberi penalti pada laga malam ini adalah Napoli,” klaim Mazzarri. Kemenangan tim tuan rumah dibuka dengan gol penalti Cavani menit 50, setelah bomber Uruguay itu dilanggar Thiago Motta di kotak terlarang La Beneamata. Cavani menyarangkan gol keduanya juga melalui tendangan 12 pas usai dijatuhkan kiper Inter Luca Castellazzi menit 93. “Inter Milan sedang dalam performa terbaiknya saat ini.Tetapi seluruh pemain yang kami miliki adalah pemain pilihan pertama, yang saya rasa sangat hebat semuanya,” sanjung Mazzarri. Napoli dengan demikian sukses menghentikan tujuh kemenangan beruntun pasukan Ranieri di seluruh kompetisi sekaligus menyingkirkan sang juara bertahan di arena tersebut. Partenopei selanjutnya menjajal Siena pada semifinal 19 Februari mendatang. (m15/fi/tf)

Rutin Gelar Turnamen Catur

Klasemen Grup B Angola 1 Pantai Gading 1 Burkina Faso 1 Sudan 1

pada partai puncak, 26 Februari mendatang, karena hanya menjajal Cardiff, yang notabene berkompetisi di divisi Championship. Reds pun sangat potensial mengakhiri puasa gelar, setelah kali terakhir menjuarai Piala FA 2006. Semua itu tak terlepas dari andil Bellamy, striker kelahiran 13 Juli 1979 yang mencetak gol penyeimbang kedudukan ke gawang Citizens menit 73. City lebih dulu unggul lewat gol Nigel De Jong menit 30, namun kapten Steven Gerrard mampu memaksakan skor 1-1 saat memasuki rehat dengan golnya dari titik putih menit 41. Tim tamu asuhan Roberto Mancini memulihkan keunggulannya melalui gol Edin Dzeko menit 66. Tapi hanya tujuh menit berselang, segera disamakan lagi oleh Bellamy. Pantas jika segala pujian menghampiri pemain buangan The Eastlands itu, termasuk dari Mancini. “ Tentu saja saya kecewa karena kami tidak mencapai final. Tapi saya bahagia untuk Craig,” tuturnya. “Perbedaan apa yang dibuat jika Bellamy mencetak gol atau Gerrard mencetak gol. Saya berkata halo padanya sebelum laga, sehingga tidak perlu lagi mengucapkan semoga Anda beruntung setelahnya,” tambah pelatih asal Italia itu dalam ESPN. Bahkan bagi Kenny Dalglish, manajer Liverpool, aksi penyelamatan Bellamy dijadikannya sebagai bahan sindiran bagi Citizens. “Jika Manchester City masih punya pemain lain yang kelihatannya tidak ingin mereka pertahankan, mereka tahu kami ada di mana,” ledeknya. “Dia sangat luar biasa. Dia sudah seperti itu ketika datang ke klub dan sangat fantastis bisa memiliki seorang pemain seperti dia di sini,” sanjung Dalglish. Gerrard sebagai maskot Merah juga tak ketinggalan memuji striker yang suka pindah klub tersebut. “Craig Bellamy yang membuat kita beda dalam laga ini,” katanya melalui Sky Sports. “Kecepatannya selalu mengancam (lawan). Ketika dia mendapatkan kesempatan, kita tahu bahwa dirinya akan bisa menyelesai-kannya dengan bagus,” pujinya lagi. *Jonny Ramadhan Silalahi

Hashim DjojohadikusumoApresiasi Waspada

Klasemen Grup A Guinea Khatu Zambia Libya Senegal

Pepe yang tampak tidak terima dengan perlakuan pendukung tim tuan rumah, sempat memberikan ‘perlawanan’. Saat menuju ruang ganti, Pepe tertangkap kamera mencium kostum Madrid di hadapan fans Barca. “Kami menunjukkan semangat Madridista yang sebenarnya, semangat dari sebuah grup yang hebat,” klaim mantan bek FC Porto berusia 28 tahun tersebut. “Malam ini kami jauh lebih superior dibanding Barca. Kami bangga dengan apa yang kami lakukan dan apa yang kami punya. Para fans juga bangga,” tambah Pepe. (m15/goal/tf)

BOMBER bengal Craig Bellamy merasa aneh akan menjajal klub kota kelahirannya, Cardiff City, setelah dirinya membawa Liverpool menembus final Carling Cup 2011/2012. “Kemarin malam saya melihat Cardiff melaju dan saya turut bahagia bersama mereka,” beber Bellamy, seperti dilansir Reuters, Kamis (26/1). Penyerang veteran Wales berusia 32 tahun itu menghabiskan musim lalu bersama Cardiff dengan status sebagai pemain pinjaman dari Manchester City. Dia merupakan bintang utama The Reds ketika menyingkirkan The City pada semifinal dengan agregat 3-2. Golnya pada laga leg kedua semifinal di Stadion Anfield, Rabu (Kamis WIB), membuat skor menjadi 2-2. Citizens pun tersingkir karena sudah kalah 0-1 pada leg pertama di Etihad Stadium. Kini Bellamy mesti menghadapi mantan lagi, bahkan Cardiff City lebih spesial karena dia dilahirkan di ibukota Wales tersebut. “Itu tidak dapat menjadi final yang lebih baik bagi saya. Terasa lucu melihat kerja sepakbola saat ini. Tetapi untuk mendapatkan partai final merupakan hal besar bagi kami,” tutur mantan striker Newcastle itu. Tentu saja, karena Si Merah tak pernah mencapai final di StadionWembley dalam kurun waktu 16 tahun terakhir. Kisah petualangan terakhir The Anfield Gank di stadion kebanggaan Inggris itu terjadi pada final Piala FA 1996, saat mereka dikalahkan Manchester United 0-1. Kini anak asuh Kenny Dalglish itu menjadi favorit

AP

BINTANG kemenangan Guinea Khatulistiwa David Alvarez (2 kiri) merayakan golnya ke gawang Senegal dengan menaiki tubuh pelatih Gilson Paulo di Bata Stadium, Kamis (26/1) dinihari WIB. menit. Tendangannya melahirkan kemenangan amat menentukan bagi Guinea Khatulistiwa, yang pertama kali menembus babak delapan besar. Sedangkan Senegal yang kalah mengejutkan atas Zambia pada laga pembuka, dipastikan tersingkir. Padahal, Demba Ba

cs 108 tingkat peringkatnya di atas Alvarez dan kawan-kawan. Zambia berpeluang mendampingi Guinea Khatulistiwa yang menjadi tuan rumah bersama Gabon, setelah pada penampilan keduanya bermain 2-2 dengan Libya. (m15/rtr/espn)

MEDAN (Waspada): Harian Waspada secara konsisten ikut berperan dalam mengembangkan olahraga catur di Sumatera Utara. Hal itu diwujudkan dengan penyelenggaraan turnamen catur Waspada Cup yang sudah menjadi agenda rutin. “Saya mengucapkan terimakasih kepada Harian Waspada. Diharapkan, akan lahir atlet catur kelas nasional melalui turnamen Waspada Cup,” kata Ketua Umum Pengurus Besar Persatuan Catur Indonesia (PB Percasi) Hashim Djojohadikusumo. Didampingi GM Utut Adianto, Hashim memberikan apresiasi tersebut ketika menerima audensi Ketua Pengprov Percasi Sumut Parlindungan Purba SH MM di Jakarta, Kamis (26/1). Pada kesempatan itu, Parlindungan menyeWaspada/ist rahkan undangan kepada Hashim Djojohadi- KETUA Umum PB Percasi Hashim Djojohadikusumo (kanan) didampingi kusumo untuk membuka turnamen catur GM Utut Adianto (kanan) ketika menerima audensi Ketua Pengprov Percasi Waspada Cup yang akan dilaksanakan di Medan Sumut Parlindungan Purba, SH, MM di Jakarta, Kamis (26/1). pada 28 Februari - 3 Maret 2012. Menurut Parlindungan, catur Waspada Cup dibagi atas tiga handal dari Sumatera Utara. Turnamen ini juga sebagai perkategori, yakni kelas eksekutif dengan harapan diikuti Plt. Gubsu, siapan Pengprov Percasi Sumut menghadapi Pekan Olahraga Bupati/Wali Kota, Kapoldasu, Pangdam, Kajati, Ketua KONI Sumut, Nasional (PON) 2012 di Provinsi Riau,” ujar Parlindungan. para pengusaha, tokoh masyarakat, anggota legislatif dan Waspada Cup akan diikuti beberapa tim dari luar Provinsi sebagainya. Sumatera Utara. “Pada penyelenggaraan tahun 2011, Waspada Kemudian kelas khusus wartawan sekaligus seleksi bagi atlet Cup diikuti 270 peserta dari Sumatera Utara, Sumatera Barat, catur PWI Sumut untuk Porwanas 2013. Sedangkan kelas bagi Riau, Jambi, Aceh, Kepulauan Riau dan Jakarta. Tahun ini peserta umum bakal menjadi ajang pemanasan bagi para pecatur diharapkan akan diikuti 500 peserta dari berbagai daerah karena sebelum turun di PON 2012 Riau. akan menjadi pemanasan sebelum PON 2012,” papar “Diharapkan melalui turnamen ini akan lahir bibit pecatur Parlindungan. (m25)

Sport

WASPADA Jumat 27 Januari 2012

A11

Lanud Medan Siapkan Pengamanan Waspada Drag Race & Drag Bike 2012 MEDAN (Waspada): Pangkalan Angkatan Udara (Lanud) Medan mendukung penuh event Waspada Drag Race & Drag Bike 2012, termasuk memberikan izin penggunaan Sirkuit Lanud Medan sebagai ajang balapan mobil dan motor, Minggu (29/1) nanti.

Waspada/Hamdani

KETUA Panitia Waspada Drag Race & Drag Bike 2012, Hang Tuah Jasa Said (kiri), bersama perwakilan dari Lanud Medan Kapten Kal Asri Andi Dhalimunthe (2 kiri) dan sejumlah panitia lainnya meninjau lokasi Sirkuit Lanud Medan, Kamis (26/1).

PSMS Vs Persela Akhirnya Ditunda SURABAYA (Waspada): Badan Liga Indonesia (BLI) akhirnya menunda laga PSMS Medan versus Persela Lamongan dalam lanjutan Indonesian Super League (ISL) yang seharusnya berlangsung di Stadion Lamongan, Minggu (29/1) nanti. Menurut Manajer Tim PSMS, Drs Benny Tomasoa, di Surabaya, Kamis (26/1), BLI via faximile, Rabu (25/1) malam, telah menginformasikan penundaan tersebut. Isi faximile itu menegaskan kalau stadion milik Gresik United sebagai pengganti stadion di Lamongan, tidak diizinkan oleh pihak pengelola untuk digunakan. “Begitu juga dengan stadion pilihan lainnya di Manahan Solo. Stadion itu akan dipakai untuk pertandingan Persis di kompetisi IPL. Sedangkan stadion Mojokerto yang diusulkan Persela ditolak BLI karena tidak memiliki lampu. Apalagi laga away keempat PSMS ini berlangsung malam dan diliput ANTV (live),” beber Benny. Atas penundaan itu, lanjut Benny, kita me-

minta tanggungjawab BLI untuk memberikan ganti rugi atas dana transportasi dan penginapan selama berada di Surabaya. “BLI akhirnya bersedia memberikan ganti rugi. Karena sudah ada kesepatan seperti itu, kita pun siap dan menerima keputusan BLI,” ucap Benny. Seperti diberitakan sebelumnya, Stadion Lamongan kondisinya sangat tidak memungkinkan untuk menggelar pertandingan. Lapangan yang terus diguyur hujan menjadi berlumpur sehingga tim akan sulit mengembangkan permainan. Atas penundaan itu, skuad Ayam Kinan selanjutnya langsung bertolak dari Surabaya ke Jakarta, Kamis (26/1) pukul 14.30. Dari Jakarta, tim PSMS menuju Medan pukul 19.00. “Setibanya di Medan, tim akan menjalani persiapan guna menghadapi Gresik United di Stadion Teladan pada 2 Februari mendatang,” sebut pelatih PSMS, Raja Isa. (m17)

PSSB Pilih Pelatih Chile BANDA ACEH (Waspada): Tim Divisi Utama PSSB Bireuen terus memburu peracik taktik anyar untuk membesut Muarrif dkk. Dari sejumlah kandidat, pilihan jatuh pada sosok John Castro Caballero. Jika tak ada kesepakatan, maka pelatih lokal kembali diincar. Manajer Tim PSSB Bireuen, Aziz Fandila didampingi Wakil Manajer Rasyidin, Kamis (26/1), mengatakan untuk mengangkat performa Laskar Bate Kureng di kancah Divisi Utama, klub membutuhkan pelatih kepala. Kata dia, sejumlah nama yang lepas dari incaran, antara lain mantan pelatih Timnas U23 Rahmad Darmawan. RD lebih memilih klub Liga Super Indonesia, Pelita Jaya. PSSB juga gagal mendapatkan pelatih asal Chile, Miguel Angel Arrue Padila. “Miguel masih terikat kontrak dengan klubnya di Peru. Tapi secara pribadi dia setuju saja. Apalagi dia juga pernah melatih anak-anak ketika di Paraguay,” sebut pria yang akrab disapa Aziz Bengkel ini. Selepas itu, lanjut dia, manajemen kembali melirik pelatih asing yang juga pernah mendidik Faumi Syahreza dkk di Paraguay selama enam bulan. Dia adalah John Castro Caballero, pelatih asal Chile. “Kalau tidak salah saya, selama anak-anak ditangani Castro, dari 14-16 laga, hanya satu kali kalah saat ujicoba,” tambah mantan guru pembimbing 30 pesepakbola muda Aceh di Paraguay, Nasruddin Ali SPd. Tekait dengan posisi Castro, Aziz mengatakan hal itu akan diputuskan oleh Gubernur Aceh, Irwandi Yusuf. “Kita tunggu gubernur. Saat ini John Castro sudah ada di Banda Aceh,” tukas Azis. Ditambahkan, saat ini pemain asal Nigeria, Olisa Godstime Michael, yang perposisi bek, sedang mengikuti seleksi di PSSB. “Untuk mengangkat prestasi tim, kita memang membutuh-

Waspada/ist

JOHN Castro Caballero (kiri) foto dengan guru pendamping tim Aceh di Paraguay, Nasruddin Ali. kan setidaknya tiga pemain asing untuk posisi belakang, tengah, dan depan,” ujarnya. Jalwandi dkk yang bersaing di Grup I Divisi Utama Liga Prima Indonesia Sportindo (LPIS) musim 2011/2012, masih terpuruk di papan bawah. “Untuk perekrutan semua pemain asing itu akan diputuskan pelatih kepala nanti,” pungkas Azis. (b07)

Problem Catur

TTS TOPIK

Jawaban di halaman A2 8

7

6

5

4

3

2

1 B

C

D

E

tidak ada masalah. Kita ucapkan terima kasih atas dukungan pihak Lanud Medan yang telah memberikan izin penggunaan sirkuit, termasuk pengamanan yang akan diberikan,” ucap Hang Tuah. Event Waspada Drag Race & Drag Bike 2012 merupakan rangkaian acara HUT Waspada Ke-65. Rencanya, event yang baru pertama kali diadakan salah satu surat kabar tertua di Sumut itu akan menjadi agenda rutin. “Kita berharap event yang pertama ini dapat berjan sukses, sehingga rencana untuk menggelar kegiatan secara rutin bisa terwujud. Kita juga ucapkan terimakasih kepada pihak-pihak yang telah mendukung kegiatan ini,” demikian Hang Tuah. 200 Peserta Mendaftar Sekretaris Panitia Waspada Drag Race & Drag Bike 2012, Erwinsyah, mengatakan hingga Kamis (26/1) sore, sudah sekira 200 peserta mendaftar di Sekretariat BarSpeed Jl Kenanga Raya PasarVI Setia Budi Medan. “Animo peserta cukup tinggi, namun begitu, kita masih membuka pendaftaran hingga Jumat (27/1) ini. Sedangkan, Sabtu (28/1), akan dilakukan proses scrutineering bagi seluruh kenderaan peserta lomba,” demikian Erwinsyah. (m42)

Klub Harus Lahirkan Atlet Berprestasi Pengurus Ikas Shooting Club Dilantik BANDA ACEH (Waspada): Ketua Umum Pengurus Provinsi Persatuan Menembak dan Berburu Seluruh Indonesia (Pengprov Perbakin) Aceh, Iskandar Hasan, mengharapkan klub-klub yang ada di provinsi itu mampu melahirkan atlet-atlet berprestasi. Pernyataan itu disampaikan dalam sambutannya usai melantik pengurus Ikas Shooting Club (ISC) di Ballroom Sulthan Hotel Banda Aceh, Rabu (25/1) malam. Menurut dia, apa yang diharapkan memang tidaklah semudah membalik telapak tangan. Tapi kalau pengurus klub mau bekerja keras dan membina anggotanya, bukan tidak mungkin akan melahirkan atlet yang bisa diandalkan. Kapolda Aceh ini juga mengharapkan pengurus klub segera menjalankan program kerja setelah dilantik. Berbuat yang terbaik untuk memajukan organisasi dan anggota, sehingga tidak menjadi pajangan semata sampai masa jabatannya berakhir. “Pengurus klub harus bertanggungjawab membina atlet. Jadi, saya ingatkan ISC jangan sekadar menjadi wadah tempat berkumpul, tetapi harus menunjukkan kinerjanya dengan melahirkan atlet andal,” pinta Iskandar. Wakil Ketua KONI Aceh, Maulisman Hanafiah, mengharapkan Perbakin Aceh mampu membina klubklub, sehingga lebih termotivasi untuk memunculkan atlet berprestasi. Apalagi Perbakin mampu meloloskan sejumlah atlet memperkuat kontingen Aceh di PON XVIII/2012 Riau, September mendatang. “Infrastruktur olahraga menembak seperti lapangan tembak juga perlu dibenahi dan diperbanyak. Apalagi lapangan tembak representatif di Aceh tidak begitu banyak. Begitu juga dengan masalah persenjataan, harus memadai. KONI Aceh memang pernah membantu pengadaan senjata. Namun kami tidak mengetahui kondisi senjata tersebut sekarang,” katanya. Ketua Umum ISC, PP Andry Agung, mengatakan klub yang dipimpinnya bertekad menyumbangkan atlet-atlet yang mampu memperkuat kontingen Aceh di berbagai kejuaraan, baik nasional maupun internasional. “Walau ISC baru terbentuk sejak awal Januari 2012, namun kami suidah siap melahirkan atlet berprestasi yang akan mengharumkan nama Aceh di pentas olahraga menembak tingkat nasional maupun internasional,” katanya. (b04)

F

G

H

Waspada/Hamdani

CALON peserta Waspada Drag Race & Drag Bike 2012 mendaftar di Sekretariat BarSpeed Jl Kenanga Raya Pasar VI Setia Budi Medan, Kamis (26/1). Hingga kemarin, jumlah peserta yang mendaftar sudah mencapai 200 orang.

Gus Irawan Cs Tekad Tampil Menghibur Tidak Mau Terpancing KONI Asahan MEDAN (Waspada): Kesebelasan KONI Sumut dengan kapten H Gus Irawan Pasaribu, bertekad menampilkan permainan menghibur ketika meladeni tantangan KONI Asahan di Stadion Mutiara Kisaran, 30 Januari mendatang. “Kita tetap upayakan tampil menarik untuk menghibur para penonton di Kisaran. Kita tak mau terpancing, kendati KONI Asahan sudah ‘menabuh genderang perang’ bakal mengganjal kita,” jelas Gus Irawan di Medan, Kamis (26/1). Sebelumnya, pemain KONI Asahan M Saleh Malawat sudah menyatakan timnya tidak akan memberikan ruang, terutama bagi bomber KONI Sumut itu untuk memasuki benteng pertahanan mereka. Laga eksibisi di Kisaran tersebut digelar sebagai rangkaian acara pelantikan pengurus KONI Asahan periode 2011-2015 diketuai Nurkarim Nehe. Gus Irawan menilai, perang urat saraf jelang pertandingan memang sudah biasa, meskipun bertajuk laga eksibisi. “Itu juga menunjukkan keseriusan tim KONI Asahan untuk memenangkan pertandingan. Namun kami juga siap meladeninya sekaligus memburu kemenangan dengan permainan

1. Nama pertempuran antara pasukan muslim versus pasukan Romawi Timur tahun 636. 3. ____ bin Walid, panglima pasukan muslim dalam pertempuran diatas, dikenal sebagai saifullah (pedang Allah). 5. Nama kaisar Roma pada pertempuran diatas, kepada siapa Rasulullah pernah mengirim surat untuk memintanya agar masuk Islam. 6. Buya _____, ulama besar, pernah menjadi Ketua MUI Pusat. 8. Deretan; Rangkaian nama-nama mereka yang terpercaya meriwayatkan hadis. 9. Nama istri Nabi Muhammad, menyimpan naskah kumpulan Al Quran asli Panitia Zaid. 10. Pemimpin. 12. Zat tanduk tipis pada ujung jari kaki dan tangan, disunatkan dipotong hari Jumat. 13. Nama populer Romawi Timur dalam sejarah perang diatas (No. 1 Mendatar) beribukota Constantinople. 17. Wakil (pengganti Nabi Muhammad setelah wafat). 18. Perbuatan baik yang mendatangkan pahala. 19. Singkatan Majelis Ulama

menarik dan menghibur,” tukas Dirut PT Bank Sumut tersebut. Ditambahkan, pihaknya akan membawa tim terbaik dari unsur pengurus KONI Sumut ke Kisaran. Selain Gus dan Ketua Harian John Lubis, timnya nanti diperkuat mantan pemain Persiraja H Sakiruddin dan mantan PSMS Junior Basyaruddin Daulay. “Wakil Ketua II Prof Dr Agung Sunarno dan Wakil Ketua III M Syahrir juga sudah biasa tampil di hadapan ribuan penonton. Jadi tim kami nantinya tidak akan grogi untuk menyajikan aksi menarik di Stadion Mutiara,” klaim Gus Irawan. Menurut Sekum KONI Sumut Chairul Azmi, penampilan dan perjuangan timnya untuk melawan Nurkarim Nehe cs juga bakal didukung pengurus Siwo PWI Sumut sebagai badan fungsional KONI Sumut. “Siwo sebagai bagian dari kami, kabarnya siap menyumbangkan lima pemain dipimpin Monang Panggabean. Jadi dari segi persiapan dan kelengkapan pemain, KONI Sumut tidak ada masalah,” ucap Chairul. “Kalau KONI Sumut menang, itu sudah wajar. Tapi kalau KONI Asahan yang menang, tentu luar biasa,” canda Prof Agung Sunarno. (m42)

Waspada/Arianda Tanjung

KETUA KONI Sumut H Gus Irawan Pasaribu (kanan) tak mau terpancing dengan gertakan pemain KONI Asahan.

PS PiJay Impikan Divisi Utama MEUREUDU (Waspada): Setelah sukses merebut tiket promosi ke Divisi I Liga Amatir Indonesia musim 2010/2011 lalu, kini PS PiJay (Pidie Jaya) dituntut segera mematangkan persiapan menghadapi kompetisi kasta ketiga Indonesia yang dijadwalkan berlangsung mulai 25 Feburuari mendatang. “Sebagai tim promosi, kita berharap PS PiJay mampu berprestasi. Jangan sampai malah justru prestasinya menurun hingga akhirnya terdegradasi ke Divisi II lagi,” ucap pendukung PS PiJay, Mukhtar, Kamis (26/1). Dikatakan, segala persiapan harus maksimal, baik dari segi tim maupun pendanaan. Dengan begitu, diharapkan prestasi PS PiJay dapat meningkat, seperti halnya impian masyarakat agar

MIMBAR JUMAT Mendatar

Putih melangkah, mematikan lawannya dua langkah.

A

“Kita juga siapkan pengamanan untuk mencegah terjadinya hal-hal yang tidak diinginkan. Terlebih arena acara merupakan wilayah ring satu,” ujar Kasi Ops Lats Lanud Medan Mayor Tek Aris Subekti, yang dalam hal ini mewakili Dan Lanud Medan Kolonel PNB Abdul Rasyid Jauhari, Kamis (26/1). Dijelaskan, untuk mengamankan acara, pihaknya akan menyiapkan sekira 60 personil anggota TNI AU. Begitu pun, Aris tetap berharap kerjasama dengan panitia dan peserta kejuaraan untuk saling menjaga ketertiban. “Pada prinsipnya, Sirkuit Lanud Medan selalu terbuka untuk kegiatan-kegitan yang positif. Terlebih acara ini dapat mendukung pembinaan atlet balap Sumut, sekaligus mencegah aksi balapan liar di jalan raya,” tambah Mayor Aris yang turut didampingi Kapten Kal Asri Andi Dhalimunthe. Sebelumnya, Ketua Panitia Waspada Drag Race & Drag Bike 2012, Hang Tuah Jasa Said, pihak Lanud yang diwakili Kapten Asri Andi Dhalimunthe, Koordinator Lapangan dari BarSpeed Medan Edwin Nasution dan sejumlah panitia lainnya telah meninjau langsung lokasi Sirkuit Lanud Medan. “Alhamdulillah, masalah izin sirkuit sudah rampung dan

Indonesia. 20. Tidak haram. 21. Surat Al Quran yang dibaca pada saat kemalangan. 23. Binatang yang disebut dalam surat Al Ghasiyah ayat 17. 24. Semoga Allah mengasihinya, mengampuninya.

Menurun

1. Kaum yang berondok dan diberitahukan oleh batu yang berbicara menjelang kiamat. 2. Guru agama; Ahli agama. 3. Buah larangan yang dimakan Adam dan Hawa. 4. Kota pusat kekhalifan Umayyah. 7. Ucapan syukur kepada Allah. 9. Kebijaksanaan (dari Allah). 11. Ja’iz; Tidak berdosa dan tidak pula berpahala bila dilakukan. 14. Pedang Nabi Muhammad yang dirampasnya dari tangan musuh dalam perang Badar. 15. Sifat khusus untuk menunjukkan adanya Allah dan hanya ada pada Allah; Mentalitas. 16. Tulus hati; Al-_____ surat al Quran dimulai dengan kata qul. 18. Sejenis burung yang menyerang pasukan Abrahah. 19. Tempat bermalam, melempar jumrah dan menyembelih kurban. 22. Nabi yang anaknya bernama Sam.

tim ini promosi ke Divisi Utama Liga Indonesia. “Kita tahu animo masyarakat begitu besar dalam mendukung PS PiJay. Terlebih setelah tim mampu prmosi ke Divisi I. Apalagi jika nantinya sukses menembus level kompetisi professional,” demikian Mukhtar. Menanggapi hal itu, Ketua Umum PS PiJay, HM Gade Salam mengaku dirinya bersama jajaran pengurus sudah berkomitmen untuk terus memajukan PS PiJay. “Kami para pengurus juga akan berupaya maksimal membawa PS PiJay menembus level Divisi Utama Liga Indonesia. Namun tentu semuanya butuh perjuangan dan kita sangat mengharapkan dukungan semua pihak,” ucap Bupati Pidie Jaya itu. (b09)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

6 9 2 9 2 1 3 5 7 2 1 3 9 6 4 7 4 9 5 3 2 9 6 1 7

4

3

*****16

Sport

A12

WASPADA Jumat 27 Januari 2012

Azarenka Lega Atasi Clijsters MELBOURNE, Australia (Waspada): Victoria Azarenka berhasil melaju ke final Australian Terbuka 2012, setelah memupus ambisi juara bertahan Kim Clijsters (Belgia) 6-4, 1-6, 6-3. Atas hasil ini, Azarenka merasa lega, bahkan sempat ingin menangis.

AP

Bukti Nadal Hantu Bagi Federer MELBOURNE (Waspada): Rafael Nadal (foto) sekali lagi membuktikan kalau dirinya menjadi ‘hantu’ bagi Roger Federer pada ajang Grand Slam. Pada semifinal Australia Terbuka di Melbourne, Kamis (26/1), Nadal mampu menahan permainan pembuka yang tajam dari petenis Swiss itu untuk mencapai babak final Australia Terbuka. Petenis Spanyol itu menang 6-7 (5/7), 6-2, 7-6 (7/5), 6-4, sehingga memperpanjang penderitaan pesaing beratnya tersebut. Federer yang telah menelan delapan kekalahan dari Nadal dari sepuluh pertemuan di ajang Grand Slam, tidak pernah mampu mengalahkannya sejak Wimbledon 2007. Pemilik gelar juara 16 Grand Slam itu dikalahkan Nadal pada final lima set di Australia Terbuka 2009. Federer tetap tak

mampu melakukan balas dendam di bawah sorotan lampu Rod Laver Arena. Pada final Minggu (29/1), Nadal yang telah memenangi 10 gelar Grand Slam bakal menantang juara bertahan Novak Djokovic atau petenis Inggris Raya Andy Murray. Djokovic mengaku tidak memiliki ruang sentimen pada Murray, yang dihadapinya pada semifinal, Jumat (27/1) ini. Di final 2011, Djokovic mengandaskan permainan Murray dengan kemenangan tiga set langsung. Dia mendominasi sepanjang musim, tidak terkalahkan sampai Juni dan memenangi dua ajang besar lainnya. Namun petenis peringkat satu dunia asal Serbia ini berharap dirinya mendapat perlawanan yang lebih keras dari petenis Inggris Raya tersebut. “Dia terlihat bugar. Dia

AP

Lakers Balas Clippers LOS ANGELES, AS (Waspada): Los Angeles Lakers berhasil membalaskan kekalahan pada edisi sebelumnya di NBA atas LA Angeles Clippers dengan skor 96-91 di Staples Center, Kamis (26/1) siang WIB. Kobe Bryant (foto) yang menjadi bintang dengan menghasilkan 24 poin, 12 poin itu dihasilkannya pada kuarter empat. Pau Gasol menambah dengan torehan 23 poin dan 10 rebounds. Dari kubu Clippers, Blake Griffin menjadi penampil terbaik dengan menghasilkan 26 poin dan sembilan rebounds. Caron Buttler dan Marvin Williams masing-masing menambah 16 poin. Clippers sebenarnya bermain cukup baik. Chris Paul dkk malah mengakhiri kuarter kedua dengan keunggulan 51-49. Dominasi Clippers masih berlanjut pada kuarter ketiga dengan keunggulan 71-68. Tapi Lakers bangkit pada kuarter empat. Bryant bahkan sempat membuat Lakers memimpin enam angka, sebelum akhirnya berkurang menjadi selisih lima angka. Kemenangan ini membalaskan kekalahan pada jumpa pertama, yang dimenangkan Clippers 102-94. Pada partai lailnnya, nasib berbeda dialami dua tim tangguhWilayah Timur; Miami Heat dan Chicago Bulls. Heat mengalahkan Detroit Pistons, sedangkan Bulls ditumbangkan Indiana Pacers 90-95. Mentas di The Palace of Auburn Hills, Heat sempat mendapatkan perlawanan sengit dari Pistons. Namun LeBron James dkk berhasil meraih keme-

Hasil Lainnya, Kamis (26/1) New Jersey 97-90 Philadelphia NY Knicks 81-91 Cleveland Charlotte 75-92 Washington New Orleans 91-101 Oklahoma Milwaukee 105-99 Houston Minnesota 105-90 Dallas Atlanta 83-105 San Antonio Toronto 111-106 Utah Jazz Denver 122-93 Sacramento Portland 93-101 Golden State

nangan 101-98. James yang menjadi bintang dengan mencetak angka tertinggi 32 poin dan tujuh assists, termasuk enam angka terakhir dari tembakan bebas. (m15/okz/ap)

bermain dengan baik,” ucap Djokovic. “Dia pasti sangat termotivasi untuk memenangi grand slam pertamanya. Dia telah memainkan partai final di sini dalam dua tahun terakhir. “Namun di sisi lain, saya telah bermain sangat baik di sini dalam beberapa tahun terakhir. Anda tahu, kami mengharapkan pertandingan hebat,” tambah petenis berusia 24 tahun itu. Unggulan keempat Murray, yakin dapat menampilkan permainan terbaik setelah mencapai final grand slam kelimanya secara berturut-turut. “Saya telah melakukan persiapan sebaik yang saya bisa. Untungnya tenis telah berlangsung dengan bagus,” klaimnya. (m15/afp/rtr)

“Saya merasa sepertinya tangan saya berbobot 200 kilogramdantubuhsayasekitar1.000 kilogram,” ungkap Azarenka, sambil mengusap air mata. “Semuanya terguncang, namun perasaan ketika Anda akhirnya menang merupakan sebuah kelegaan. Saya tidak percaya (laga) ini akhirnya berakhir, saya hanya ingin menangis,” ujarnya lagi. Tampil di Rod Laver Arena, Kamis (26/1), duel sengit terjadi pada set pertama. Azarenka sempat memimpin 3-1, namun Clijsters berusaha bangkit. Juara Australian Terbuka tahun lalu itu berhasil memperkecil ketinggalan menjadi 4-3 sebelum Azarenka tetap unggul. Clijsters tidak tinggal diam. Pada set kedua, petenis Belgia ini menemukan permainan terbaiknya. Terbukti, Clijsters menyamakan kedudukan. Kalah telak di set kedua, performa gemilang Azarenka berlanjut pada set ketiga. Sebelum menggagalkan ambisi Clijsters mempertahankan gelar, Azarenka berhasil mematahkan servis lawan untuk

menambah keunggulan menjadi 5-3 sekaligus menutup permainan dengan keunggulan 6-3. Jumpa Sharapova Dengan kemenangan ini, Azarenka akan ditantang unggulan keempat asal Rusia, Maria Sharapova, yang secara mengejutkan menyingkirkan unggulan kedua Petra Kvitova. Bermodalkan semangat tinggi dan keunggulan jam terbang, Sharapova yang baru saja diplot untuk memimpin tim Piala Fed Rusia menyudahi perlawanan Kvitova 6-2, 3-6, 6-4. Ini sekaligus pembalasan dendam Sharapova terhadap Kvitova di finalWimbledon 2011 lalu. Bagi Kvitova, kekalahan ini terasa pahit. Pasalnya, petenis Republik Ceko ini sempat diuntungkan dengan buruknya servis pertama Sharapova di dua set pertama. Namun, servis juara 2008 itu membaik jelang akhir set ketiga di mana Kvitova pun harus rela gagal mencicipi gelar grand slam keduanya. Untuk Masha, tiket final memperbesar kans mengoleksi titel grand slam keempatnya. (m33/ap)

AP

UNGGULAN ketiga asal Belarusia Victoria Azarenka (kiri), tak kuasa menahan emosi setelah mengatai juara bertahan asal Belgia Kim Clijsters pada semifinal Australia Terbuka 2012 di Rod Laver Arena, Melbourne, Kamis (26/1).

Pasang Iklan HP. 081370328259 Email:

iklan_waspada@yahoo.co.id

Sumatera Utara

WASPADA Jumat 27 Januari 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:39 12:52 12:40 12:47 12:46 12:43 12:40 12:35 12:42 12:42

‘Ashar 16:02 16:15 16:03 16:09 16:09 16:07 16:03 15:58 16:05 16:04

Magrib 18:38 18:49 18:39 18:43 18:44 18:45 18:39 18:35 18:41 18:39

���Isya

Imsak

Shubuh Syuruq

Kota

19:50 20:01 19:51 19:56 19:56 19:58 19:51 19:47 19:53 19:52

05:09 05:25 05:10 05:19 04:18 05:10 05:09 05:05 05:12 04:13

05:19 05:35 05:20 05:29 05:28 05:20 05:19 05:15 05:22 05:23

L.Seumawe 12:45 L. Pakam 12:38 Sei Rampah12:37 Meulaboh 12:49 P.Sidimpuan12:36 P. Siantar 12:37 Balige 12:37 R. Prapat 12:34 Sabang 12:52 Pandan 12:38

06:38 06:54 06:39 06:48 06:47 06:39 06:38 06:33 06:41 06:42

Zhuhur ‘Ashar 16:07 16:01 16:00 16:12 16:00 16:00 16:01 15:57 16:14 16:02

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:42 18:37 18:36 18:47 18:39 18:37 18:38 18:35 18:48 18:40

19:54 19:49 19:48 19:59 19:51 19:50 19:50 19:47 20:00 19:52

05:18 05:09 05:08 05:20 05:04 05:07 05:06 05:03 05:26 05:06

05:28 05:19 05:18 05:30 05:14 05:17 05:16 05:13 05:36 05:16

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:38 12:40 12:50 12:42 12:39 12:46 12:34 12:45 12:38 12:37

18:40 18:40 18:46 18:43 18:38 18:44 18:35 18:44 18:39 18:36

19:52 19:52 19:58 19:56 19:50 19:56 19:47 19:56 19:51 19:49

05:06 05:09 05:23 05:11 05:10 05:18 05:04 05:15 05:06 05:07

05:16 05:19 05:33 05:21 05:20 05:28 05:14 05:25 05:16 05:17

Panyabungan 12:35 Teluk Dalam12:42 Salak 12:40 Limapuluh 12:36 Parapat 12:38 GunungTua 12:35 Sibuhuan 12:35 Lhoksukon 12:44 D.Sanggul 12:38 Kotapinang 12:33 AekKanopan 12:35

06:46 06:37 06:36 06:49 06:32 06:35 06:35 06:31 06:54 06:35

16:02 16:03 16:12 16:06 16:02 16:09 15:58 16:08 16:01 16:00

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:35 06:38 06:51 06:40 06:39 06:46 06:33 06:43 06:35 06:36

Zhuhur ‘Ashar 15:59 16:06 16:03 15:59 16:01 15:58 15:58 16:07 16:02 15:56 15:58

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:38 18:46 18:41 18:35 18:38 18:37 18:37 18:41 18:40 18:35 18:35

19:50 19:58 19:53 19:48 19:50 19:49 19:49 19:54 19:52 19:47 19:48

05:02 05:08 05:09 05:06 05:07 05:03 05:02 05:17 05:07 05:01 05:04

05:12 05:18 05:19 05:16 05:17 05:13 05:12 05:27 05:17 05:11 05:14

06:30 06:37 06:38 06:34 06:36 06:31 06:30 06:45 06:36 06:30 06:32

Polsek Binjai Gagalkan 20 Kg Ganja Masuk Medan BINJAI (Waspada): Petugas Polsek Binjai dipimpin Kapolsek AKP Zakaria, Kamis (26/1) sekitar pukul 08:00 menggagalkan pemasukan 20 kg ganja asal Aceh tujuan ke Medan. Selainbarangbukti20kgganja, polisi mengamankan pemiliknya berinisial AI, 22, warga Lambaro Tumong, Aceh Besar. Bus Pelangi BK 7654 A dike-mudikan T, 40, wargaAcehjugadiamankan,guna memperkuat kesaksian. Keterangan yang dikumpul-

kan, pagi itu pihak Polsek Binjai operasi rutin di depan kantor Polsek Jalan Lintas Sumatera. Ketika itu melintas bus angkutan umum Pelangi. Saat distop dan diperiksa, ditemukan bungkusan besar berisi 10 bal dilakban warna kuning.

Ketika dibuka ternyata bungkusan itu berisi ganja. Melalui kernetbus,Isman,24,wargaAceh, diketahui daun ganja itu milik AI, yang duduk di bangku tempel. Menurut Isman, ketika ditemui wartawan, AI naik dari Aceh Besar tujuan Medan. Sementara Kapolsek Binjai AKP Zakaria ketika dikonfirmasi diruangkerjannyamenyebutkan, awalnya tersangka coba mengelak, namun setelah diperiksa akhirnya mengaku.(a05)

Kadivreg PT. KAI Sumut Arogan Waspada/Nazelian Tanjung

TERSANGKA AI pemilik 20 kg ganja asal Aceh.

Ratusan Kader PKS DS Ikuti Mukayyam Dasar II LUBUK PAKAM (Waspada): Dewan Pimpinan Daerah Partai KeadilanSejahtera(DPDPKS)Kab.Deliserdangdalammempersiapkan pemimpin handal terus berbenah diri membekali kadernya dengan kekuatan rohaniah dan jasmaniah. Ketua DPD PKS Deliserdang, H. Marajaksa Harahap, S.Ag melepas 300 kader PKS Delisedang untuk mengikuti mukayyam dasar II di Bumi Perkemahan Pramuka Sibolangit, dari kantor DPD PKS Jalan Thamrin Lubukpakam, baru-baru ini. Selama tiga hari (20-22 Januari 2012), seluruh kader diingatkan untuk tidak melakukan kegiatan yang tidak bermanfaat terlebih dapat merusak lingkungan serta menzalimi sesama atau makhluk lain, tegas H. Marajaksa Harahap. Selain latihan fisik meliputi olahraga lari beberapa kilometer, mendaki tebing, menjelajah sungai, meniti seutas tali di atas kolam, merayap di atas lumpur, menaiki tali laba-laba, lompat harimau dan sederet kegiatan lainnya, para kader juga diharuskan mengejar target membaca Alquran satu juz per hari di samping kiamul-lail shalat tahajjud hingga menjelang subuh, dan shalat subuh berjamaah. Ahmad Yani, 28, kader asal Desa Kolam Kecamatan Percut Sei Tuan menyatakan bangga dapat mengikuti program mukayyam II DPD PKS Deliserdang. “Meski banyak menguras tenaga, namun banyak manfaat yang diperoleh dari mukayyam ini.” Kegiatan ini juga dalam rangka memanaskan mesin PKS menyongsong Musyawarah Kerja Nasional (Mukernas) yang rencananya dilaksanakan Maret 2012 di Sumut. “Mari kita bangkit bersama untuk negeri,” ajak Marajaksa yang optimis PKS mampu memenangkan pesta rakyat pada Pemilu 2014.(a06)

SEIRAMPAH (Waspada): Kepala Devisi Regional (Kadivreg) I- Sumut/NAD PT. Kereta Api Indonesia (PT. KAI), arogan terhadapnasibpedagangasonganyang telah berjualan puluhan tahun di atas kereta api, kata Ketua Fraksi PAN DPRD Sergai, H. Syahlan Siregar, ST, kepada Waspada, Rabu (25/1), di Sei Rampah. Menurut H. Syahlan Siregar, lanjutan musyawarah antara perwakilan pedagang asongan Sumut dengan Kadivreg di ruang rapat PT. KAI Sumut, Jl. Prof. M.Yamin, Medan, Selasa (24/1), berlangsung alot hingga menyita waktu tiga jam. Kadivreg,kataSyahlan,terlalu kaku dan arogan menafsirkan peraturan dan perundang-undangan dan perintah atasannya, untuk menertibkan pedagang asongan yang sejak zaman dahulu sudah berjualan di kereta api kelas ekonomi, dalam upaya mencari nafkah.

Rapat dipimpin Kadivreg PT. KAI Sumut/NAD, M. Nasir, juga dihadiri Manager Asset, Irwan Sipayung, Asisten Manager, Bayu, Humas, Asri, sedangkan pihak pedagang asongan dihadiri Ketua Ikatan Pedagang Asongan, Ahmad Sukri, Wakil Ketua, Rifai Harianto dan Pembina Pedagang Asongan,BismandanLolom.Juga hadir anggota DPRD Sumut dari Fraksi Demokrat, H. Buyung, serta Ketua Fraksi PAN Sergai, H. Syahlan Siregar, ST, sementara ratusan pedagang asongan menunggu di luar ruangan. Menurutnya, berbagai syarat dari PT. KAI dipatuhi pedagang asongan. Tapi satu syarat yang dimohonkanpedagangdanwakil rakyat, yaitu agar jumlah pedagang asongan yang boleh berjualan tidak dibatasi hanya 30 pedagang,tapiditambahsebabjumlah pedagang yang menjadi anggota seluruhnya 702, dengan kaku dan arogannya Kadivreg malah mengatakan tidak semua aspirasi

bisa ditampungnya dalam membuat keputusan. Karena dia ditugaskan untuk mengelola PT. KAI Sumut dengan prinsip orientasi keuntungan. H. Syahlan menilai, Kadivreg PT. KAI Sumut arogan dan tidak punya hati nurani, serta tidak memiliki konsep dalam upaya menyelesaikan masalah di lingkungan kerjanya. Sementara Kadivreg melalui Polsuska PT. KAI Sumut, Kompol M. Purba ketika dihubungi Waspada, menyebutkan, sebenarnya pedagang asongan tidak diperbolehkan berjualan di dalam kereta api. Namun pihak PT. KAI, katanya, mengambil kebijakan demi ketertiban. Terkait pembatasan jumlah pedagang asongan, menurut M. Purba, jika mereka setuju bisa datang kembali ke PT. KAI, untuk menandatangani perjanjian.Tapi jika tidak setuju, pihaknya terpaksa melakukan penertiban terhitung Februari mendatang.(c03)

BINJAI (Waspada):Wali Kota Binjai HM Idaham, SH, M.Si diwakili Sekdako Iqbal Pulungan minta aparatur pemerintah menjadi contoh bagi masyarakat memenuhi kewajiban pajak. Ketika membuka sosialisi SPT Tahunan, PPH pajak pribadi di lingkungan Pemko Binjai Pajak di aula Pemko, Kamis (26/1), Wali Kota menyebutkan pajak memiliki peran penting memberi kontribusi nyata dalam belanja daerah. Pada APBD Kota Binjai tahun 2011, secara nasional 76,96% APBN ditopang dari penerimaan pajak. “Pemerintah Kota Binjai akan meningkatkan pencapaian target penerimaandaerah.Salahsatucaramelaluiinformasidanmenumbuhkan kesadaran para PNS dan masyarakat serta wajib pajak lainnya. Sosialisasi diikuti bendahara gaji dari seluruh unit kerja, dihadiri kepala Kantor Pelayanan Pajak Pratama Binjai H. Sarbini Pohan, Kepala Dinas Pengelola Keuangan dan Asset Drs. Aspian.(a04)

TEBINGTINGGI (Waspada):Tarif retribusi air PDAMTirta Bulian Kota Tebingtinggi akan mengalami kenaikan mulai Februari 2012. Kenaikan tarif itu dilakukan terhadap semua segmen pelanggan dan telah mendapatkan persetujuan DPRD sebesar 36 persen dari tarif dasar yang ada. Direktur PDAM Tirta Bulian Ir. Oki Doni Siregar, Rabu (25/1), di ruang kerjanya, mengatakan kenaikan tarif itu dilakukan, setelah empat tahun tarif retribusi air tidak dinaikkan. Padahal, berbagai faktor yang mempengaruhi operasional PDAM dalam pengadaan air bersih bagi warga kota terus mengalami kenaikan. Dari catatan PDAM, penyesuaian tarif air bersih itu dilakukan hanya satu kali dimasa mantanWali Kota Ir.H.Abdul Hafiz Hasibuan. Sehingga wajar, jika tarif retribusi air dinaikkan, kata Oki Doni. Diungkapkan, untuk saat ini, tarif air PDAM Tirta Bulian merupakan tarif palingrendahdariseluruhPDAMyangadadiSumut,bahkanIndonesia. Sesuaiperaturan,semestinyatingkatkenaikantarifPDAMbisadilakukan setiap dua tahun sekali. Namun, karena PDAM juga memiliki misi sosial, maka kebijakan kenaikan tarif dilakukan sanat hati-hati. Alasan kenaikan tarif, tambah dia, karena biaya operasional PDAM setiap tahun juga mengalami peningkatan. “Untuk menjaga agar perusahaan daerah tetap sehat, maka kenaikan tarif tak bisa dihindari,” tegas dia. Oki Doni mengakui, proses kenaikan tarif sudah melalui mekanisme yang lazim dilaksanakan dan sudah mendapat persetujuan DPRD. Untuk golongan sosial umum (SU) harga baru Rp1,020 per M3, sosial khusus Rp1,360 M3. Rumah tangga A Rp2,108 per M3, rumah tangga B Rp2,924 per M3, rumah tangga C Rp3,264 per M3. rumah tangga D Rp3,604 per M3. Kemudian instansi pemerintah/TNI/ Polri Rp3,604 M3 Sedangkan golong niaga, niaga kecil (N.1) Rp4,218 per M3, niaga menengah (N.2) Rp 6,188 per M3, niaga besar (N.3) Rp7,480 M3. Dari data yang ada, jumlah pelanggan PDAM Tirta Bulian mencapai 9.224, dengan jumlah pelanggan rumah tangga 8.000 KK lebih. Selebihnya dari kelompok niaga dan sosial khusus.(a09)

Waspada/Ist

KETUA Fraksi PAN DPRD Sergai, H. Syahlan Siregar, (3 dari kiri) bersama Pembina Pedagang Asongan, Lolom dan Bisman, Polsuska PT. KAI Sumut, Kompol M. Purba serta pedagang asongan, usai pertemuan dengan Kadivreg PT. KAI Sumut.

Sejak Selesai Dibangun Tahun 2007 Bendungan Irigasi Tidak Berfungsi BESITANG (Waspada): Irigasi di Lk. IX, Kel. Bukitkubu, Kec. Besitang sejak dibangun tahun 2007 tidak berfungsi. Proyek menghabiskan dana ratusan juta rupiahinitidakmemberimanfaat berarti bagi petani. PengamatanWaspada, konstruksi beton irigasi sudah retak, sementara sejak bendungan tersebut selesai dibangun hingga kini, kontraktor yang menangani proyek sama sekali tidak pernah me-masang pintu klep untuk mengatur sirkulasi air. Proyek yang bersumber dari

APBD Langkat ini dianggap mubazirdanterkesanmenghamburhamburkan uang negara. Tak hanya bendungan yang tidak berfungsi, tapi ratusan meter parit telah tumpat karena praktis tidak ada perawatan, baik dari masyarakat mau pun Dinas Pertanian. Pada musim curah hujan tinggi seperti sekarang, air menggenangi areal persawahan termasuk kebun milik petani.Yang sangat meresahkan petani, air bertahandiarealpersawahanmereka sampai berminggu-minggu sehinggapertumbuhanpadiyang

baru ditanam tidak berkembang. Parit-parit yang dibangun pasca banjir bandang tahun 2006 sudahpadatumpat.Namunyang disesalkan, petugas dari Dinas Pertanian termasuk aparat kelurahan tak pernah menggerakkan partisipasi masyarakat untuk bergotongroyong. Kondisi ini pernah disampaikan Waspada kepada Ka. Kelurahan Bukitkubu, Mawardi, namun tak terealisasi. Untuk kelancaransirkulasiair,Ismaildan warga berharap lurah dapat menggiatkangotongroyong.(a02)

Pupuk Silaturahmi Lewat Pengajian Akbar BERINGIN, Deliserdang (Waspada): “Mari kita pupuk terus silaturahmi lewat pengajian akbar setiap bulan,” kata Camat Beringin Batara R Harahap, S.Sos., M.Sc, di hadapan ratusan jamaah pengajian akbar Kecamatan Beringin, kemarin, di Masjid Al Ikhlas, Kualanamu. Batara kembali mengingatkan para jamaah pengajian yang mayoritas kaum ibu, bahwa tanpa persatuan dan silaturahmi yang kuat pengajian rutin setiap bulan itu tak akan membawa dampak positif. “Saya gembira antusias para kaum ibu di kecamatan tercinta ini. Minimal setiap pengajian akbar pasti kita akan membawa oleholeh berupa aplikasi tausyiah yang disampaikan mubaligh,” ujar Batara. Sementara Hj. Masyitah Pane dalam tausiahnya mengingatkan para kaum ibu dan jamaah lainnya yang hadir agar di penghujung bulan Syafar ini, sebaiknya menjalankan shalat sunat bermunajat kepada Allah SWT.(m16)

Eksekusi Ruko Di Sei Bamban Nyaris Ricuh SEI BAMBAN (Waspada): Pengadilan Agama TebingTinggi (PA-TT) mengeksekusi rumah toko (ruko) seluas 140 M2 yang berlokasi di Dusun II, Desa Pon, Kec. Sei Bamban, Kab. Serdang Bedagai, Rabu (25/1) sekira pukul 10:00 yang nyaris ricuh dengan pihak tergugat. Juru sita pengganti Muhamad Syahril dengan saksi Handayani dan H. Zainul Abidin membacakan putusan eksekusi No: 100/Pdt.G/2009/ PATTD jo PA Medan No: 120/Pdt.G/2009 PTA Medan tahun 2009 serta putusan MA No: 294 K/AG/2010 tahun 2010. dan salinan risalah kantor pelelangan kekayaan negara dan lelang Medan No: 656/2011 tanggal 6 September 2011 (KPKNL). Setelah dibacakan putusan, pihak Pengadilan Agama Tebing Tinggi langsung membuka besi penghalang ruko dan gembok pintu, selanjutnya mengeluarkan isi rumah serta pembongkaran pintu. Di saat petugas berusaha membuka besi penghalang dan gembok pintu, tergugat yang juga salah seorang ahli waris, Supianto alias Usup Bin Kasman, 48, bersama istrinya Sri Ningsih mencoba menghalangi petugas eksekusi.

Di hadapan petugas eksekusi, Usup mengakui dia telah membayar separuh dari harga rumah kepada adik-adiknya dan dirinya merasa tidak pernah menandatangani surat jual beli. Bahkan, Usup menuding petugas pihak eksekusi Pengadilan Agama Tebing Tinggi yang melakukan eksekusi tanpa pemberitahuan sebelumnya, sehingga dianggapnya melanggar hukum. Sengketa berawal dari 13 ahli waris yang juga adik kandung dan kemanakan tergugat menjual objek eksekusi kepada termohon eksekusi Andy Halim Putra. Dengan kesepakatan harga ruko yang memiliki luas 140 M2 itu dijual Rp300 juta padatahun2009.Walautelahdijualpihakpenggugat, pihak tergugat tidak bersedia ke luar dari rumah itu. Dalam upaya mengantisipasi serta mengamankan proses eksekusi, Polres Sergai menyiagakan personil Satlantas, Sabhara, Reskrim,dan Intelkam serta para Kasat, bahkan, Kapolres Sergai AKBP Arif Budiman, S.Ik, MH langsung memantau jalannya eksekusi.(c03)

Bidan Pengantin Itu Pernah Curhat Soal Asmara

Sosialisasi Pengisian SPT

Tarif Air PDAM T. Tinggi Naik 36 Persen

Waspada/Edi Saputra

PIHAK tergugat Supianto alias Usup, (kemeja kuning) berusaha menghalangi proses eksekusi satu unit ruko yang dilakukan juru sita Pengadilan Agama Tebingtinggi.

Waspada/Asrirrais

BENDUNGAN irigasi di Lk. IX, Kel. Bukitkubu, Kec. Besitang yang dibangun tahun 2007 tak berfungsi dan telah retak.

P. BRANDAN (Waspada):Tim Reskrim Polsek P. Brandan terus menyelidiki kasus pembunuhan bidan pengantin. Dari kelanjutan hasil olah TKP, Rabu (25/1), polisi menemukan sepotong kayu yang diduga digunakan sebagai alat mengeksekusi korban. Kayu berukuran 2 x 3 cm dengan panjang kurang dari 1 meter ditemukan di atas plafon rumah korban. Pelaku diperkirakan sengaja membuang potongan kayu yang terdapat bercak darah itu usai menghantamkan benda tumpul tersebut ke dahi dan wajah, Sahrum Lubis. Kematian bidan pengantin ini menyedot perhatian masyarakat. Selasa malam sebelum jasad korban dikebumikan, ratusan warga yang melintasiJalinsumMedan-Acehmemadatirumah korban di bilangan Lingkungan Bukit I, Kel. Tangkahandurian, Kec. Brandan Barat. Informasi yang dihimpun, Sahrum menjalin hubunganspesialdenganseorangpria.Hubungan asmara antar sesama jenis ini kabarnya kerab diwarnai kekerasan fisik dan psikis dari

pasangannya. Menurut informasi, beberapa waktu lalu pada acara pesta perkawinan di Besitang, tata rias pengantin profesional yang memperoleh sertifikat dari Beauty Riveraganza ini, pernah menceritakan hubungan asmaranya. Korban menceritakan perangai pria yang pernah memukul wajahnya hingga lembam. Sang pacar kerab minta uang dan bila tidak diberi, dia bisa agresif. Sesuai informasi, korban yang mengaku sangat menderita pernah minta tolong didoakan, agar dapat melupakan pria yang dikasihi sekaligus menjadi parasit bagi dirinya. Kematian Sharum mengundang kecurigaan keluarga korban terhadap seorang pria berinisial Pr. Pasalnya, lelaki yang disebut-sebut asal Aceh ituditengaraimemilikihubunganspesialdansering menyambangi rumah korban, namun sekarang dia menghilang. “Kami berharap peristiwa ini segera terungkap, dan pelakunya dihukum seberat-beratnya,” tutur kakak korban sambil menangis.(a02)

Dituding ‘Petieskan’ Kasus Korupsi

Himmah Kembali Demo Kejari T. Tinggi TEBINGTINGGI (Waspada): Himpunan Mahasiswa Alwasliyah (Himmah) Kota Tebingtinggi kembali menggelar demonstrasi di kantor Kejaksaan Negeri (Kejari)Tebingtinggi Deli, Rabu (25/1). Dengan membawa berbagai poster, belasan mahasiswa yang bergabung dengan kelompok masyarakat, Lumbung Informasi Masyarakat (Lima) berorasi bergantian di depan kantor Kejaksaan di Jalan KL. Yossudarso. Mereka mengecam lambannya penanganan kasus korupsi di Kejaksaan Negeri Tebingtinggi Deli,bahkankhususnyakasuskorupsiyangsedang berjalan terkesan“dipeti es kan” pihak kejaksaan. Para mahasiswa juga mensinyalir pejabat korupsi menjadi ajang ‘sapi perahan’ oknum-oknum petugas Kejari. Mereka mencontohkan, kasus runtuhnya gedung SMP Negeri 2 beberapa waktu lalu dan kasus rumah potong hewan (RPH) di Dinas Pertanian Tebingtinggi senilai Rp176,6 juta yang ditangani pihak kejaksaan sampai sekarang tidak terdengar kelanjutannya. Mereka juga minta oknum Kasi Pidsus Kejari, M. ZulfanTanjung yang selama ini menangani kasus-kasus korupsi, bertanggungjawab sebelum pindah tugas. Sambil membentang berbagai poster, belasan mahasiswa asal Tebingtinggi tersebut serentak berteriak,‘hidup mahasiswa..’,‘tangkap koruptor...’. Di antara berbagai poster tersebut bertuliskan. “Kejari jangan tutup mata”. “APBD keringat rakyat”, “Koruptor bukan ATM berjalan”. “Jangan jadikan koruptor sapi perahan”.“Jangan ditangkap pejabat korupsi ketika uangnya habis”. “Usut kasus runtuhnya gedung SMP Negeri 2 Tebingtinggi”. Dalam pernyataan sikapnya, mereka minta kepastian hukum dan mengusut tuntas dugaan tindak pidana korupsi penyalahgunaan anggaran pengadaan lahan tanah Rumah Potong Hewan (RPH) di Dinas Pertanian Tebingtinggi yang merugikan negara sebesar Rp176.600.000 ditambah tempat tersebut mubazir. Usuttuntasdugaanpenyalahgunaananggaran TA 2007 pengadaan lahan kantor Camat Bajenis

dengan total kerugian Rp35 juta. Kemudian minta Kejari mengusut dugaan penyalahgunaan anggaran perparkiran Dishub Tebingtinggi TA 2009 dengan total kerugian Rp42 juta, dan kasus dugaan korupsi lainnya. Selain itu, pihak Kejari diminta melaksanakan tugassecaraprofesionaldanobjektifsertamemproses secaracepatsetiappenanganankasuskorupsisehingga tidak terkesan ‘main mata’ terhadap para pihak. Sehinggatidakterkesanmenjadikankoruptorsebagai ‘sapi perah’ atau ‘ATM berjalan.’ Aksi unjurasa tersebut berlangsung aman dantertibdenganmendapatpengamananpetugas gabungan Polres Tebingtinggi yang dipimpin langsung Kapolres, AKBP Drs. Andy Rian Djajadi, SIk. Usai menyampaikan aspirasinya, perwakilan pengunjukrasa, Sahri Damanik, bersama dua orang lainnya diterima KajariTebingtinggi, Olopan Nainggolan di ruang kerjanya. Kepada Kajari, kordinator lapangan Sahri Damanikmewakilipengunjukrasamenyampaikan kekawatirannya beberapa kasus korupsi yang ditanganikejaridipetieskan.Padahalkatanya,Kejari punyakewenangandankekuatanuntukmenghimpun data-dataataubukti-buktikasuskorupsi.PCHimmah dan Lumbung Informasi Masyarakat akan terus mengawalproseshukumdugaankorupsiinisampai tuntas, bila tidak mereka akan kembali datang mendemo kantor kejari tersebut. Menjawab tuntutan mahasiswa tersebut, Kejari Tebingtinggi, Olopan Nainggolan, SH mengatakan kasus dugaan korupsi yang ditangani memerlukan waktu untuk diproses, ada yang tahap penyelidikan dan tahap penyidikan. Menurutnya, penyelesaikan kasus korupsi tidak mudah, memerlukan cukup bukti, bila tidak, masalahnya nanti akan kembali jaksa atau perkaranya akan divonis bebas. Dalammenanganikasus-kasuskorupsi,Kejaksaan bekerjasamadenganBPKPuntukprosespengusutan. “Semua berdasarkan fakta hukum, tidak ada yang mainmataantarpejabatdenganpetugaskejari,apalagi pejabat korupsi menjadi sapi perahan, bila benar ada kita siap menindaknya,” ucap Kejari. (a11)

Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Pengusaha Adudomba Warga Desa Janji RANTAUPRAPAT (Waspada): Gara-gara tidak diperbolehkannya truk pengangkut material melintasi di tanah wakaf masyarakat yang dikelola pengusaha bermata cipit, warga Desa Janji, Kec. Bilah Barat, Kab. Labuhanbatu di adudomba hingga terjadi perkelahian. Pertikaian melibatkan warga yang tidak memperbolehkan tanah wakaf dilintasi, dan warga yang satu lagi berpihak ke pengusaha yang menentang warga setempa itu terjadi Minggu (22/1) sekira pukul 21:35. Hal itu dikatakan Karim seorang warga Desa Janji yang sempat adu jotos dengan warga yang berdomisili di Desa Janji. Malam itu juga Karim membuat laporan ke Mapolres Labuhanbatu dengan Nomor STPL/ 67/I/2012/SPK C. Kejadian bermula di saat Karim datang ketangkahan untuk menemui Kepala Desa Afdling I yang pada saat itu berada di lokasi itu. Setibanya di lokasi, Karim dituding Agus Salim sebagai provokator sehingga menantang Karim untuk berkelahi, namun Karim tidak menanggapi ucapan warga yang pro kepada pengusaha tersebut. “Saya pikir persoalan itu sampai di situ saja ternyata dia (Agus Salim, red) alias Atan mengirim pesan SMS ke HP saya untuk mengajak berkelahi,” terang Karim. Ketua Lembaga Cegah Kejahatan Indonesia (LCKI) Labuhanbatu Supardi Sitohang, SE ketika dimintai tanggapannya mengenai insiden perkelahian antar warga itu, menyatakan sangat menyayangkan hal itu terjadi. Peristiwaituterjadiakibat sikaparogansidankesewenang-wenangan daripihaktertentu.Makapihaknyamerasaterpanggiluntukmendampingi warga yang mengkuasakan persoalan itu ke LCKI Labuhanbatu. “Kita tidak rela di daerah ini masih berlaku hukum rimba atau hukum uang yang mengatur segala-galanya, lembaga ini kita pertaruhkan untuk membelaorang-orangyangtidakberdayadantertindassehinggakeadilan itu diperoleh masyarakat,” kata Sitohang. (c07)

WASPADA Jumat 27 Januari 2012

Gadis Dipasung Di Kolong Jembatan Limalaras SUNGGUH malang nasib Marsini, 21, gadis yatim-piatu yang melewati hari demi hari dalam kondisi sangat memprihatinkan di bawah jembatan Limalaras, Tanjungtiram, Batubara. Tangannya diikat ke ‘tempat tidurnya’. Dia dipasung. “Dia (Marsini, red) masih punya saudara, dia punya seorang abang dan dua adik yang keadaan ekonominya juga sulit,” kata Kartini,47, mengaku makcik Marsini yang tinggal di emperan bawah jembatan Limalaras, Kamis (26/1) Diceritakan, selama ini Marsini sehat-sehat, bisa sekolah SD di Bagandalam,SMP di Tanjungtiram dan SMA di Tala wi. Setelah menginjak dewasa, dia pernah tinggal di Pekanbaru. Namun dalam dua tahun tera khir jatuh sakit. Tubuhnya kerempeng dan seperti orang hilang ingatan Pengobatan secara medis sampai ke paranormal sudah diusahakan. Marsini sempat sehat dalam 3 - 6 bulan, kemudian kumat lagi Dalam keadaan dihimpit ekonomi, Kartini terpaksa merawat keponakannya tiga bulan terakhir, sejak abangnya pindah ke Jambi Untuk memudahkan merawatnya dan takut hilang melarikan diri,Kartini meng gantungkan hidup suaminya melaut itu, dengan berat hati mengikat tangannya ke ‘tempat tidurnya’ di bawah

kolong jembatan Limalaras “Dia seperti tidak pernah tidur, kadangkala bisa diajak ngomong; ingat masa lalu. Dia aman tinggal di situ, tidak kena hujan, tidak kena air pasang” ujar Kartini yang setiap hari memandikan,tukar pakaian, memakaikan bedak Marsini. “Guru aku pak Ginting,pak Sofyan” kata Marsini ketika ditanya Waspada. Kemudian ngomongnya melantur entah ke mana. Karena Kartini mengatakan Marsini lulusan SMA di Talawi, Waspada minta bantuan Kepala SMAN I Talawi Zainal Sagala untuk memastikan kebenarannya. Setelah dicari nama Marsini pada kelulusan 2007 sampai 2011, ternyata tidak ditemukan. “Mungkin saja dia lulus di SMPN I Tan jungtiram karena menyebut nama guru pak Ginting,Sofyan” kata Azmi Tenaga Ke sejahteraan Sosial Kec. (TKSK) Tan jungtiram ikut melihat kondisi Marsini yang disebut orang ‘dipasung’ itu Menurut Azmi, keadaan Marsini mempri hatinkan, sudah yatim piatu,perlu mendapat perhatian serius Pemkab Batubara. * Helmy Has

Miliki Sabu, Dituntut 7 Tahun Denda Rp1 M RANTAUPRAPAT (Waspada): Miliki sabusabu, terdakwa Ar alias Dian, 40, warga Lorong 3 Aek Kanopan, Kec. Kualuh Hulu, Kab. Labuhanbatu Utara dituntut Jaksa Penuntut Umum (JPU) dengan pidana penjara tujuh tahun serta denda Rp1 miliar. Tuntutan tersebut dibacakan JPU J Ginting, SH dalam persidangan yang diketuai majelis hakim Dedi,SH,diPengadilanNegeri(PN) Rantauprapat, Selasa (24/1). Terdakwa terbukti bersalah secara bersama-sama memiliki dan menguasai narkotika golongan I sebagaimana diatur dalam pasal 112 ayat (1) UU No.35 tahun 2009 tentang narkotika jo pasal 55 ayat (1) ke-1 KUHP dalam

dakwaan subsidair. Menyatakan barang bukti berupa1buahtassandang,1buah timbangan digital, 1 buah pipet padaujungpipetruncing(sendok sabu-sabu), 90 lembar kantong plastik klip, 3 bungkus besar sabusabu seberat 23 gram bruto dan 4bungkuskecilsabu-sabuseberat 1,3 gram bruto dirampas untuk dimusnahkan. Ar dalam keterangannya

menyebutkan, sabu-sabu diperoleh dengan membelinya dari Iwan (DPO) sebanyak 20 gram seharga Rp20 juta. Namun pada saat itu terdakwa baru membayarnya Rp4 juta yaitu pada hari Senin, 19 September 2011 sekira pukul 02:00 di rumah terdakwa. Tujuan terdakwa membeli sabu-sabu itu untuk dijual dan terdakwa kemudian mengemas sendiri sabu-sabu tersebut denganmenggunakantimbangan dengan ukuran paket per bungkusnya Rp100 ribu sampai dengan paket Rp1 juta dengan menggunakan plastik klip. Usai mendengar tuntutan, majelis hakim menunda persidangansatumingguuntukmemberikan putusan. (a18)

Panen Gurami 3 Ton Di Sei Balai SEI. BALAI (Waspada): Panen perdana ikan gurami kelompok perintis air tawar bantuan Otorita Asahan di Desa Sei Balai Kec. Sei. Balai Batubara, mencapai hasil 3 ton, Rabu (25/1). “Hasil panen perdana ikan gurami menggembirakan, potensi budidaya air tawar di Sei Balai perlu dikembangkan ‘membangun’ perikanan di Batubara” kata Ir. Rinaldi Kadiskanla Batubara dalam tatap muka dengan petanitambakSeiBalai,Rabu(25/ 1). Hadir Ketua DPRD Batubara Selamat Arifin, SE, Marcopolo, Syahrial dari Otorita Asahan, Ir. AzwarHamid(Pokja),Inspektorat Batubara, Ketua KTNA Amin Nasution. Katua Kelompok Perintis Burhan melaporkan, 9.000 bibit gurami dan pakan bantuan Otorita Asahan 8 bulan lalu menghasilkan panen 3 ton. Saat ini menjadi masalah adalah mencari pasar, dengan hasil yang dicapai dapat dilaksanakan bantuan bergulir Menurut Kadiskanla Rinaldi, melihat potensi air tawar akan diupayakan bisa membangun balai benih di Sei Balai membangun perikanan di Batubara.

Dia minta sesama anggota kelompok saling mendukung, fungsikan kelompok meningkatkan produksi ikan menambah pendapatan keluarga. Marcopolo dari Otorita Asahan mengungkapkan, dalam membangun Batubara perlu program strategis yang menyentuh masyarakat pemberdayaan ekonomi dan mandiri, bantuan diberikan untuk pemberdayaan ekonomi desa mencapai sejahtera, seperti diberikan ke perikanan, pertanian dan lingkungan hidup di Batubara tahun 2011. Ketua Pokja Azwar Hamid menyampaikan terima kasih ke

Otorita Asahan telah memberikan bantuan dan memperoleh hasil menggembirakan seperti panen ikan gurami, sebelumnya panen ikan kerapu di Medangderas 10 Desember 2011 lalu bisa dikembangkan meningkatkan ekonomi rakyat. Ketua DPRD Batubara Selamat Arifin mengakui, dia juga bagian petani di Sei Balai, merasa banggadidesanyapunyabudidaya air tawar yang diharap terus meningkat dan berkembang. Dia mendukung seandainya di Sei Balai dibangun balai benih untuk meningkatkanproduksibudidaya air tawar di Kab. Batubara. (a12)

Satu Unit Rumah Terbakar TALI AIR -Batubara (Waspada) Rumah Amat Buyung warga desa pemekaran Tali Air Permai/Baganbaru Tanjungtiram Batu bara nyaris musnah terbakar,Kamis (26/1) dini hari Kejadian tak disangka itu cepat menda pat bantuan warga memadamkan menyi ramkan air namun herannya bagian tengah rumah mengalami rusak dilalap api Berikut barang berharga tivi,lemari ludes Sedangkan asal api belum jelas,ma sih dalam penyelidikan,kerugian puluhan juta Plt KadesTali Air Permai AbdWahab,Ka mis (26/1) membenarkan kebakaran me nimpa warganya Amat Buyung,belum tahu asal api dan kerugian puluhan juta. (a12)

Aktivitas TPH Meresahkan KOTAPINANG (Waspada): Sejumlah warga yang bermukim di kawasan perkampungan Karang Sari, Desa Sisumut, Kec. Kotapinang beberapa waktu belakangan, dibuat resah akibat aktivitas Tempat Pemotongan Hewan (TPH) yang beroperasi di Jl. Nusantara, Desa Sisumut. Selain menimbulkan bau tak sedap,wargajugamenudingTPH tersebut tidak memiliki izin. Pandi, salah seorang warga kepada wartawan, Rabu (25/1) mengatakan, hampir setiap hari warga yang bermukim di kawasan mencium bau tidak sedap akibat limbah TPH yang dibuang ke parit.

Bau tersebut semakin menyengat saat turun hujan.Walaupunwargasudahmenyampaikan masalah itu secara baik-baik, namunpemilikTPHmengakusudah memiliki limbah buang sebelum mengalirkannya ke dalam parit. “Kami nggak tahan dengan baunya. Kalau sudah hujan baunya minta ampun,” katanya. Selainitu,katadia,wargamenduga TPH tersebut tidak memiliki izin, sehingga operasional TPH itu mengkhawatirkan. Apa lagi daging yang dihasilkan di TPH ituuntukdikonsumsimasyarakat. Karenanya dia mendesak Pemkab menertibkan TPH tersebut. “Kalau gak ada izin bagaimana

masyarakat mengkonsumsi daging dari TPH itu. Selama ini daging-daging lembu yang dipotong dijadikan bakso dan dipasarkan di Labusel,” katanya. Kepala Dinas Pertanian, Peternakan, dan Perikanan Pemkab Labusel, Selwin Marpaung yang dikonfirmasi membenarkan bahwaTPHitutidakmemilikiizin. Namun menurutnya, karena Pemkab Labusel saat ini belum memiliki RPH, maka TPH itu dibiarkan beroperasi. “Karena rumah potong kita belumada,jadikitabiarkan,tetapi tetap kita awasi. Agar tidak membahayakan masyarakat,” katanya. (c18)

Waspada/Rasudin Sihotang

PETUGAS Satpol PP Kota Tanjungbalai membongkar lapak-lapak pedagang kaki lima di Jalan HOS Cokroaminoto, Rabu (25/1).

Satpol PP Bongkar Lapak PKL TANJUNGBALAI (Waspada): Akibat melanggar peraturan dan menimbulkan pemandangan kumuh, puluhan petugas Satpol PP Kota Tanjungbalai membongkar lapak pedagang kaki lima, Rabu (25/1). Pantauan Waspada, pembongkaran itu berlangsung sejak pukul 08.00 hingga siang hari. Lapakdantendayangdibongkaryaknidisepanjang jalan T.Umar, Cokroaminoto, Ahmad Yani, Veteran, dan Asahan. Petugas mengangkut puluhan tenda berikut meja dan kursi itu ke kantor Pol PP menggunakan mobil dinas. Pembongkaran berjalan lancar kendati sejumlah masyarakat mencoba menghalangi penertiban itu. Kakan Satpol Pamong PrajaYusmada didampingi Kasi P2 Rismantri di lokasi menjelaskan, penertibanyangberlangsunghariitusifatnyamasih persuasif (pendekatan). Menurutnya, pembongkaran dilakukan karena pemiliknya tidak di tempat, sementara para para pedagang yang ditemukan berjualan baru sebatas peringatan.

“Barang-barang untuk sementara kita amankan di kantor dan baru akan dikembalikan jika pemiliknya datang dan menandatangi surat pernyataan tidak mengulang kembali,” terang Yusmada usai memberikan penjelasan dan pemahaman kepada pedagang tentang Peraturan Daerah. Lebih lanjut dijelaskan, masyarakat yang menggelar dagangan di kaki lima, pinggir jalan, di atas selokan yang menimbulkan kekumuhan telah melanggar Perda No. 8 Tahun 2004. Untuk itu, pihaknya berkomitmen tetap menegakkan peraturan dan melakukan penertiban sampai keindahan dan ketertiban kota itu kembali sedia kala. Sementara seorang pedagang diwawancara mengaku tidak terima atas pembongkaran itu. “Kami hanya mencari susuap nasi, tapi mengapa harusdiusirdandibongkarsepertiini,”ketuspenjual gorenganitusembarimembungkuspisanggoreng pesanan pelanggan. (a32)

Bupati Tak Pernah Bicara Moral Nelayan Di Sungai Berombang RANTAUPRAPAT (Waspada): Bupati Labuhanbatu tidak pernah mengucapkan kata-kata tentang moral nelayan sewaktu menyerahkan bantuan 10 unit kapal di Sungai Berombang, Kec. Panai Hilir, Kab. Labuhanbatu, Selasa (17/1) lalu. DemikiandisampaikanKabagHumasInfokom Setdakab Labuhanbatu, Abdurrahman Hasibuan, kepada wartawan di ruang kerjanya, Selasa (24/ 1) terkait pemberitaan yang menyangkut ucapan bupati tentang moral nelayan. Rahman mengatakan, pada saat memberikan pidato sambutan, arahan dan bimbingan, bupati sama sekali tidak pernah menyinggung moral nelayan di daerah itu. Bupati hanya mengatakan, bahwa yang berhak menerima bantuan kapal itu haruslah benar-benar nelayan yang tergabung dalam kelompok usaha bersama (KUB), bukan orang-orang yang mengaku sebagai nelayan yang kerjanya hanya duduk-duduk di kedai kopi. Dari kalimat itu jelas dapat kita baca, bahwa bupati sama sekali tidak menyinggung tentang moral nelayan. Tetapi, lebih memposisikan diri sebagai “ayah/bapak” yang menasehati anaknya agar dalam memberikan bantuan haruslah tepat sasaran. “Kalau ada nelayan yang tersinggung lantas mengecam pidato ini perlu kita pertanyakan, apakah dia benar-benar nelayan atau mengakungaku sebagai nelayan yang tidak direspon keinginannya,” tanya Rahman.

Terkait dengan banyaknya oknum-oknum yang mengaku sebagai nelayan akhir-akhir ini di Kec, Panai Hilir sehubungan digulirkannya bantuankapalkepadanelayan,Rahmanmengatakan,halitubisa-bisasaja.Tetapi,untukmenentukan keabsahan KUB yang ada harus melalui rekomendasi dari kepala desa/lurah. “Tentu kepala desa atau lurah yang tahu pasti warganya berprofesi apa, apakah sebagai nelayan, petani, pedagang, atau sebagai pengusaha kedai kopi,” tegasnya. Kepala Desa Sungai Baru, Kec. Panai Hilir, Tarmijo, kepada wartawan mengaku, bahwa pihaknya banyak didatangi oknum-oknum yang inginmendapatkanpengesahanKUB,tetapiditolak karena oknum tersebut tidak berprofesi sebagai nelayan.“Sayategasmenolakuntukmengeluarkan surat rekomendasi, karena saya tahu persis pengurus dan anggota yang ada di kelompok itu tidak murni seluruhnya nelayan,” kataTarmijo, seraya menjelaskan ketua dan bendahara dari KUB tersebut merupakan guru dengan status PNS dan nakhoda kapal penumpang jurusan Labuhanbatu – Tanjung Balai. Tarmijo juga mengatakan, bahwa atas penolakan itu oknum tersebut lantas bergerilya untuk mendapatkan dukungan dari nelayan lainnya, tetapi mendapat penolakan, sehingga memberikan statemen yang merugikan nelayan itu sendiri. (c07)

Setelah 37 Tahun Dalam Penantian 37 TAHUN waktu yang cukup untuk mematangkan kedewasaan seseorang dan mem-

bentuk nuansa indah bagi sebuah penantian perjumpaan. Teknologi komunikasi semakin canggih membuat

alumnus SMA Negeri 1 Kisaran tahun 1975, walau tidak seutuhnya, dapat berkumpul di rumah Drs.

Waspada/Nurkarim Nehe

SEBAGIAN alumni SMANSA Kisaran yang bertemu di Medan Sabtu (21/1).

Jufri Muslim di Jalan Tulip Blok L 124, Griya Indah, Helvetia, Medan, Sabtu (21/1). Di antaranya hadir H. Mohd. Rasyid, SH Staff Ahli Wali Kota Medan bidang Hukum dan Politik, Drs. Syawaluddin Hasibuan, MM Ketua KKK (Kerukunan Keluarga Kisaran) Propinsi Riau, Iptu Yakin Pardosi Kasat Pam Objek Vital Polresta Medan, Koordinator H. Sudaryoto dari Kisaran, lalu alumni yang menetap di Jakarta, Bogor, Riau, Aceh, Siantar, Medan, Semarang, Yogjakarta, Surabaya dan sebagainya datang ke Medan. “Medan menjadi pilihan karena lebih dekat dengan bandar udara daripada dilakukan di Kisaran, yang penting niat bertemu selain diiringi rasa silaturahmi yang 37 tahun dalam masa penantian perjumpaan juga memikirkan bagaimana membantu sekolah yang dulu tempat menimba ilmu dan bercanda ria saat remaja,” ujar Ketua Panitia H. Sudaryoto Ketua Panitia

Reuni alumni SMANSA Kisaran tahun 1975 kepada Waspada, Selasa (24/1). Hadir juga alumni 1976, 1977, 1972, 1973, dan 1971. Meski tidak bisa hadir, salah satu alumni pertama SMANSA H. Samsul Bahri Batubara, SH mantan Ketua DPRD Asahan/Ketua Partai Golkar Asahan, berpesan agar para alumni berkenan membantu peningkatan kualitas belajar dan mengajar di SMAN 1 Kisaran. Tuan rumah Drs. Jufri Muslim merasa berbahagia mendapat kesempatan pertama rumahnya menjadi tempat perjumpaan setelah 37 tahun tidak bertemu. “Kami menginginkan adanya pertemuan rutin apalagi di masa usia seperti sekarang ini hendaknya kita semakin bermanfaat bagi diri sendiri, keluarga dan masyarakat,” tutur Jufri. Suasana haru menjalar saat pemotongan nasi tumpeng dan saling menyuapi. Kakek dan Nenek ini, urai Sudaryoto, bahkan ada yang

meneteskan airmata. H. Sudaryoto selaku ketua panitia pun berharap alumnus SMANSA Kisaran yang secara finansial berkemampuan menyisihkan sedikit demi sedikit dana untuk membantu ‘sekolah kenangan’, minimal membantu pemikiran dan pembentukan jaringan. “Kami siap setiap saat dan berharap pada pertemuan lanjutan lebih banyak lagi alumni yang datang sehingga cita-cita semua alumni untuk membentuk Ikatan Alumni SMANSA Kisaran dapat terwujud sebagai wadah silaturahmi sosial dan berguna bagi SMAN 1 Kisaran dan masyarakat,” tutur Iptu Yakin Pardosi. Waktu terus bergulir, regenerasi tetap berjalan hingga tiap manusia memenuhi ‘kontrak fitrahnya’. Semua diukur dengan amal ibadah. * Nurkarim Nehe

Sumatera Utara

WASPADA Jumat 27 Januari 2012

B3

OTK Rusak Pasar Tarutung TARUTUNG (Waspada): Sejumlah bangunan kios dan satu pintu masuk alternatif di pasar tradisional Tarutung (Taput) beberapa minggu terakhir sengaja dirusak orang tidak dikenal (OTK). Proses pembangunan kios dan penutupan pintu masuk pasar tradisionalTarutung diwarnai sikap pro-kontra sesama warga sekitar, khususnya pedagang kaki lima (PKL). Sebab, penutupan satu pintu masuk itu

berdekatan langsung dengan rumah warga yang bekerja sebagai pedagang seharian di pasar Tarutung. Kabid Pasar Tarutung, Elim Sitompul, Rabu (25/1) menjawab wartawan di Tarutung, membe-

narkan kejadian pengrusakan tersebut. Kata dia, pihaknya telah membuatlaporanresmikePolres Taput untuk dilakukan pengusutan secara tuntas. “Pihak Polres telah turun ke TKP. Perkembangan selanjutnya sudah kami serahkan kepada pihak keamanan. Namun yang jelas kami tidak diam, hari ini, Kamis (26/1) tim UPT pasar dibawa komando dinas akan melakukan penutupan pintu masuk pasar yang dirusak,” ujar Sitompul.

Sementara UPT pasar Tarutung, P3 Lumbantobing, yang selama ini dituding sebagai “provokator” oleh sekelompok warga sekitar saat dijumpai di kantornya, Rabu (25/1), tak berhasil dijumpai. Dia malah terkesan menghindari wartawan. Kabarnya, proyek pembangunankiospasartersebutditampung dalam APBD Taput tahun 2011dandikelolaolehDinasCipta Karya Taput. Dan telah diserahkan kepada Dinas Pasar. “Yang berurusan langsung dengan peristiwa pengrusakan

itu adalah Dinas Pasar Taput. Kami hanya sebatas pembangunan fisik proyek, kami tidak mungkin lagi mencampuri itu. Yang terpenting bagi kami proyek tersebut telah selesai 100 persen” ujar Pimpro Sondang Pane, menjawab wartawan, Rabu (25/21). Pantauan Waspada, Selasa (25/1),sedikitnyaduadindingkios bagianbelakangyangterbuatdari beton dan satu pintu masuk yang sudah dipagar beton terlihat sudah bolong. Di belakang kios yang dirusak adalah rumah milik warga. (c12)

Sekda Dairi: Tidak Sekadar Adipura

Waspada/Marolop Panggabean

PINTU pasar Tarutung, yang sudah ditutup dengan cor beton, dirusak orang tidak dikenal.

WN Prancis Tewas SIMPANG EMPAT (Waspada): Warga Negara Asing (WNA) asal Prancis, Dillen Seger Ivan Paul Losi, 35, alamat 7 Boulevard Alben CamusVal Orea Ferancis, tewas di Rumah Sakit Umum (RSU) Efarina, Jalan Djamin Ginting Berastagi, Kab. Tanah Karo setelah muntah akibat mengalami sakit mata dan sakit perut saat berada di dalam penginapan Thalita, Kec. Simpang Empat, Kab. Tanah Karo. Hingga sekarang mayat korban masih di instalasi ruang jenazah menunggu pihak keluarga datang. “Korban sejak Kamis (14/1) kemarin sudah menginap di penginapan Thalita seorang diri. Namun, pada, Selasa (24/1) sekira pukul10:00pagi,korbanmengalamisakitmatasertaperut.Mengetahui pelancong asal Ferancis sakit, Rizal selaku pihak penginapan langsung membawanyakePuskesmasBerastagigunamendapatkanperobatan,” terang Kapolsek Simpang Empat AKP Kandar kepada Waspada, Rabu (25/1) di Polres Tanah Karo. Dikatakannya, usai korban berobat di Puskesmas Berastagi, pihak penginapan langsung membawanya kembali ke penginapan, dan di dalam penginapan korban meminta sarapan bubur. Usai menyatap bubur, korban sempat mengalami gejala muntah-muntah. “Sekira pukul 18:32 malam, korban langsung dilarikan ke Rumah Sakit Umum Efarina, namun korban tidak dapat tertolong, dan sekira pukul 20:00, korban meninggal dunia. Hingga sekarang korban masih berada di ruang instalasi jenazah menunggu pihak keluarga datang, atau perwakilan untuk menjemput korban. Lebih lanjut dikatakannya, barang milik korban yang diperiksa Polsek Simpang Empat, satu unit laptop, HP, lima botol Mansion kosong, 1 Vodka kosong, 3 Coca-cola, satu bungkus putih berisi ganja serta biji, 2 ons tembakau rokok beserta tictac, alat kontrasepsi (kondom) serta identitas atas nama Ivan. (c19)

PP Gema Paluta Bentuk Komisariat Baru Di UMTS GUNUNGTUA (Waspada): Pengurus Pusat Gerakan Mahasiswa Padanglawas Utara (PP Gema Paluta) membentuk komisariat organisasi di Kota Padangsidimpuan, yakni Komisariat Gema Paluta Universitas Muhammadiyah Tapanuli Selatan (UMTS) yang digelar di ruangan Fisipol lantai tiga kampus UMTS, Rabu, (25/1). Syarifuddin Tanjung, Ketua PP Gema Paluta terpilih, didampingi sekretaris Kholil Siregar dan bendahara Elly Rawaty, di sela-sela acara menyebutkan sangat bersyukur, karena telah terbentuknya komisariat Gema Paluta di UMTS. “Kami sangat bangga dan bersyukur atas dipercayakannya kepada kami untuk menggerakkan roda organisasi Gema Paluta di komisariat UMTS,” sebut mereka. Ketua Umum PP Gema Paluta, Anwarsyah Siregar didampingi Sekjen Nuamir Habibi Tanjung mengatakan, sangat mengapresiasi rekan-rekan juang mahasiswa di UMTS dengan antusiasnya mereka sehingga terbentuk komisariat di kampusnya, dan berharap akan membawa nama Gema Paluta yang lebih baik lagi berjalan sesuai dengan koridornya. “Kami juga sangat bersyukur karena telah membentuk komisariat di wilayahTapanuli Bagian Selatan (Tabagsel) yang merupakan pertama kalinya sejak Gema Paluta ini ada. Dan ke depan, diharapkan menambah komisariat di Universitas STAIN dan juga UGN,” jelas Anwar. Sementara, Gusti Putra Hajoran Siregar, SE, yang juga mantan ketua umum Gema Paluta mengucapkan selamat kepada yang terpilih sebagai pengurus dan Komisariat UMTS yang merupakan sayap organisasi dapat memberikan pengaruh besar di Gema Paluta dan dapat menjalankan fungsi mahasiswa sebagi sosial kontrol khususnya di wilayah Tabagsel. (a35)

Ulil Fadil Jadi Kadis PU Palas SIBUHUAN (Waspada): Ir Ulil Fadil Nasution, MM dilantik menjabat Kepala Dinas Pekerjaan Umum, Pertambangan dan Energi Padang Lawas (Palas) menggantikan Ir Chairul Windu. Pelantikan dilasanakan di Aula Kantor Bupati, Rabu (25/1) sore, oleh Bupati Palas H. Basyrah Lubis, SH. Ulil Fadil dilantik bersama Drs Ramal Guspati Pasaribu yang dilantik sebagai Penjabat Assiten I Bidang Pemerintahan dan Sahmardan Pulungan, SE sebagai Kaban Lingkungan Hidup. Dalam sambutannya, bupati mengatakan pergantian tersebut merupakantuntutanpengembangandanpenyegaranorganisasi.Untuk itu Bupati meminta agar para pejabat yang baru dilantik telah memiliki program dan melaksanakan sasaran pekerjaan yang akan diterapkan. Dalam kesempatan itu, secara khusus bupati menegaskan agar setiap PNS di Palas jangan terlibat dalam hal politik, karena PNS adalah pelayan masyarakat yang harus turut menjaga kekondusipan daerah. “Sebagai Bupati yang hingga saat ini masih syah, saya menegaskanagarPNSjanganikut-ikutanberpolitik,”tegasBupati.(a34)

FB-LMP Akan Didirikan Di Pakpak Bharat PAKPAK BHARAT (Waspada): Forum bersama Laskar Merah Putih (FB-LMP) Kab. Pakpak Bharat akan didirikan di wil. Kab. Pakpak Bharat. Hal itu disampaikan Jun Sahata Cibro, pemegang Mandat FB-LMP No; 005/SM-MD/FB-LMP/SU/I/2012 kepada wartawan, Rabu (25/1). Dikatakan Jun, pihaknya segera menyelesaikan struktur Pimpinan Cabang FB-LMP Kabupaten Pakpak Bharat. “Beberapa unsur kita telah lakukan koordinasi dan kita akan kordinasi dengan pihak Pemerintah Daerah dan TNI/Polri serta tokoh masyarakat/agama,” ungkapnya. Dikatakan Jun didampingi Henri Berutu, juga selaku pemegang mandate, diharapkan dukungan penuh dari semua pihak sehingga sebagaimana tujuan organisasi.(csb)

SIDIKALANG (Waspada): Sidikalang, Kab. Dairi, diproyeksikan menjadi kota Adipura . Namun, bukan piala atau sertifikat Adipuranya,yang perlu.Yang diperlukan adalah bagaimana agar Sidikalang semakinbersih,ujarSekdaDairiJuliusGurning,S.Sos kepadaWaspada, Rabu (25/1). Menurut Gurning, tujuan utama adalah membuat kota Sidikalang semakin bersih mengingat daerah itu sebagai kota transit pariwisata yang perlu menunjukkan wajah yang berseri. “Tetapi kalau bisa sampai meraih Piala Adipura, semakin baik.” Dalam meningkatkan kebersihan masih banyak ditemukan kendala termasuk di antaranya penanggulangan sampah. Begitu juga lokasi pekuburan umum yang terletak di Jalan Sakti. Beberapa drainase juga merupakan kendala. Di antara beberapa agenda kerjanya setelah dilantik menjadi Sekda, 11 Januari 2012, Gurning mengatakan akan mendiskusikan hal itu dengan Dinas Cipta Karya dan Bina Marga selaku instansi terkait dalam penanggulangan kebersihan termasuk memberi pencerahan kepada warga, sebab tanpa dukungan masyarakat kecil kemungkinan kebersihan Sidikalang dapat meningkat. Tentang Sidikalang kota transit pariwisata, Gurning menjelaskan, kota tersebut sebagai jalur penghubung antara Medan dengan Aceh Singkil hingga Tapaktuan dan penghubung Tanah Karo dengan Pangururan. Jadi, kota Sidikalang dapat juga dimanfaatkan sebagai kota transit pariwisata sebelum melanjutkan perjalanan ke daerah lain.(a20)

IRT Tewas Digilas Bus PEMATANGSIANTAR (Waspada): Ibu rumah tangga (IRT) pegendara sepedamotor, Anggiat P Rumahorbo, 41, petani, warga Desa Martoba, Kec. Simanindo, Kab. Samosir tewas diduga sesudah tubuhnya digilas satu unit mobil bus. InformasiWaspada himpun, Rabu (25/1), korban mengenderai sepedamotor Honda Supra Fit BK 6759WI diduga digilas bus Sejahtera dikemudikan JS, 45, warga Jalan Bah Lias Kiri, Kel. Sigulanggulang, Kec. Siantar Utara, Kota Pematangsiantar di jalan umum km 39-40 jurusan Pematangsiantar-Parapat di Dusun Hubuan, Desa Sibaganding, Kec. Girsang Sipangan Bolon, Kab. Simalungun, Selasa (24/1) pukul 16:00. Korban tewas digilas bus

Sejahtera ketika sepedamotor dikemudikannya melaju dengan kecepatan tinggi dari arah Pematangsiantar menuju arah Parapat. Ketika tiba di tempat kejadian, sepedamotor korban berupaya mendahului satu unit kendaraan di depannya. Namun, korban terpaksa mengerem mendadak, karena bus Sejahtera melaju dari arah berlawanan. Akibat mengerem secara mendadak itu, sepedamotor korban kehilangan kesimbangan dan korban terjatuh bersama sepedamotornya. Saat itulah, bus Sejahtera yang tetap melaju, menggilas tubuh korban. Akibatnya, korban mengalami luka berat dan langsung tewas di tempat kejadian. Warga melihat kejadian itu segera menahan bus Sejahtera

dan berupaya melakukan pertolongan terhadap korban. Namun, korban saat itu sudah meninggal sehingga Sat Lantas Polres Simalungun yang tiba di tempat kejadian segera membawa korban ke RSUD Dr. DjasamenSaragihgunakeperluan visum, sedang pengemudi bus Sejahtera bersama sepedamotor korban dan bus Sejahtera diamankan ke Pos Lantas Parapat. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Ipda Alsem Sinaga, Rabu (25/1) menyebutkan kecelakaan lalulintas yang mengakibatkan korban jiwa itu masih dalam penyelidikan. (a30)

Revisi SK Menhut Tunggu DPR RI SIMALUNGUN (Waspada): Pemkab Simalungun, melalui Dinas Kehutanan daerah itu, mengusulkan revisi SK (Surat Keputusan) Menhut (Menteri Kehutanan) Nomor 44 Tahun 2005. Usulantersebutsudahdisampaikan pada 2010 lalu ke Kementerian Kehutanan dan kini tinggal menunggu persetujuan DPR RI. Revisi SK Menhut Nomor 44 Tahun 2005 tersebut akan menentukan luas kawasan hutan negara yang sesungguhnya di Kab. Simalungun. KepadaWaspada, Kamis (26/ 1), Kepala Dinas Kehutanan Kab. Simalungun, JanWanner Saragih mengatakan, usulan revisi SK Menhut Nomor 44 Tahun 2005 sudah diajukan Kementerian Kehutanan untuk mendapat persetujuan DPR RI. Pemkab Simalungun berharap DPR RI dapatmenyetujuirevisidimaksud

pada tahun ini, sehingga ada kepastian hukum terhadap lahan yang selama ini sudah terlanjur menjadi kawasan pemukiman penduduk, perkebunan dan perkantoran pemerintah. DiterangkanSaragih,jikarevisi SK Menhut Nomor 44 Tahun 2005itudisetujuiolehpemerintah danDPRRI,makakawasanhutan negara di bumi habonaron do bona bakal berkurang sekira 40 ribu hektar.“Pemkab mengusulkandikeluarkannya40ribuhektar lahan yang berada di sejumlah kecamatan termasuk di ibukota kabupatendiPamatangRayadari kawasan hutan negara, karena sudah menjadi pemukiman dan sudah dibangun kantor pemerintahan,” papar Saragih. Menurutnya, dengan dikeluarkannya 40 ribu hektar lahan yang selama ini termasuk dalam kawasan hutan negara, maka luas

kawasan hutan di Kab. Simalungun dari sebelumnya sekitar 130 ribu hektar akan menjadi 90 ribu hektar lebih. Menanggapi usulan tersebut, Wakil Ketua DPRD Simalungun, Ojak Naibaho, berharap Pemerintah Pusat dan DPR RI mengakomodir usulan revisi SK Menhut Nomor 44 Tahun 2005. Hal ini untuk mendukung pengembangan pembangunan daerah serta kepastian hukum terhadap lahan-lahan dimaksud. “Kita berharap Pemerintah Pusat dan DPR RI mengabulkan revisi SK Menhut Nomor 44 Tahun2005yangdiusulkanPemkab Simalungun,sehinggapemerintah daerahmendapatkepastianuntuk mengembangkanpembangunan daerah, karena sudah ada kepastian lahan yang dapat dimanfaatkanpemerintahdanmasyarakat,” kata Naibaho. (a29)

Pemko Sibolga Biayai Pengobatan Penderita Tumor SIBOLGA (Waspada): Pemerintah Kota Sibolga menanggung biayapengobatanRosmiatiWaruwu, 43, penderita tumor di kepala. Warga miskin ini diberangkatkan untukberobatkesalahsaturumah sakit di Medan, Selasa (24/1). Ini dilakukan sebagai bentuk pertanggungjawaban moral dalam membantu kesehatan keluarga kurang mampu di daerah itu. Warga yang diberangkatkan itu seorang miskin dengan status janda tujuh anak. Dia sehari-hari berjualan ikan dari rumah ke rumah.Keberadaannyadiketahui berkat laporan salah seorang Kepala Lingkungan (Kepling), di Kelurahan Aek Habil. Camat kemudian mendatangi rumah Rosmiati dan langsung melaporkannya kepadaWali Kota Sibolga. “Laporan ini langsung diresponWali Kota. Dan untuk itu, saya sampaikan terimakasih karena Wali Kota Sibolga atas nama Pemko Sibolga bersedia memfasilitasi pengobatan Rosmiati hingga akhirnya dirujuk ke salah satu rumah sakit di Medan,” kata Camat Sibolga Selatan Sahat Simatupang menjawab wartawan. Hadir untuk memberangkatkan Rosmiati menjalani perobatan ke Medan,Wali Kota Sibolga Syarfi Hutauruk, Kepala Dinas

Kesehatan M. Yusuf Batubara, Direktur RSU FL Tobing Tunggul Sitanggang dan Dokter Puskesmas Aek Habil Julia Siska. RosmiatiWaruwu mengungkapkan, penyakit ini telah diidapnya sekira enam tahun. Bermula dari benjolan kecil di kepala yang kemudian membesar. “Maret 2011, sayapernahberobatkeRSU FL Tobing Sibolga dan pihak rumah sakit langsung merujuknya untuk berobat ke Rumah Sakit

AdamMalikMedan,”kataRosmiati. Wali Kota Sibolga Syarfi Hutauruk mengimbau kepada seluruh warga Kota Sibolga, baik orang kaya, miskin, pejabat, maupun warga biasa, supaya rutin memeriksakan kesehatan ke Puskesmas dengan biaya gratis. “Pemeriksaan kesehatan perludilakukangunamengetahui kondisi kesehatan kita, jika gejala penyakit telah ada, supaya dapat diantisipasi,” tandasnya. (a24)

Waspada/Ist

WALI KOTA Sibolga Syarfi Hutauruk menjenguk Rosmaini Waruwu,penderita tumor di kediamannya sebelum diberangkatkan ke salah satu rumah sakit di kota Medan , Selasa (24/1).

Waspada/Ahmad Cerem Meha

RUAS Jalinsum di Jalan SM Raja Banjar Tanggal menghubungkan Kelurahan Batunadua, Kota Padangsidimpuan masih digenangi air hujan.

Jalinsum Kota P. Sidimpuan ‘Amburadul’ P. SIDIMPUAN (Waspada): Ruas Jalan Lintas Sumatera (Jalinsum) dikeluhkan warga Kota Padangsidimpuan karena masih ‘amburadul’, tepatnya di Jalan SM Raja, Banjar Tanggal menghubungkan Kelurahan Batunadua. Amatan Waspada, kondisi ruas Jalinsum tersebut berlobang, ditempeli aspal dan tanah. Bilahujanlobangjalankembalidigenangiairseperti kolam ikan, bila musim kemarau kondisinya berabu tebal dan rawan kenderaan macat. ‘’Kami sudah lelah melintasi ruas jalan ini, setiaptahunkondisinyatetaptidakadaperubahan. Sedangkan akhir tahun yang lalu sudah diperbaiki dinas PU provinsi, namun tidak bertahan lama ruas jalan ini kembali digenagi air hujan,’’ ujar Sisolkot Pulungan, 37, warga Batunadua yang melintas di lokasi.

Kadis Binamarga Tingkat I Sumatera Utara, Ir Marapinta Harahap dikonfirmasi melalui teleponnya menyebut akan memperhatikan ruas Jalinsum di Kota Padangsidimpuan. ‘’Nanti saya sampaikan kondisi ruas Jalinsum di Kota Padangsidimpuan kepada Balai Jalan Nasional,’’ ujar Marapinta kepada Waspada, Rabu (25/1) sore. Anggota DPRD Kota Padangsidimpuan, Sopian Harahap mengakui rusaknya Jalinsum diakibatkan dugaan mark-up dinas yang menangani rehab dan pemeliharaan Jalinsum. ‘’Kita mensinyalir ada dugaan korupsi yang menjamur di dinas yang menangani pemeliharaan Jalinsum di Kota Padangsidimpuan. Harapan kita aparat hukum memanggil dinas terkait itu, mengapa pemeliharaan jalan tidak maksimal,’’ ungkap Sopian.(c13)

Radio PROXY FM STAIN Kreatifitas Mahasiswa Dan Dosen PADANGSIDIMPUAN (Waspada): Ketua STAIN Padangsidimpuan Dr. H. Ibrahim Siregar, MCL, membuka secara resmi Praktek Penyiaran Lapangan (PPL) mahasiswa semesterVII Jurusan Dakwah di Radio Proxy FM STAIN Padangsidimpuan,Selasa(24/1).ProxyFMSTAINhasilkreatifitas dosen dan mahasiswa Jurusan Dakwah. Dalamacaraitu,Ibrahimmengatakan,kegiatan PPL ini ajang bagi mahasiswa untuk mempraktikkan ilmunya yang telah diikuti dalam perkuliahan. Dia berharap agar mahasiswa Jurusan Dakwah yang akan mengikuti PPL menjadi komunikatorkomunikator andal STAIN Padangsidimpuan ke masyarakat. Ke depan, katanya, STAIN akan terus melakukan penambahan fasilitas yang dibutuhkan khususnya di Jurusan Dakwah STAIN Padangsidimpuan sebagai upaya yang terus-menerus dilaksanakan dalam kaitan proses peningkatan status STAIN Padangsisimpuan menjadi IAIN. Kegiatan PPL tahun ini merupakan kegiatan

perdana PPL yang dilaksanakan di radio Proxy FM yang dalam masa ujicoba siaran setelah mendapat izin penyelenggaraan penyiaran dari Komisi Penyiaran Daerah Sumatera Utara (KPIDSU), menurut Ketua STAIN, PPL mahasiswa Jurusan Dakwah tahun ini mengalami kemajuan. karena selama ini dilaksanakan di berbagai stasiun radio di Tapanuli Bagian Selatan, momen ini dimanfaatkan Lab. Jurusan Dakwah sebagai tempat PPL mahasiawa Jurusan Dakwah untuk mengisi masa ujicoba siaran. Dosen Pembimbing Barkah Hadamean Harahap, yang juga Programm, PR dan Marketing Manajer Radio Proxy FM STAIN Padangsidimpuan, mengatakan kegiatan PPL ini diikuti 18 mahasiswa, akan melaksanakan praktik di bidang broadcasting, jurnalistik radio dan manajemen produksi siaran radio, yang kesemua program acaranya di Proxy FM STAIN Padangsidimpuan itu merupakan hasil kreatifitas dosen dan mahasiswa Jurusan Dakwah. (a26)

Diduga Rebutan Perempuan

PNS Paluta Tewas Dikeroyok Di Cafe PANDAN, Tapteng (Waspada): Oknum Pegawai Negeri Sipil (PNS) di Dinas PU Paluta dan mantan Bendaharawan di Dinas PUTapteng, IN, 44, tewas diduga dikeroyok karena rebutan perempuan di salahsatu cafe JalanTerminal Baru, Dusun IV, Desa Bona Lumban, KecamatanTukka, Selasa (24/1) subuh, sekira pukul 01:00. Informasi dihimpun Waspada di Mapolsek Pandan, Kamis (26/1), korban dan para pelaku sudah sama-sama mabuk minuman beralkohol di cafe tersebut. Saat itu korban sedang duduk berdampingandengansalahseorangperempuan, tiba-tiba seorang pelaku berdiri dan mengajak perempuan tersebut berjoget, namun dilarang korban. Tidak terima , pelaku spontan menonjok muka korban hingga kemudian menganiaya dengan membabi buta dibantu rekan pelaku. Kapolres Tapteng, AKBP Dicky Patria Negara SIKdidampingiKapolsekPandan,IptuEdiSidauruk kepada wartawan di Mapolsek Pandan membenarkanperistiwapengeroyokandimaksud mengakibatkan seorang meninggal dunia. “Benar telah terjadi penganiayaan di sebuah cafe di Jl Terminal Baru, Desa Bona Lumban, Kec. Tukka. Dan sejauh pemeriksaan, penyebab penganiayaan karena rebutan perempuan,” kata Kapolres. Korban , lanjutnya, sempat dibawa ke Rumah Sakit Umum Pandan untuk mendapatkan perawatan, namun nyawanya tidak tertolong. “Saat ini kepolisian bekerja keras mengungkap para pelaku, dan sudah melakukan pemeriksaan terhadap tujuh saksi, termasuk gadis rekan korban dan pelayan kafe. Kita sudah memintai keterangan para saksi-saksi yang mengetahui dan melihat kejadian, dan saat ini identitas pelaku sudah kita ketahui,” tegas Kapolres. Saksi mengungkapkan, IN mendapat penganiayaan berupa tangannya dipelintir. Korban kemudian ditarik ke luar. Ditendang dan dihantam membabi-buta. Penganiayaan hanya berlangsung singkat. Sekira 10 menit. Lalu korban menghembuskan napas terakhir sesaat akan dibawa ke rumah sakit. Salah seorang saksi mata yang tidak mau disebut namanya kepada wartawan di Sibolga, Rabu (25/1) siang, mengungkapkan, dia sudah memberikan keterangan ke penyidik Polsek Pandan itu, korban dianiaya di hadapan oknum polisi berinisial Briptu P, namun Briptu P tidak

sedikit pun melerai. Setelah 10 menit berlalu, para pelaku dan oknum polisi tersebut hilang meninggalkan jejak dari lokasi kejadian. “Hanya saya yang tinggal bersama beberapa orang pelayan cafe, kemudian kami membawa korban ke rumah sakit untuk mendapatkan pertolongan. Hanya sebelum tiba di rumah sakit, korban sudah tidak bernyawa,” tukas sumber tersebut dengan sedikit trauma didampingi orangtuanya dan keluarganya yang seorang anggota TNI. Kapolres Tapteng AKBP Dicky Patria Negara SIKdidampingiKapolsekPandan,IptuEdiSidauruk di Mapolsek Pandan, Selasa (24/1) mengaku akan mendalami keterlibatan seorang oknum polisi dalam kasus tersebut. Saat ini pihaknya masih melakukan pengumpulan bukti-bukti guna pendalaman kasus. Kalau memang terbukti bersalah, Kapolres bilang tidak akan melindungi anggotanya dan akan memprosesnya hingga ke pengadilan. SementaraKapolsekPandan,IptuEdiSidauruk yang dikonfirmasi wartawan, Rabu (25/1) terkait pemeriksaan saksi-saksi mengatakan sudah memeriksa delapan saksi, di antaranya pengusaha cafe dan pelayan cafe serta oknum polisi tersebut sertarekankorban.“Sudahdelapansaksidiperiksa,” katanya. Tetapi apakah pelaku sudah tertangkap? “Belum,” ujar Kapolsek. Pihaknya masih terus melakukan pengejaran yang saat ini diperkirakan masih berada di wilayah Sibolga. “Kita sudah tahu siapa pelakunya, saat ini masih dalam pengejaran,” ucapnya. Di JlTerminal Baru, Dusun IV, Desa Bona Lumban, KecamatanTukka,TapanuliTengah (Tapteng) banyak berdiri café yang buka malam hari dengan dihunipelayangadiscantik.Umumnyapelayanitu didatangkan dari luar kota oleh pemilik cafe. Selainmenyediakanberbagaiminumankeras, di cafe tersebut juga disediakan musik ala tarian hot memancing birahi. Dan informasinya, pelayan di cafe tersebut bisa diajak naik ke bulan setelah terjadi kesepakatan harga. Sebelumnya, Forum Lintas Iman Peduli Tapteng (Forlipta) yang digagas para tokoh agama dan didukung Bupati Tapteng, Raja Bonaran Situmeang, telah menegaskan dan meminta cafecafe tersebut ditutup, karena merusak moral generasi muda. (tim)

Sumatera Utara

B4

WASPADA Jumat 27 Januari 2012

Ormas Islam Batubara Kutuk Pemotongan Bantuan Masjid LIMAPULUH(Waspada): Umat Islam Batubara melalui sejumlah organisasi kemasyarakatan (Ormas), bereaksi atas pemotongan dana bantuan dari Pempropsu untuk 200 masjid yang diduga dilakukan oknum Dewan Masjid Indonesia Kab. Batubara. Ketua Pengurus Daerah Pemuda Muhammadiyah (PDPM) Kab. Batubara Taufik Abdi Hidayat, S.Soskepada Waspada,Kamis (26/1) mengatakan, terus memantau perkembangan berita pemotongan dana bantuan masjid ini dari media. Secara tegas ia mengecam tindakan pemotongan dana untuk rumah ibadah ini, lebih-lebih disebut-sebut dilakukanoleh oknum yang termasuk dalam DMI yang notebene mengetahui rambu-rambu sesuai ajaran agama. “Tidak ada alasan atau kilah apapunyangdapatmenghalalkan pemotongan dana untuk rumah ibadah, apalagi kalau dikatakan ganti biaya operasional pengurusan dana. Kami dari PDPM mengutukkeraspelakunyajikabenar itu terjadi dan tindakannya itu

adalahaibbagidirinyasendiridan bukan cerminan umat islam secara keseluruhan,” tandasTaufik. Sementara itu ketua GP AnsorKec.LimapuluhMazlanmengharapkan, sejumlah pengurus masjid dan mushala yang menerima bantuan ini semestinya menolak menerima bantuan jika diketahuiadapemotonganataupun tidak menerima jika tidak sesuai dengan yang ditandatangani. Seperti pengurus masjid Istiqomah Desa Lubuk Besar, Kec. Limapuluh yang ditemuinyaWagiman.KepadaMazlan,Wagiman mengaku telah mendengar isu pemotongan dana ini dan berkomimen tidak akan menerima dana itu jika ada pemotongan. Hal sama disampaikan mantan Kepala Desa Gambus Laut Zaharudin yang mengatakan di

Wabup Sergai Resmikan Griya Kompos PEGAJAHAN (Waspada): Wakil Bupati Serdang Bedagai Ir. H. Soekirman meresmikan Griya Kompos Kelompok Tani Sari Karya dirangkai temu kangen bedah budaya Paguyuban Pujakesuma Kab. Serdang Bedagai, di Desa Suka Sari Kec. Pegajahan, Selasa (24/1). Hadir Ketua GOPTKI Sergai Ny. Hj. Marliah Soekirman, Kadis Pertanian dan Peternakan Setyarno, SP, Kabag Humas Sergai Drs. H. Mariyono, SP, Camat Pegajahan Misran, SE, Kepala Desa Suka Sari Kartimin, Tokoh Masyarakat, Aliansi Pemuda Indonesia (API), parapengurusdananggotaPaguyubanPujakesumadari17kecamatan se Kab. Serdang Bedagai. Rumah pupuk kompos kelompok Sari Karya tersebut merupakan tanah milik Kartimin yang telah dihibahkan kepada kelompok tani, kemudian dibangun rumah pupuk kompos oleh Dinas Kehutanan dan Perkebunan Pemkab Serdang Bedagai, dengan luas tanah keseluruhan 15x20 meter dan bangunan seluas 8x10 meter. Dalam sambutanWabup H. Soekirman mengimbau masyarakat untuk taat membayar Pajak Bumi dan Bangunan (PBB) karena sumber dana terbesar yang digunakan untuk pembangunan adalah dari hasil pajak. Wabupjugamengatakandengantaatmembayarpajakdiharapkan pemerataan pembangunan dapat dirasakan hingga ke desa-desa terpencil. Apalagi saat ini desa bukan lagi sebagai bagian bawahan karena telah memiliki hak atas Anggaran Dana Desa (ADD) yang diperuntukkan untuk pembangunan desa seperti pembangunan jalan, saluran sanitasi desa dan saluran irigasi untuk pertanian. Sebelumnya Wabup H. Soekirman menghadiri temu kangen bedah budaya Paguyuban Pujakesuma. Membaurnya warga dari Mabmi dan suku Batak pada acara Temu kangen bedah budaya khususnya budaya Jawa tersebut, menandakan bahwa persatuan dan kesatuan di Sergai sangat baik.(a08)

Kajari Ajak KNPI Batubara Kerjasama Pembinaan Hukum LIMAPULUH (Waspada): Kepala Kejaksaan Negeri (Kajari) Kisaran/Batubara Anthony T, SH mengajak jajaran PD KNPI Kabupaten Batubara bekerjasama melakukan pembinaan hukum di kalangan pemuda daerah ini. Hal itu dikatakan Ketua DPD KNPI Batubara, Syafrizal kepada Waspada di Limapuluh, baru-baru ini, menanggapi hasil audiensi KNPI Batubara ke Kajari Kisaran/Batubara. Audiensi dipimpin Syafrizal itu dilaksanakan, di ruang kerja Kajari. Turut mendampingi Kajari, Kasi Intel Budi P, SH. Sedang Syafrizal didampingiWakil Ketua KNPI Batubara Amin Mukti Atmaja Nasution, SE, Wakil Sekretaris Taufik Abdi Hidayat, SSos, Yusriadi Sitorus, Khairul Amri.Wakil Bendahara Harmoko dan Komisi Riset/ Penelitian Hendri Nopel Harahap. Kajari mengatakan, generasi muda khususnya KNPI sangat potensial dalam meningkatkan kesadaran hukum masyarakat. “Karenanya, Kejaksaan Negeri daerah ini mengajak KNPI proaktif melakukanpembinaanhukumdikalangangenerasimudabekerjasama denganjajaranKejari,”ujarKajarisebagaimanayangditirukanSyafrizal. Dikatakan, audiensi ini juga dimaksudkan menjalin silaturahim antara KNPI Batubara dengan jajaran Kejari Kisaran/Batubara. KNPI Batubara, menurut Syafrizal menyambut baik ajakan kerjasama jajaran Kejari ini dan akan menindaklanjutinya mulai waktu dekat ini.KajarijugamenyambutbaikaudiensiyangdilakukanKNPIBatubara itu, tutur Syafrizal. (c04)

Warga Perupuk Sambut Baik Upaya Peningkatan Jalan PERUPUK, Batubara (Waspada): Jalan ke Pantai Sejarah Perupuk Kec. Limapu luh Batubara akan ditingkatkan melalui dana APBD Batubara 2012 sepanjang 750 meter Rp350 juta. Warga Perupuk, menyambut baik upaya Pemkab Batubara membenahi lokasi wisata pantai dengan membangun jalan masuk yang selama ini jalan tanah pasir Namun tidak jelas peningkatan jalan itu, apakah berupa pengerasan, rapat beton/cor, atau pengaspalan. Untuk APBD Batubara TA 2012, Kec. Limapuluh mendapat dana sebesar Rp7,4 miliar, diantaranya desa Perupuk yang dialokasikan atas pembangunan jalan ke Pantai Sejarah Rp.350 juta, rehab pintu klep Rp.200 juta, dan pembuatan jembatan plat duiker di Kampung Alur Rp100 juta. (a12)

Gambus Laut seharusnya ada sembilan desa penerima, namun baruduayangdisalurkan.Masingmasing satu masjid menerima Rp23 juta dan mushala Rp 13 juta. Padahal,menurutZahar,seharusnya rumah ibadah itu menerima Rp 25 juta dan Rp15 juta.“ Dana itu diserahkan tunai kepada pengurus masjid dan muhsala di Bank Sumut Limapuluh, namun kemudian diserahkan kepada oknum DMI,” kata Zahar. Unit Masyarakat Pemantau Anggaran (Umar) Batubara Kamaluddin kepada Waspada mengatakan, meminta kepada aparat penegak hukum untuk segera melakukan pengusutan atas adanya dugaan pemotongan dana bantuan masjid ini. Karena kalau

memang benar oknum ini pelakunya,memanglatarbelakangnya sudah dikenal luas oleh masyarakat Batubara. “ Ia sudah beberapa kali tersandung hukum gara-gara masalahuang,”kataKamaluddin. Selain itu, pengurus BKM MasjidAlfalahDesaDahariIndah, Kec. Talawi, Hamzah kepada Waspada melalui ponselnya menyampaikan kekecewaannya atas proses penyaluran bantuan kepadamasjidmereka.Sebabsaat pendataanmasjidpenerimabantuan dan seremonialnya di Medanmasjidnyamegikuti,termasuk foto pengurus, membuka rekening dan sebagainya sehingga seluruh dokumen lengkap. Namun saat acara Plt Gubsu di Kisaran baru - baru ini ternyata masjidnya

Tipu Dua CPNS, Oknum Pegawai Kemenag Dituntut 1 Tahun LUBUKPAKAM (Waspada): Berjanji bisa mempekerjakan sebagai pegawai negeri sipil di lingkungan Kementrian Agama, oknum guru di Madrasah Tsanawiyah Desa Dagang Krawang, Kec. Tanjungmorawa, Ha, 34, warga Dusun III, Desa Dagang Kelambir,dituntut1tahunpenjara oleh jaksa Siti Chairani, SH di Pengadilan Negeri (PN) Lubukpakam, Selasa (24/1). Akibat perbuatan terdakwa, saksi korban Sufriyani, S.Pd, 33, wargaKomplekSetiaSerbelawan, Kec. Dolok Batu Nanggar, Kab. Simalungun dan Sri Nilasari, 31, warga, Huta IV, Nagori Padang Maimu,Kec.DolokBatuNanggar, Kab. Simalungun, dirugikan masing-masingRp40jutadengan total kerugian Rp80 juta. PerbuatanitudilakukanJumat(3/6-2011) pukul 14:30, di Dusun II, Desa Dagang Kelambir, Kec. Tanjungmorawa. Sebelumnya, sekitar bulan

Oktober 2009, saksi Halimah Simatupang mengikuti sertifikasi guru jalur pendidikan di Institut Agama Islam Negeri (IAIN) dan berkenalan dengan terdakwa yang juga mengikuti sertifikasi. Selanjutnya awal Desember 2009, terdakwa menawarkan jasa kepada Halimah dan temanteman kuliah termasuk korban Sufriyani dan Sri Nilasari, bahwa dia dapat mengurus dan memasukkan siapa saja yang mau jadi PNS di lingkungan Kementrian Agama dengan biaya Rp65 juta. Uang muka yang harus diserahkan Rp25 juta, sisanya setelah SK ke luar. Kemudian15Desember2009, saksi korban Sri Nilasari dan Sufriyani, masing-masing menyerahkan uang Rp25 juta di rumah terdakwadanmengatakanSKPNS ke luar Maret 2010. Namun terdakwa minta uang tambahan masing-masing Rp15 juta, Jumat (13/5-2010), dengan alasan pe-

sesudahbibityangditanammasih berumur dua minggu, tiba-tiba banyak bibit mati akibat diserang keong mas. Serangan hama keong mas

ngurusyanglamasudahmeninggal, uang tambahan akan diberikan kepada pengurus baru. Ternyata janji terdakwa Ha tidak terkabul, sehingga kedua korban melapor ke Polsek Tanjungmorawa, Jumat (3/6). Sejak ditangani pihak kepolisian hingga persidangan, terdakwa Ha berstatus tahanan kota. Pada persidangan itu, terdakwa meminta kepada majelis hakim agar menjaga nama baiknya dan tidak dipublikasikan melalui media karena dia seorang PNS. Mendengar hal itu, majelis hakim mengatakan seluruh haknya sebagai terdakwa sudah diberikan, sedang persidangan itu terbuka untuk umum. “Kami tidakadawewenangmenghalangi siapa saja yang meliput persidangan, karena sidang ini terbuka untuk umum,” tegas majelis hakim dipimpin Pontas Effendi, SH, hakim anggota Yogi Arsono, SH, KN dan Ahmad Yani, SH.(a07)

Batangtoru Segera Miliki SMK Pertambangan BATANGTORU (Waspada): Masyarakat Kec. Batangtoru, Kab. Tapanuli Selatan dan sekitarnya akan memiliki Sekolah Menengah Kejuruan (SMK) khusus jurusan Pertambangan. “SMK Pertambangan tahun ini akan kita buka di Batangtoru. Tujuannyaagardapatmemenuhi kebutuhan tenaga kerja lokal dengan keahlian khusus di PT Agincourt, yang tahun ini hingga 20 tahun ke depan melakukan eksploitasi pertambangan emasnya,” kata Bupati Tapsel, Syahrul M. Pasaribu, Selasa (23/1). Dijelaskan, SMK Pertambangan dibangun di atas lahan yang dihibahkan masyarakat Desa

Sipette di sekitar kawasan objek wisata sungai Parsariran. Bupati Tapsel sangat berterimakasih dan mengapresiasi sikap masyarakat yang mau menghibahkan tanah tersebut. Penerimaan siswa baru pertama kalinya akan dibuka untuk tahun ajaran 2012/2013 pada bulan Juni mendatang. Sembari menunggu gedung dan sarana prasarana sekolah dibangun, untuk sementara siswa akan menumpang belajar di lokal SD yang berada di samping kantor Camat Batangtoru. “Tahun ini Pemkab Tapsel akan mengalokasikan anggaran pembangunan gedung SMK Per-

Partai Demokrat Siap Jaring Cawalkot P. Sidimpuan P. SIDIMPUAN (Waspada): DPC Partai Demokrat Kota Padangsidimpuan telah membentuktimuntukmenjaringpasangan CalonWali Kota/WakilWali Kota yang akan diusung pada Pemilukada akhir tahun ini. “Tim telah terbentuk. Saat ini sedangmempersiapkanprosespenerimaanpendaftaranyangInsya Allah dibuka 1 Februari hingga 1 Aprilmendatang,”kataKetuaDPC PDPadangsidimpuanKhoiruddin Nasution, SE, Selasa (23/1). Sebagai satu-satunya partai politik yang tanpa koalisi bisa mengusung pasangan bakal Cawako/Cawawako, Partai Demokrat merupakan yang pertama membuka pendaftaran bagi calon peserta Pemilukada Padangsidimpuan 2012. Susunan tim yang telah dibentuk itu, Ketua Yul Asmara

Pane, SE,Wakil Ketua Parlaungan Tambunan, SE, Sekretaris Abdul Azis Nasution, SH,Wakil Sekretaris Rina Astuti Harahap, SE, dan Bendahara Samuil Nasution. Tim membuka pendaftaran dan pengambilan formulir persyaratan mulai 1 Februari hingga 1 April di kantor sekretariat DPC Partai Demokrat Kota Padangsidimpuan, Jalan Kenanga No. 111 atau depan Kantor Bupati Tapsel. Bagi yang ingin tahu informasi lengkapnya, hubungi Yul Asmara di 081286212982. “Kepadamasyarakatluasyang inginmendaftarsebagaibakalcalon peserta di Pemilukada Padangsidimpuan,tidakadasyaratlainkecuali persyaratanyangtelahditetapkan TimPenjaringan,”jawabKhoiruddin ketika ditanya apakah ada persyaratan khusus pada pendaftaran tersebut.(a27)

Hama Keong Mas Resahkan Petani SORKAM BARAT, Tapteng (Waspada): Hama keong mas yang melanda tanaman padi warga Sorkam Barat sangat meresahkanpetani,sementarapihak Pemkab Tapteng melalui Dinas Pertanian kurang tanggap. Sedangkan kerugian materi para petani, ratusan ribu rupiah per petak. Hasil informasi Waspada di lapangan, Selasa (24/1), awalnya petani yang bercocok tanam di areal persawahan Sorkam Kanan dilakukan serentak. “Awal Desember tahun 2011 lalu, kata Saharan Simatupang, warga Kel. Sorkam Kanan. Menurut Sahran, bercocok tanam secara serentak untuk menghindari tanaman dari serangan hama lain, termasuk menyesuaikan cuaca hujan saat itu tergolong tinggi di mana areal persawahan yang dimiliki petani hanya mengharapkan tadah hujan. Saat bercocok tanam berlangsung keadaan aman, namun

tidak masuk penerima bantuan. Secara terpisah Sekretaris DMI Kab. Batubara Haris Fadilah kepada Waspada melalui ponselnya saat dihubungi menyatakan, sampai saat ini dari 200 masjid penerima bantuan tinggal 30 persen lagi yang belum disalurkan. Ia mengakui masih ada yang belum menerima dikarenakan DMI sebagai penyalur bantuan saat ini tengah mendata ulang penerima bantuan ini secara detail, namun awal Februari semanya akan tersalurkan. Ia juga ada mendengar tentang pemotongan dana atau apapun istilahnya yang menyangkut uang, namun menurutnya itu adalah ulah oknum dan bukan kebijakan lembaga. (c05)

tersebut sudah sangat meresahkan kalangan petani, sementara hinggasekarangpihakpemerintah belum ada yang turun tangan dalam menangani masalah yang

Waspada/Alam Tanjung

SAHRAN Simatupang memperlihatkan hama keong mas yang merusak tanaman padi.

dihadapipetani.Sahranmengakui, walaupun semai yang ditanam sudahbanyakyangmatidimakan keong mas, petani tidak putus asa dan kembali mengulangi dari awal menggantinya dengan bibit yang baru. Adanya hama keong mas tersebut maka musim panen tahun ini tidak akan serentak disebabkan sebagian para petani masih ada yang baru melakukan cocok tanam dan sebagian lainnya tanaman padinya hampir berbuah. “Kita khawatir bagi para petani yang terlambat bercocok tanamakangagalpanennantinya apalagi cuaca saat ini musim kemarau terjadi kekeringan di areal persawahan pertanian,” tarang Sahran. Dalamhalinipetanimeminta agar Pemkab Tapteng melalui Dinas Pertanian dapat bersikap pro aktif mencari solusinya di mana masyarakat di Kec. Sorkam Barat menggantungkan hidup dari hasil pertanian padi.(a24)

tambanganitusebesarRp500juta. Kemudian ada kebijakan bersama masyarakat Batangotoru, di mana setiap desa mau menyumbangkan Rp2,5 juta untuk percepatan pembangunan sekolah tersebut,” ujar Syahrul. Ditambahkan, SMK Pertambangan ini dibangun di Batangtoru karena saat ini memang tenaga kerja berkeahlian pertambanganyangdibutuhkandidaerah itu. Selanjutnya akan dibangun sejumlahSMKdi14kecamatanseTapseldanjuru-sannyadisesuaikan dengan kebutuhan di daerah masing-masing. “SMKPertambanganiniakan memiliki kegunaan yang sangat besar bagi masyarakat Kec. Batangtoru, Muara Batangtoru, Marancar, Angkola Sangkunur dan Angkola Barat. Atau sekitar daerah kontrak karya PT AR pada khususnyadanseluruhTapselpada umumnya,” tambahnya.(a27)

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars didampingi Wakil Ketua TP PKK Ny. Hj. Asdiana Zainuddin, dan Kepala Sekolah Drs. Ramli Siregar meninjau pembangunan 4 ruang kelas baru (RKB) SMA Negeri I Sunggal yang baru selesai dibangun.

Wabup DS Serahkan 13 Unit Rumah Program ‘Baru Yakin’ SUNGGAL, Deliserdang (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan melalui Wabup H. Zainuddin Mars menyerahkan 13 unit rumah sehat dan layak huni yang telah selesai dibedah melalui program “Baru Yakin” (bedah rumah masyarakat miskin/kurang mampu), di Kec. Sunggal. Penyerahan di Lapangan Bolakaki Pasar IV Desa Sei Semayang, Kec. Sunggal, Rabu (25/1), dirangkai gendang Guro-guro aron Mburo ate tedeh masyarakat Karo serta pelantikan pengurus MergaSilima,dihadiriratusanwargasertasejumlah pejabat Pemkab Deliserdang di antaranya Asisten I, H. Syafrullah, S.Sos. MAP, Kadisdikpora Hj. Sa’adah Lubis, SPd, MAP,Wakil Ketua TP PKK Deliserdang Ny. Hj. Asdiana Zainuddin Mars, Kadis Infokom Drs. Neken Ketaren, Camat Sunggal Drs. Sariguna Tanjung, MSi bersama unsur Muspika, Sekcam Sunggal Drs. Jahar Rambe, Kades bersama perangkat desa se-Kec. Sunggal, Ketua MPC PP KabupatenDeliserdangH.DaniGintingdanlainnya. Di hadapan ratusan warga, Wabup H.

Zainuddin Mars menyampaikan terimakasih dan penghargaan yang tulus atas terjalinnya kebersamaanyangterbangundidaerahini,terlebih bagi komunitas etnis Karo yang mampu mempererat kebersamaan lewat seni dan budaya bangsa sebagai warisan nenek moyang kita. Menurut Wabup, kebersamaan yang ditunjukkaninitentumerupakangambaranbetapa besarnya dukungan bagi percepatan pembangunan yang selama ini dilakukan lewat pola kebersamaan bersinerginya 3 pilar kekuatan melibatkan pemerintah didukung pihak swasta dan partisipasi masyarakat sehingga telah membuahkan hasil dengan tercatatnya Kab. Deliserdang sebagai kabupaten berprestasi tingkat Nasional khususnya dibidang pendidikan, infrastruktur dan berbagai bidang lainnya. Demikian juga pelaksanaan program “Baru Yakin” dengan sasaran 10.000 unit rumah tidak layak huni menjadi rumah sehat dan layak huni terus dilaksanakan secara bekelanjutan di wilayah Deliserdang.(a06/m34)

Pertamina Minta UD SS Cabut Pohon Sawit Di Sumur Minyak PANGKALANSUSU (Waspada): Kepala Layanan Operasi (KLO) PT Pertamina EP Field Pangkalansusu, memerintahkan perusahaan perkebunan UD Sejahtera Sawita (SS), mencabut tanaman kelapa sawit di areal seputar sumur minyak dan jalur pipa. “Dalam waktu dekat kami melayangkan surat kepada manajemen perusahaan perkebunan itu,agarmerekamencabuttanamanpohonkelapa sawit di areal sumur minyak dan jalur pipa milik Pertamina,”tegasDanielMunthekepada Waspada di ruang kerjanya, Selasa (24/1). Munthe menjelaskan, di areal kebun kelapa sawitmilikUDSSterdapatpuluhansumurminyak Pertamina EP Pangkalansusu, sehingga pihak Pertamina merasa terganggu. KLO lebih lanjut menyatakan, sebelumnya Pertamina memasang portal di ruas jalan menuju area sumur. Pemasangan portal dilakukan karena UD SS dinilai melanggar butir perjanjian terkait perawatan rutin terhadap kondisi jalan. Sikap tegas Pertamina ini membuat posisi UD SS makin sulit dan terjepit. Selain terancam kehilangan akses jalan darat, perusahaan swasta ini harus meng-

hadapi aksi warga pesisir dari sejumlah desa, yang menentang praktik alih fungsi hutan mangrove. Sementara itu, sampai hari ke tiga aksi penjebolan tanggul, masyarakat pesisir dilaporkan masih terus memantau perkembangannya di lapangan, meski sampai sejauh ini belum ada upaya UD SS menutup kembali tanggul yang telah dijebol. Menurut tokoh masyarakat, Azhar Kasim, warga akan terus memonitor situasi. Ia mengakui, pasca aksi demo ada beberapa pihak berupaya melakukan pendekatan kepadanya untuk mediasi pertemuan dengan pihak perusahaan. “Kami tidak menutup diri atas upaya dialog sepanjang seluruh masyarakat dilibatkan. Jika pun terjadi dialog, kami minta pimpinan perusahaan langsung turun tanpa diwakili supaya dapat memahami apa yang dituntut masyarakat,” ujarnya. Warga menuntut agar kawasan pesisir yang telah dikonversi, dikembalikan ke fungsi semula, sebab dampak dari kerusakan ekosistem membuat penghasilan nelayan jauh menurun dan dampak lain, terganggunya keseimbangan lingkungan.(a02)

Opini

WASPADA Jumat 27 Januari 2012

TAJUK RENCANA

KPK Harus Lebih Proaktif

K

PK (Komisi Pemberantasan Korupsi) menunjukkan taringnya dengan menetapkan mantan Deputi Gubernur Senior (DGS) Bank Indonesia (BI) Miranda S. Goeltom sebagai tersangka dalam kasus dugaan suap pemilihan DGS pada 2004 yang melibatkan belasan anggota dewan di masa lalu dan sudah divonis pengadilan Tipikor. Walau sudah ditetapkan sebagai tersangka namun Miranda masih bebas alias belum ditahansehinggamenimbulkantandatanyabesar,mengapaadapilihkasih?Kalautersangkatersangka lainnya ditahan mengapa terhadap Miranda tidak ditahan. Sebaiknya, KPK segera menahan Miranda sekalipun ia bersikap kooperatif selama ini. Dengan dijadikannya Miranda S. Goeltom sebagai tersangka maka terpenuhilah sedikit rasa keadilan masyarakat,. Meskipun kasusnya sudah menjangkau Miranda, namun masih ada ganjalan yang belum tuntas, seperti siapa penyandang dana atau sponsor penyuapan dalam pemilihan DGS itu. Lantas, apa tujuan mereka memenangkan Miranda. Selama Miranda menjabat Deputi Gubernur Senior Bank Indonesia kompensasinya dalam bentuk apa dan adakah pelanggaran hukumnya? Masih banyak hal-hal yang perlu dikejar oleh KPK pasca menjadikan Miranda tersangka. Kasus ini memang unik dan berlarut-larut. Penerima suapnya sudah divonis namun siapa pemberi suapnya belum. Awalnya kita khawatir kasus ini hanya terfokus pada Nunun, dan itu sangat mencederai hukum serta melukai hati nurani rakyat jika aktor utamanya tidak tertangkap. Setelah Miranda dijadikan tersangka masih ada PR baru: KPK wajib bekerja keras mencari siapa sponsor/penyandang dana dan motifnya. Oleh karena itu, jangan puas dengan tertangkapnya Nunun dan dijadikannya Miranda sebagai tersangka. Semua pihak yang terlibat wajib dijadikan tersangka dan diproses sesuai hukum berlaku. Jangan muncul anggapan negatif KPK tebang pilih dalam menegakkan supremasi hukum di negeri ini terkesan takut bila melibatkan orang-orang dekat di lingkaran kekuasaan. Kita mesti memberi acungan dua jempol buat Agus Condro sang ‘’whistleblower’’. Berkat kesadaran si peniup pluit kasus ini terbuka lebar walaupun dia ikut dihukum penjara 15 bulan. Puluhan mantan anggota DPR periode 19992004 terseret ke pengadilan, termasuk Panda Nababan yang divonis 17 bulan. Rendahnya hukuman bagi koruptor banyak disesalkan masyarakat karena tidak menimIntisari bulkan efek jera sehingga kasus-kasus korupsi semakin menjadi-jadi sekalipun KPK sudah berupaya keras melakukan KPK tidak boleh pilih penindakan dan upaya pencegahan. Bagaimana dengan Miranda? Apakah juga kasih dan harus proaktif dihukum rendah? Kita harap tidak! mengusut korupsi lain akan Sebab, ancaman hukumannya 5 tahun. Atas seperti kasus Nazaruddin perbuatannya itu, Miranda dijerat melanggar Cs (Wisma Atlet) meli- Pasal 5 ayat 1 huruf b atau Pasal 13 UU No 31 tahun 1999 tentang Tipikor jo Pasal 55 ayat batkan banyak tokoh di 1 dan ayat 2 jo pasal 56 KUHP. Wanita yang kini berstatus dicegah untuk berpergian ke elite kekuasaan luar negeri itu terancam hukuman 5 tahun penjara dan pidana denda Rp250 juta. Artinya, jaksa dan hakim mesti berani, jangan sampai hukumannya di bawah 2,5 tahun penjara. Hemat kita, tertangkapnya Nunun Nurbaeti di Thailand dan kini tengah menjalani pemeriksaan di KPK membuka jalan munculnya tersangka baru. Banyak keterangan Nunun yang menyudutkan Miranda sehingga KPK merasa yakin mantan DGC BI itu tidak bisa lepas dari jerat hukum. Kini, Nunun dan Miranda sudah dalam penguasaan KPK. Jika melihat buktibukti hukumnya sudah terang-benderang sebaiknya kedua tersangka segera dimajukan ke meja pengadilan untuk menjalani hukuman. Tidak perlu proses sidang yang berbelitbelit lagi. Apalagi kalau proses persidangannya nanti sampai mengakibatkan kasus Nazaruddin terpinggirkan karena diduga kuat melibatkan sejumlah nama petinggi Partai Demokrat. Sehingga KPK harus lebih proaktif. Jangan sungkan menegakkan supremasi hukum. Justru itu, KPK tidak perlu larut dalam satu kasus Nunun dan Miranda saja, apalagi terombang-ambing dengan upaya sementara pihak untuk luput dari kasus Nazaruddin. Jangan sampai pula terperangkap politik-politikan. Konsentrasilah, fokus bekerja, tunjukkan kinerja dengan membongkar kasus Wisma Atlet Palembang yang melibatkan banyak tokoh politik dan elite kekuasaan. Dan yang penting KPK dapat mengungkap kekuatan besar yang selama ini melindungi Nunun dan Miranda, termasuk si penyandang dana yang masih misterius. Saatnya KPK mengungkap siapa kekuatan yang melindungi kedua tersangka selama ini sehingga kasusnya berlarut-larut, serta membuka lebar hubungannya seperti apa dengan Miranda, di mana kasus cek pelawat ini nilainya mencapai puluhan miliar rupiah. Bagi-bagi cek dilakukan usai kemenangan Miranda S. Goeltom sebagai Deputi Gubernur Senior Bank Indonesia. Kasus suap ini terbongkar atas pengakuan Agus Condro yang mengaku menerima suap Rp500 juta dan melibatkan puluhan rekannya sesama mantan anggota DPR periode 1999-2004 terseret dalam kubangan korupsi, termasuk melibatkan Nunun dan Miranda.+

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Email komentar@waspada.co.id

+6285361186517 Salam dari sini utk saudara , tetangga. Waspada semoga dalam lindungan Allah. Aceh. +6285275710361 Selamat pagi Waspada..saya bangsa Aceh mantan GAM dulu. selaku pribadi saya ini...yang menentap di Kota Medan saat ini saya prihatin atas gejolak peristiwa di Aceh saat ini yang mana kita harap berdamai lah bangsaku patuhilah UUD MoU pertahanlah UUD yang sudah ada pada tgl 15 dulu damai kan Aceh yang mulia. jangan ada lagi yang tumpah darah .wasalam. +6285297365910 Mengucapkan hut dirgahayu hr waspada demi kebenaran/keadilan 11 jan 1947 11 jan 2012 semoga menjentuh di hati masyarakan sumatra utara\indonesia DR B.LUBIS +6285276986787 Dalam agama:seluruh perselisihan adalah kejahatan bukan rahmat{dosa}ada juga perselisihan tdk menimbulkan dosa seperti perselisihan para sahabat dan para imam yg mengikuti mereka semoga Allah mengelompokan kita dlm golongan mereka amin’’’ +62819638291 Assw, utk 085261172936 masih banyak yg lebih penting dilakukan, utk uchwah Islamyah dari pada menyalahkan amalan org lain. Bayangkan saja nanti kalau bapa Mati bagaimana anak2 bapak melaksanakan fardu kipayahnya, ya dikuburkan saja seperti hewan.Kenapa bpk ikuti Al QURAN yg dicetak sekarang padahal pada zaman Nabi hidup belum ada? Yg benar aja. T.Kasih. +6282168609161 Dirgahayu harianWaspada ke 65 demi kebenaran dan keadilan. Semoga dgn bertambah usia semakin matang dlm pemberitaan. Dari anak koran era thn 1959 jg dilupakan. +6287747606425 Dalam pesta pemilukada Aceh & pendapat Waled Mualem Muzakir Manaf sebagai mantan Panglima Perang Gerakan Atjeh Merdeka(GAM) bisa tercapai 60% bahkan lebih dari 60% dgn catatan Wilayah Beutong,Nagan,Trumon,Samarkilang,Peurelak dan Nisam sawang, Nama Abu Razak sangat dominan pengaruhnya & Abu Razak sekrg berada dibawah bimbingan Kapolda Aceh & pengaruh beliau sangat hebat dlm wilayah tsb diatas diharapkan kpd Waled Mualem Muzakir Manaf utk merangkul, menjatu kembali Abu Razak dalam jajaran PA & bila Abu Razak sdh menjatu dlm jajaran PA kami haqkulyakin pasangan Ayahanda Dr Zaini Abdullah-Waled Mualem Muzakir Manaf bisa mencapai suara kemenangannya diatas 60%, bahkan kami dengar Info Abu Razak ada mendirikan LSM”BARANADI” Penjelmaan Suara hati Rakyat Aceh. +6287768190185 Hidup itu apa mau bunuh2an . . . .kenapa di Aceh bunuh org semudah bunuh binatang. Kami hamba allah sama seperti yg lain.silahturami lebih bagus ketimbang bunuh2 org dgn tanpa alasan. Di mana hati nurani org yg melakukan penembakan di aceh.buat pemerintahan di mana pun tolong selesaikan semua dgn aman dan damai tanpa jatuh korban, jgn tunggu korban lebih banyak baru pada heboh sendiri. +6281362438529 Hallo waspada,tagihan PDAM sekarang sama mahalnya dengan PLN,pada hal dari segi pembiayaan sangat jauh bedanya, ada apa dengan tarif PDAM? Apa perlu swastanisasi?

B5

Menyongsong Opini WTP Di Sumut Oleh Tohirin, SE, Ak Pemda harus mulai mengubah paradigma dari penyusunan laporan dari keharusan menjadi kebutuhan

P

emerintah baik pusat maupun daerah memiliki kewajiban menyampaikan laporan keuangan kepada BPK RI. Laporan ini selanjutnya akan diaudit BPK RI untuk diberikan opini. Sampai dengan Laporan Keuangan Pemerintah Daerah (LKPD) Tahun Anggaran 2010, di Sumatera Utara belum satupun pemerintah daerah yang mendapatkan opini Wajar Tanpa Pengecualian (WTP). Memasuki tahun 2012, Pemprovsu dan Pemko/Pemkab sudah harus mulai menyusun LKPD TA 2011. Apakah di tahun 2012 ini Opini WTP dapat diberikan BPK RI terhadap LKPD 2011? Berikut disajikan trend opini di Sumut, permasalahan dalam LKPD sehingga tidak dapat diberikan opiniWTP dan apa kiatkiat yang dapat dilakukan. Selain WTP, penilaian lain adalah WDP (Wajar De-

ngan Pengecualian), TW (Tidak Wajar), TMP (Tidak Menyatakan Pendapat). Dari di samping ini diketahui, selama enam tahun terakhir tidak satupun Pemda di Sumut yang memperoleh opini WTP dari BPK. Dari pemeriksaan terakhir atas LKPD TA 2010 dari 34 entitas pemeriksaan diketahui opini yang diberikan adalah 21 WDP, 2 TW dan 11 WDP. Permasalahan Pemda tidak WTP Berikut ini permasalahan yang sering terjadi di Pemda sehingga opini WTP tidak dapat diberikan, antara lain: Pertama, terbatasnya SDM akuntansi publik di Pemda. Sebagian besar Pemda sangat terbatas memiliki personel memadai di bidang akuntansi sektor publik. Keterbatasan ini menyebabkan ketidaksiapan atau paling tidak keterlambatan menghasilkan laporan keuangan yang sesuai standar akuntansi yang telah ditetapkan. Kedua, manajemen kas yang belum tertib. Persoalan kas adalah persoalan yang paling mendasar untuk menjadi perhatian Pemda. Pengelolaan APBD akan selalu terkait persolan kas. Pendapatan harus dipastikan bahwa sudah dikelola, dicatat dan dilaporkan sesuai mekanisme yang telah ditetapkan. Belanja daerah juga demikian. Ketiga, manajemen aset tetap yang tidak didukung dokumen pendukung. Permasalahan aset tetap adalah paling sering menjadi pengecualian dalam pemberian opini oleh BPK. Aset tetap yang dimiliki Pemda harus dicatat dan dilaporkan dalam neraca daerah. Persoalan yang

sering ditemui auditor BPK adalah bahwa Pemda tidak dapat memberikan data dan/ atau penjelasan yang memadai atas aset yang dilaporkan dalam laporan keuangan. Keempat, kecenderungan bukti formal internal tanpa didukung bukti eksternal transaksi belanja. Belanja daerah yang dilaporkan dalam Laporan Realisasi Anggaran harus didukung bukti cukup dan sah. Belanja daerah baik belanja pegawai, belanja barang, belanja modal serta belanja bantuan harus dibuktikan bahwa kegiatan-kegiatan tersebut memang dilaksanakan melakui dokumen pendukung yang memadai. Kelima, manajemen investasi yang tidak memenuhi prinsip investasi. Investasi yang dilakukan Pemda harus dilakukan berdasarkan mekanisme yang ditetapkan. Kejelasan permasalahan investasi yang disajikan dalam laporan keuangan sangat berdampak kepada pemberikan opini oleh BPK. Investasi yang dilakukan Pemda harus direncanakan, dilaksanakan, dikelola dan dilaporkan sesuai mekanisme. Keenam, political will pengambil keputusan Pemda. Yang terakhir dari seluruh permasalahan yang menyebabkan opiniWTP belum bisa diperoleh. Kepala daerah diharapkan menjadi contoh teladan yang melakukan “leading by example” bagi jajarannya. Ketika kepala daerah sudah commit melakukan pengelolaan keuangan daerah yang transparan dan akuntabel, maka dapat dipastikan jajaran di bawahnya akan mengikuti. Konsistensi atas political will ini juga sangat diperlukan kesinambungan pengelolaan keuangan daerah transparan dan akuntabel. Kiat supaya WTP Berikut ini kiat-kiat yang dapat ditempuh Pemda dalam rangka pencapaian opiniWTP: Pertama, Pemda diharapkan dapat segera menyampaikan LKPD TA 2011 sesuai batas waktu maksimal yang ditetapkanUU,yaitupalinglamatigabulan setelah berakhirnya tahun anggaran atau 31 Maret 2012. Kedua, selain tepat waktu juga harus memiliki dasar dan data pendukung memadai. Jangan mengabaikan ketepatan substansi informasi yang terkandung dalam LKPD. Pemda harus mulai mengubah paradigma dari penyusunan laporan dari keharusan menjadi

kebutuhan. Ketiga, bagi Pemda yang sudah beberapa kali memperoleh opiniWDP harus bersiap-siap menyongsong opini WTP. Syarat utama adalah segera menyelesaikan permasalahan yang “dikecualikan” BPK. Ketika opini WDP sudah sekian lama diperolehnamunPemdatidakjugaberanjak, akan menimbulkan pertanyaaan. Pertanyaan tersebut adalah apakah Pemda memang sebegitu“bandel” nya tidak mau melaksanakan rekomendasi BPK RI atas hal-hal yang dikecualikan, ataukah memangrekomendasiBPKRIyangtidakdapat dilaksanakan? Untuk mendukung peningkatan pemeriksaan LKPD maupun perolehan opini LKPD, BPK melakukan beberapa inisiatif yaitu: mewajibkan semua auditee menyerahkanManagementRepresentation Letter kepada BPK; mewajibkan semua auditee untuk menyusun Rencana Aksi guna meningkatkan opini pemeriksaan laporan keuangannya; membantu entitas pemerintah dalam implementasi Rencana Aksi yang telah disusul dan diserahkannya kepada BPK; menyarankan DPR-RI, DPDRIdanDPRDProvinsimaupunkabupaten/ kota membentuk Panitia Akuntabilitas Publik. Management representation letter merupakan dokumen yang memuat pernyataan tanggung jawab kepala daerah atas LKPD-nya, sehingga diharapkan dapat memberikanpenekananagarLKPDbenarbenar disusun secara memadai. Selain itu, menindaklanjuti temuan pemeriksaan BPK periode sebelumnya, Kepala daerah juga diwajibkan menyusun rencana aksi yang berisikan langkah tindak lanjut konkrit dan jadwal pelaksanaannya secara rinci. Mari kita songsong era baru pengelolaan keuangan daerah yang tercermin dalam LKPDTA 2011 di Provinsi Sumatera Utara. Era baru yang dimaksud adalah perubahan paradigma dari Penyusunan LaporanKeuangandarikeharusanmenjadi kebutuhan serta era baru dimana para pengambil keputusan di Pemda melakukan leading by example dengan memberikanteladankepadajajarannya.Mudahmudahan di tahun 2012 ini di Sumatera Utara opiniWTP dapat diperoleh. Semoga. Penulis adalah Auditor BPK RI Perwakilan Provinsi Sumatera Utara.

Imlek, Hilangkan Sifat Egois - Primordial Oleh Sofyan Harahap Pola hidup eksklusif ditandai dari tembok dan pagar besi berlapis-lapis bak kandang harimau.

P

erayaan Tahun Baru Imlek 2563 oleh saudara kita etnis Cina berlangsung meriah dan aman. Seorang teman kebetulan seorang ustadz sampai pangling alias terbengongbengong. ‘’Kok peringatan tahun baru hijriyah tidak semeriah Imlek ya,’’ katanya bertanya. Saya dengan mudah memberi jawaban, ‘’Karena anda tinggal di Kota Medan.’’ Kota Medan kini bisa dibilang Kota Cina. Lihat saja ketika Imlek. Masyarakat sulit mencari toko yang buka di wilayah perkotaan. Jalanan sepi. Itu menandakan pusat bisnis sudah milik orangorang Cina atau etnis Tionghoa. Jika saja mobil anda rusak dan membutuhkan onderdil hampir pasti tidak diperoleh pada masa Imlek. Terpaksa harus menunggu beberapa hari. Bahkan, saat seorang montir datang ke sebuah toko onderdil ingin membeli pompa bensin mobil, sang pemilik toko menolak. Suasana rumah makan pun banyak tutup. Sebab, pelanggannya kebanyakan dari warga Cina memang mereka senang makan di luar. Di pasar tradisional dampak Imlek juga terasa. Kebutuhan sehari-hari kaum ibu saat berbelanja sembako terutama ikan sulit diperoleh. Setelah ditelisik, ternyata toke-toke ikan sudah dikendalikan tekong Cina dan mereka tidak beroperasi saat Imlek sehingga tangkapan ikan oleh nelayan tradisional tidak mampu mencukupi kebutuhan masyarakat. Wajar saja harga ikan melambung tinggi saat Imlek lalu. Yang mencolok di hari Imlek adalah maraknya pembakaran kembang api dan bunyi mercon sekalipun sudah ada larangan dari pemerintah, namun karena hal itu sudah merupakan tradisi leluhur mereka petugas tidak melarang. Juga atraksi barongsai di mana-mana, semakin bebas dan semarak setelah di masa Orde Baru dilarang. Warga cukup terhibur. Bahkan, pemain barongsai sekarang ini banyak dari kalangan pribumi. Dan yang paling mencolok tentu saja di bandara. Banyak warga Medan dari kalangan etnis Cina ‘’membuang’’ uangnya dengan merayakan Imlek di luar negeri. Masa setahun kerja keras, ‘’matimatian dengan menghalalkan segala cara’’ dalam menjalankan bisnis, tiba masa Imlek sebagian keuntungan digunakan untuk berfoya-foya ke Malaysia, Singapura, Eropa dll. Atau di kawasan wisata Berastagi, Parapat, Jakarta, Bali, Yogyakarta, Lombok dll. Hanya sebagian yang merayakan Imlek di rumah saja. Apalagi berani mengundang jiran tetangga yang pribumi jumlahnya kecil. Mengapa? Tentu terkait dengan hitung-hitungan pengeluaran. Nah, merayakan Imlek di rumah bisa jauh lebih mahal ongkosnya. Jauh lebih besar pengeluarannya dibandingkan pergi ke luar negeri

bersama keluarga. Yang pasti banyak tamu yang datang, tidak sekadar makan-makan saja, tapi minta ‘’jatah’’ yang jumlahnya disesuaikan dengan kapasitas sang tamu yang diundang maupun tidak diundang, misal kalangan preman. Sehingga tidak lagi sekadar sedekah lewat angpau dalam amplop berwarna merah. Jika kedatangan tamu tidak diterima atau hanya diberi sedikit angpau saja, alamat timbul kerusuhan tak diinginkan. Suasana sakral Imlek bersama keluarga pun menjadi rusak. Cina Medan Memang Lain Saya juga punya teman yang orang tua laki-lakinya dari etnis Cina, tinggal di Jakarta. Setelah menikah dia tinggal di Medan. Puluhan tahun saya bergaul dengannya. Alhamdulillah, dia termasuk muallaf yang baik, dan bisa menyesuaikan diri dengan jiran tetangga dan di tempat kerjanya (kantor swasta). Sebagai keturunan Cina (peranakan) teman saya ini sukses beradaptasi dan rasa nasionalismenya pun cukup tinggi. Saya tahu itu ketika dia marah pada orang-orang Cina yang masih menggunakan bahasa leluhurnya di tengah keramaian masyarakat (pasar). Cina Medan memang lain dengan Cina dari daerah-daerah lain dalam berkomunikasi tetap menggunakan bahasa leluhur, tidak pilih-pilih tempat, seakan mereka tinggal di negerinya, atau Hongkong. Saya juga punya teman yang asli dari Cina perantauan (orang tuanya).Tinggal di Kampung Durian. Sulit bergaul dengan masyarakat di sekitarnya. Namun jumlah mereka dari tahun ke tahun semakin bertambah banyak. Tahun 1970an di kawasan Kampung Durian baru satu-dua rumah yang dihuni warga etnis Cina tapi sekarang mayoritas (hampir 90 persen) perumahan di jalan utama, Sutomo Ujung dan sekitarnya, sudah berpindah tangan menjadi hunian dan usaha bisnis kelompok pendatang dari etnis Cina. Harus diakui mereka punya keterampilan dalam berdagang (bisnis). Hemat saya, ada perbedaan mencolok antara etnis Cina peranakan atau yang sudah punya garis keturunan/ darah pribumi dengan etnis Cina perantauan yang cenderung hidup berkelompok, egois, dan eksklusif, hanya mementingkan sesama mereka saja, dan menerapkan pola hidup primordial, terlebih setelah berjaya menjadi penguasa perekonomian di Medan. Pola hidup eksklusif ditandai dari tembok dan pagar besi berlapis- lapis bak kandang harimau. Kelompok yang disebut terakhir ini mendominasi sehingga muncul sebutan Medan: China Town. Mengapa disebut Cina Medan? Apa bedanya dengan Cina Jakarta, Semarang, Surabaya, atau Cina Padang dan Cina Aceh? Jawabnya, Cina Medan pu-

nya ciri khas yang tidak dimiliki warga Cina di daerah lain. Kalau etnis Cina nonMedan dapat membaur, berasimilasi dengan lingkungannya, cukup peduli dengan warga miskin, menggunakan bahasa/dialek lokal, Cina Medan tidak! Mereka cenderung semakin arogan setelah tahu (dapat) menguasai Kota Medan dan merasa menduduki kasta utama. Bahkan, berani melawan dan memukul petugas (polisi) yang tengah menjalankan tugas. Tentu tidak semua seperti itu. Adalah fakta bahwa peranan Cina Medan dalam bidang ekonomi demikian signifikan sehingga sulit bagi pemerintah untuk melakukan pengawasan, misalnya kalau terjadi kenaikan harga sembako dan material bangunan pemerintah hanya bisa mengimbau atau melakukan intervensi pasar.Tidak pernah ada pengusahayangditangkapwalaupunmelakukan penimbunan barang, menaikkan harga, praktik spekulasi, dumping dll. Keberadaan Cina Medan semakin meluas disebabkan tokoh-tokoh etnis Cina di Sumut tidak mampu membina anggotanya, dibiarkan lepas saja sehingga semakin menjadi-jadi. Di sini terlihat pemerintah daerah juga tidak berhasil membina mereka, seperti gagalnya program pembauran. Hanya tinggal beberapa sekolah saja yang masih eksis dengan melakukan pembauran siswa pribumi dengan nonpribumi (Cina), seperti di Yayasan Iskandar Muda pimpinan dr Sofyan Tan yang terpilih sebagai tokoh pendidikan Waspada. Dia (Sofyan Tan) berhak memperoleh Ani Idrus Award 2011 karena dedikasinya menyukseskan pendidikan dan melakukan aksi nyata mendorong semangat persamaan etnis dan mencerdaskan generasi muda Indonesia. Niatnya membangun sekolah pembauran patut dicontoh agar generasi muda tidak mudah dihasut dan agar tidak terjadi lagi kerusuhan etnis akibat praktik diskriminasi. Sebagai bagian dari kelompok minoritas, Sofyan Tan tampil mendorong semangat persamaan etnis lewat pendidikan dan upaya pembaurannya itu tak lain untuk menjalankan UUD 1945 bahwa setiap warga negara punya hak dan kedudukan yang sama, tidak boleh diskriminatif. Tentu saja masyarakat, terlebih lagi ahli sejarah atau orang-orang tua kita yang masih hidup masih ingat betul bagaimana sepak terjang dari saudara kita keturunan Cina di masa pergolakan kemerdekaan RI. Kelompok Pao An Tui yang menjadi salah satu kekuatan Belanda berperan memerangi para pejuang kita di masa ‘’tempo doeloe’’. Sungguh fakta sejarah yang sulit dilupakan masyarakat. Sifat tidak satria atau mendua dalam membela pejuang kemerdekaan RI, bersikap arogan, egois, dan primordial itulah yang sulit dilupakan dan menjadi catatan sejarah kelam dari etnis Cina yang berakibat acapkali menimbulkan kerusuhan anti-Cina di berbagai daerah, termasuk Kota Medan tercinta. Tentu hal tersebut harus diantisipasi. Tidak saja oleh pemerintah pusat dan daerah tapi juga bagi komunitas etnis Cina sendiri, terlebih mereka yang masuk kategori Cina perantauan dan pendatang.

Penutup Kita sepakat cerita-cerita kelam peristiwa kerusuhan etnis tidak boleh terjadi lagi di masa mendatang. Namun begitu kita tidak bisa hanya berharap saja tapi harus ada upaya melakukan perbaikan, koreksi diri terutama datang dari kalangan etnis Cina. Upaya pemerintah mengangkat harkat dan martabat budaya etnis Cina dengan pemberian pengakuan (libur nasional) untuk merayakan Imlek bisa jadi akan sia-sia jika komunitas Cina khususnya di Kota Medan tidak mengubah hidupnya yang eksklusif, terutama menghilangkan kesan stereotip negative: agois dan primordial. Oleh karena itu, hilangkan pola hidup ala Cina Medan sehingga tidak menimbulkan prasangka negatif dan penolakan dari masyarakat lokal (pribumi). Cobalah berempati dengan beragam etnis lainnya. Jangan sok menganggap diri sebagai etnis unggulan dan etnis lain pecundang. Tiru pola hidup dan adaptasi Cina peranakan yang dengan ikhlas membaur dan menjadi orang lokal. Kalau bisa anak keturunannya tidak tahu kalau dia itu berasal dari Cina atau Tionghoa, tapi sebagai bagian anak bangsa Indonesia. Perayaan Imlek tahun ini hendaknya menjadi momentum introspeksi diri, belajar mengasah rasa kemanusiaan, saling membantu dan bertoleransi agar semakin berbudi dan beradab. *** Penulis adalah wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * FPDIP tolak pembatasan BBM - Cocok! * KPK jangan setengah hati tangani kasus di DPR - Biar tak terkesan pilih kasih * Ketua MK: Semua Pilkada curang - Kalau curang ngapain Pilkada

oel

D Wak

B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Rocky 4x4 Thn. 91. biru, kondisi mulus, jarang pakai, body kaleng, AC dingin, ban 31, harga Rp. 65Jt/Nego. Hub. 0853 6230 0613

DAIHATSU Xenia Li Famili 05. Warna hitam met. BK Medan, pajak panjang mulus. Harga Rp. 96Jt. Hub. 0812 6363 561

1. DAIHATSU Espass Minibus Thn. 1995 warna biru metalic, VR, AC, Tape, Harga 33,5Jt. Nego. 2.Fiat Sedan MD Uno Thn. 1989 Harga 7 Jt Nego. Hub: 061-4149993 HP. 0813 9678 4128 DAIHATSU BARU PAKET MURAH...!! All New Xenia.............DP Mulai 19 Jt-an Terios...........................DP Mulai 20 Jt-an Pick Up........................DP Mulai 8 Jt-an Luxio............................DP Mulai 13 Jt-an Proses Cepat Dan & Data Dijemput Hub. PT. CAPELLA MEDAN JOSUA 081263110820

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DAIHATSU Espass Pick-Up Thn. 2004, BK Mdn asli warna biru, Tape, VR, BR, Kondisi sangat bagus sekali. Harga Rp. 43Jt ( d a m a i ) . H u b . I WA N J l . T a d u a n / Perdamaian No. 113. HP. 0852 7630 4256

HONDA GRAND CIVIC Th. 91, Orisinil, Biru muda met, Harga 44,5Jt, Hub. 0811 679975

ISUZU 100% BARU

Grand Touring Type J, LS, LV, Pick Up Panther, Turbo Diesel, Kuat, Hemat, Dijamin untung, Terima tukar tambah semua merk, Info: Astra, Isuzu: (061) 68444.8554 / 0813.7591.5420

7 CM 8 CM

Rp. 91.000 Rp. 104.000

SUZUKI Katana Thn. 88 Dijual. BK Mdn W. Merah. Hrg. 30 Jt. Nego. Hub. 0812 6046 6036 SUZUKI Carry Minibus Alexander Tahun 88 warna biru, AC, Tape, Ban Velg Racing, Siap pakai. Harga 20Jt Nego. Hub. Muslim 0852 9668 2508 SUZUKI Carry MB Alexander Thn. 86/ 87 Hijau tua met, Plat BK, VR, Mulus. Hrg. 16,5Jt (Nego) Hub. 77756757 - 0852 9775 0771 Jl. SM Raja/Sebelum Polda.

BISON 4 RODA bak besi, Th. 94, mls, H. 47 Jt. Serius Hub. 0816 309628

SUZUKI Katana GX, Thn. 95. BK Mdn warna biru met. AC, Tape, PS, CL, VR, BR, Kondisi sangat bagus sekali. Harga Rp. 43Jt. (damai). Hub. Iwan Jl. Taduan/Perdamaian No. 113 Hp. 0852 7630 4256

MERCY E230 ‘96 Hijau Met, Km Low, Mulus, BK Mdn, Int. Original, Sprt baru, Sound system, VCD Multi, DVD, MP3, RT, DP 36,5 Jt Angs. 4,2Jt x 23 Hub. (061) 7670.0979

SUZUKI Jimny 4x4 Thn. 89 Dijual. BK Mdn asli, cantik, Harga 31Jt. Nego. Hub. 0812 8621 4177

MERCY C180 ‘94 Silver Met, Jok klt, VR 16”, ABS, Airbag, PW, PS, Alarm, BK 333, DP 25 Jt, Angs: 2,76 Jt x 23 Hub. 0852.7507.6512 / Kanda

MITSUBISHI BARU

Discount Kandas, Proses Cepat LINA.S

0812 6947 2909

# SUZUKI DEALER RESMI # Carry Pick Up...DP 9 Jt-an DVD Audio, } Bonus: Mega Carry......DP 14 Jt-an ke Film & Aksesoris APV Arena........DP 14 Jt-an Hadiah: Splash..............DP 12 Jt-an Kaca Film Swift ST ............DP16 Jt-an Perking Sensor & Aksesoris SX-4.................DP 23 Jt-an Proses Cepat, Data Dibantu, Kredit 1-5Th. Hub. 0852 6114 6499 - 061.9114 0699

}

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

061-4576602. Terimakasih

SUZUKI Katana GX Thn. 1994. Hitam, BK Medan. H. 46Jt.

Daihatsu Espass MB Thn. 1996. Merah, 1.600cc. Cat masih asli, Hub. Jl. Setia Luhur - 0812 6400 747

SUZUKI Carry Extra 1988/89 (Tugas Kita) Biru Muda Met mulus/sehat Rp. 20Jt. Hub. 0853 5959 4632 (TP) SUZUKI APV Thn. 2005. W. Biru, BK Mdn lengkap, AC, Tape, CD, DVD, TV, Power, sub woofer. Velg Import. Remot. Mulus, Original. body kaleng. BU. Hub. HP. 0812 6021 2106 Mdn. TOYOTA Twin Cam Thn. 88 Dijual. BK Mdn. W. Hitam, Hrg. 35. Juta Nego. Toyota SE Salon Thn. 86 BK Mdn. Original. Hrg. 32Juta. Hub. 0812 6046 6036

TOYOTA Corona Twin Cam Dijual. Thn. 88 W. Biru, Rem Cakram. Muka belakang Velg 15 Ban. Baru AC, Tape, Power Steering. Power Window H. 23Jt. 500rb Nego. Hub. HP. 0853 7084 1203

TOYOTA Kijang Kapsul Diesel Thn. 2003 Dijual. Warna hitam mobil siap pakai. Hub. HP. 0813 6153 2044

TOYOTA Kijang Super G Dijual. Thn. 95. Soft/warna biru. Hub. 0813 77 1717 15 TOYOTA Kijang Super Arora tahun 90. Warna biru metalik. AC, Tape, Ban Velg Racing. Siap pakai. Harga 38 Nego. Hub. 0813 6135 7361

TOYOTA Avanza Tipe G thn. 2004 Akhir dijual, warna merah, km. masih sedikit 63 ribu, jarang pakai (barang simpanan) khusus pemakai. Hub. HP. 0812 6461 8696 Jl. Rahmat No. 39 STM Simp. Limun

TOYOTA BARU

AVANZA, INNOVA, FORTUNER

PURBA : 0813 9789 4633

TOYOTA Kijang 1.8 LX ‘00 Model LSX, Biru Dongker, AC dgn, Tp, CD, PS, VR, BR, DP 17Jt, Angs. 2,85 Jt Hub. 0852.7507.6512/ Kanda TOYOTA Kijang LGX ‘97. Bensin, Hijau, BK Asli Medan, sgt mulus & terawat. BPKB 1 nama Rp. 96Jt/ Nego. Hub. 0853 7112 5151

- KIJANG NEW LSX Diesel Th. 02. Biru, H. 120Jt. - Kijang LSX Diesel Th. 97, Abu met, Plat BM, H. 89Jt Kredit Hub. Yos Sudarso 42F. 0812 6076 476 TOYOTA Kijang Kapsul LGX 1.8cc Thn. 97. W. biru, lengkap. AC Double, tape, VR, BR, CL, PW, PS, mulus siap pakai. BU. Hub. HP. 0821 6177 6086 Mdn.

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Jumat, 27 Januari 2012

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

BUTUH UANG 1 S/D 500 JT

Jaminan sertifikat rumah, SK. Camat, Akte Notaris. Proses 1 hari. Hub. 0812 6059 3875

BURSA

SERVICE/ASESORIS MOBIL

PROMO SARUNG JOK MOBIL SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO PROMO 1 PROMO II PROMO III PROMO IV

SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

TELAH TERCECER

Sebuah Surat Tanah An. Sertali Br. Ginting dengan luas 5000 M2. Yang terletak di Dusun II Dese Silebo -Lebo. Kec. Kutalimbaru Deli Serdang. Bagi yang menemukan Hub. 0813 6132 1569. Tidak dituntut tetapi diberikan imbalan.

HILANG

BURSA

KOMPUTER TERIMA LAPTOP KOMPUTER DLL (0821 6868 5346) (Menjual Laptop Komputer Seken Bergaransi) SALHA.COM Jl. Denai No. 118 (TERIMA SERVIS)

- Surat Ganti Rugi Tanah a/n. Martina FRIDA terletak di Dusun I Sei Tuan Kec. Pantai Labu Seluas 40x100meter. - Surat Pernyataan yang ditandatangani Kepala Desa Sei Tuan a/n. Ismail Ogon. Tanah terletak di Dusun I Sei Tudu Kec. P. Labu, seluas 20x100.

BURSA

PHOTO COPY

TERBAKAR

Terbakar surat2 a/n. MANGARATUA SIHOTANG Al: 1.Ijazah SD - S1 2.Surat Tanah a/n. Mangaratua Sihotang yang terletak di Jl. Ngumban Surbakti / Jl. Mawar, Kel. Sempakata seluas 24.000 M2. D/H. Lingkungan V Kel. PB.

Selayang II,Kec.Medan Selayang Kota Medan.

ELITE MOTOR

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

HILANG /TERCECER

TERCECER Dompet yang berisikan SIM A, SIM C, KTP, Kartu ATM BNI, Kartu Kredit BNI An. Hendra Prayogi. Jl. Puyuh 15 No. 263 P. Mandala Medan. Tercecer disekitar Jl. Halat. Bagi yang menemukan hubungi: No. 061-4515661

SERVICE

TELAH KEHILANGAN/TERCECER

Surat Pernyataan Melepaskan Hak Atas Tanah (SK Camat) No. 593.83/2.744/2007, Tanggal 06 Desember 2007 A/n. JOSRON SIRINGO RINGO. Tanah seluas +/- 285m2. Yang terletak di Dusun XII Konggo Kongsi Desa Sei Semayang Kecamatan Sunggal, hilang disekitar Jalan Medan Binjai Km. 13,5.

HILANG

Telah hilang Surat Sebidang Tanah dengan Bangunan rumah an. DJAGA SINUHADJI yang terletak di Gaharu Parmin No. 18c/44 Medan. Kel. Gaharu, Medan. LT. 17x14M. Bagi yang menemukan harap menghubungi Djaga Sihuhadji 0812 609 4930

AC AC

ELEKTRONIK SERVICE: AC, Kulkas, Msn. Cuci, TV, CCTV, Parabola, B. Pasang, Bergaransi. Hub. 061-77913537, 0813 7553 3375

AC

BURSA

JAYA TEKNIK

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

PRATAMA TECHNIK

REPARASI/SERVICE AC SPLIT, WINDOW/CENTRAL, DISPENSER, MENGECAT KULKAS/ JUAL BELI AC BEKAS, DLL HP. 0812 6053 690 7352833 0812 6064 9333

WC WC

KONSTRUKSI

TUMPAT/ SEDOT

77442112

0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

TUMPAT/ PENUH

821 9951

Jl. Setia Budi No. 2

Agenda

WASPADA Jumat 27 Januari 2012

07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14:30 Cek & Ricek 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30 Dewa 19.00 Binar Bening Berlian 21.30 Mega Sinetron 22.30 Box Office Movie Yhe Dukkes Of Hazzard

CATATAN

07.00 SCTV FTV Pagi 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya emang Kuya 16.00 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Anak Kaki Gunung 19.30 SCTV Sinetron : ALiya 20.00 Liputan 6 Terkini 20.30 Film Layar LEbar 22.30 Liputan 6 Terkini 22.33 Film Layar Lebar I

07.00 Disney Club 08.00 Layar Pagi 09.00 Cerita Pagi-1 10.30 Kribo 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 16.00 Animasi Spesial 17.45 Animasi Spesial The Owl 18.00 Shaun The Sheep 19.00 Fathiyah 20.00 Tendangan Si Madun 21.00 Cinta Sejati 22.00 Tarung Dangdut 00.00 Premier Preview 01.30 Lintas Malam

07:30 Wooow…! 08:00 Friends (Live) 09:00 Gowes 09:30 Segeeerr 10:30 Dokumenter: Amazon 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Indonesia Super League 2011-2012 17:30 Topik Petang (Live) 18:00 Pesbukers (Live) 19:00 Siapa Takut 20:00 Kisah Dari Langit 21:00 Deal Or No Deal 22:30 Dokumenter: Dangerous Encounter 23:30 Most Incredible Moments 00:00 Telisik 00:30 Topik Malam (Live)

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Special Program 11.00 Headline News 11.30 Metro Siang 12.05 Metro Siang 13.05 Wideshot 13.05 Wideshot 14.00 Headline News 15.30 Wideshot 16.00 Headline News 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Eadle Documentary 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 Ala Chef 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Show Imah 14:30 With Farah Quinn 15:30 Sketsa 16:00 Happy Family 16:30 Sepenggal Sejarah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV 00:00 Bioskop TransTV 02:00 Reportase Malam

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Jendela Usaha 12:00 Live News Kabar Siang 13:30 Apa dan Siapa 14:30 Kabar Pasar 15:00 Data Dan Fakta 15:30NamaDanPeristiwa 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Apa Kabar Indonesia Malam 21:00 Kabar Malam 22:00 Kabar Arena 23:00 Radio Show

08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Top Banget 11:30 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Tamu Gokil 15:00 Steve Ewon Sang Pemburu 15:30 Berita Global 16:00 Top Banget 16:30 Fokus Selebriti 17:00 TomandJerryKids Show 17:30 Spongebob Squarepants 19:00 Film TV 21:00 Big Movies 23:30 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Dream Theater Ke Jakarta April Grup musik rock progresif fenomenal asal AS, Dream Theater, akan menggelar konser pertamanya di Indonesia pada 21 April mendatang. Konser masih dalam rangkaian World Tour 2012 bertajuk A Dramatic Tour Of Events tersebut diadakan di Pantai Carnival, Ancol. Band ini berformasikan James Labrie (vokal), John

BURSA

PENDIDIKAN

BIMBINGAN PRIVAT

JAHADA SMART REVOLUTION (JSR)

Menerima Les Privat SD - SMP - SMA Dan Tenaga Pengajar Mahasiswa² dari PTN Ternama SUKSES DI SEKOLAH - Jadwal belajar disesuaikan UN DAN dengan kondisi siswa PERGURUAN TINGGI - Lama belajar 120 menit - Senantiasa mengevaluasi Akademik siswa & menumbuhkan motivasi belajar Tunggu apa lagi?

MAU PINTAR?? DAFTAR SEGERA !!!

06:00 Fokus Pagi 07:00 KISS Pagi 07:30 Halo Polisi 08:00 FTV 10.30 Hizteria 11:30 Patroli 12:00 Drama Asia (Korea): Dong Yi, Jewel In The Crown 14:00 Drama Asia ( K o r e a ) : Pink Lipstick 15:00 KISS Sore 16:00 Fokus 16:30 Drama Asia (Korea) 18:00 Drama Asia (Mandarin) 19:00 Satria 20:00 Tutur Tinular 22:00 FTV Laga

B7

CP: NAMIRA FK USU

0852.7000.1948 (061) 732.0325

Jl. Kenari Raya I No. Q8 Perumnas Mandala Medan 20226

BURSA

LOWONGAN DIBUTUHKAN

WA I T R E S C A F E C H AWA N K U P I D I PA N T O N L A B U A C E H U TA R A L A K I / PEREMPUAN 1 . JUJUR/ RAJIN SERTA RAMAH SERTA B E R TA N G G U N G J AWA B 2 . M E M P U N YA I P E N G A L A M A N D I B I D A N G N YA YA N G B E R M I N AT M O H O N H U B : ROBBY HP: 0813.5353.8854 0819.9019.3621

LOWONGAN KERJA Perusahaan Telekomunikasi PabxCCTV - Security System - Networking, membutuhkan: Beberapa orang sebagai Teknisi - Pria (muslim) usia 18 - 23 tahun - Min. SMU/ SMK/ Sederajat Lamaran diantar ke: Jl. Pukat II/ Sejati No. 77 Medan (1 minggu)

LOWONGAN KERJA RESMI KE MALAYSIA Anda ingin bekerja secara legal ke Malaysia???? Disini jawabannya:

Perusahaan Elektronik Terkemuka di Selangor, membutuhkan Tenaga kerja wanita untuk dipekerjakan di kilang:

WESTERN DIGITAL M SDN BHD, DI SELANGOR

A. SYARAT PENDAFTARAN: 1. Wanita umur 18 s/d 30 tahun 2. Pendidikan minimal SMP/ SLTA sederajat 3. Membawa foto copy Ijazah, KTP, Kartu keluarga (asli dibawa sewaktu interview) 4. Membawa pas photo warna 3x4: 6 lbr 5. Bisa eks. Malaysia 6. Bisa yang telah menikah B. GAJI - Gaji kasar sebulan RM 1.286 (untuk bagian Cleanroom) - Gaji kasar sebulan RM 1.150 (untuk bagian Non Cleanroom) - Bonus tahunan C. FASILITAS - Levy subsidy 109% - Asrama tiket pulang kemudahan kesehatan, asuransi, berangkat naik pesawat terbang - Biaya proses pemberangkatan dapat dicicil setelah TKI bekerja di Malaysia D. JADWAL PENDAFTARAN/ JADWAL SELEKSI: - Pendaftaran: Setiap hari kerja - Seleksi: Tanggal 10 Februari 2012 Segera daftarkan diri anda sekarang juga ke:

Petruci pada gitar, John Myung (bass), Jordan Rudess ( Keyboard), dan Mike Mangini (drum). Mereka telah merilis album kesebelas, A Dramatic Turn of Events, menempatkan tembang On The Backs of Angels sebagai nomini Grammy Awards 2012 untuk kategori Best Hard Rock/ Metal Peformance. Menurut Triadi Noor, DIBUTUHKAN Karyawan salon/ asistant/ capster, wanita/ pria, datang langsung ke: Jl. Kapt. Muslim Ujung No. 291-B, Helvetia Medan Telp. (061) 7734.0340

DIBUTUHKAN

Sebuah perusahaan yg bergerak dibidang property, membutuhkan seorang wakil Manager Marketing dan Wakil Manager SDM, syarat: 1 . Pria/ wanita usia max. 30 tahun 2 . Minimal tamatan SMU sederajat 3 . Pengalaman tidak diutamakan Gaji memuaskan Antar lamaran ke: JL. PASUNDAN NO. 78

DIBUTUHKAN SEGERA

Distributor produk Telekomunikasi Nasional membutuhkan karyawan/ti sbb: 1. Account Officer (AO)/ Sales Executive (SE) 2. Office Boy (OB) Syarat-syarat: 1 . Pendidikan min. SMU/ sederajat (1, 2) 2 . Umur maksimal 30 tahun (1), maksimal 28 tahun (2) 3 . Pengalaman sebagai Sales, min. 1 tahun (1) 4 . Memiliki sepeda motor dan SIM C (1) 5 . Mempunyai loyalitas yang tinggi, jujur, ulet, kreatif dan bertanggung jawab dalam menjalankan tugas (1, 2) 6 . Wilayah penempatan untuk daerah Medan Lamaran dikirim paling lambat 7 hari sesudah pengiriman ini ke:

Jl. Gatot Subroto No. 150N/ 12C Medan (sebelum Medan Fair Plaza/ simpang JL. Razak). Cantumkan kode posisi dan lokasi disebelah kiri atas amplop

DICARI

TEKNISI KULKAS - AC HUB: ASIA - 608 TELP. 7753.1904 0812.601.1904 BURSA

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH DIJUAL

Komp. Griya Tjg. Selamat Jl. Raya Tjg. Selamat Blok B No. 2 (sudut), SHM, KT 2, KM 1, Lantai keramik, Type 36 Hub. 0812.637.3542

DISEWAKAN

Rumah Koppel Jl. Beringin VIII No. 92 A, C (Jl. Gaperta) Helvetia (BARU SIAP DIREHAB) Hub. alamat tersebut

Bussiness Development dari Variant Entertainment, Dream Theater akan membawa peralatan manggung berbobot sampai 5,5 ton kargo. “John petruci akan bawa dua lemari koleksi gitarnya, begitu juga dengan John Myung sang basist. Secara teknis mereka minta 150 ribu watt untuk sound dan lighting,” kata Triadi kepada

wartawan, Rabu. Dream Theater kemungkinan akan lebih banyak memainkan lagulagu dari album baru mereka. Penontonnya bukan hanya dari Indonesia tapi juga dari negara-negara ASEAN seperti Brunei, Singapura, Malaysia, Thailand, bahkan Iran dan Italia. “Kita targetkan penonton 9 hingga 10 ribu orang,” kata Triadi. Tur asia Dream Theater akan dimulai pada 19 April 2012 di Seoul, Korea

Selatan, negara asal orang tua basist John Myung. Lalu ke Jakarta pada 21 April dan terakhir Jepang. Variant Entertainment telah menjual presale tiket bekerjasama dengan TicketOnFire. Karena tingginya permintaan, maka pada 1 18 Februari, mereka akan kembali menggelar presale. Tiket dijual antara Rp450 ribu (harga terendah) sampai tertinggi Rp4 juta. Calon penonton bisa membuka

www.ticketonfire.com. Panitia menyediakan 2.000 tiket presale. Dream Theater didirikan 27 tahun lalu dari satu universitas musik di AS bernama Berklee College of Music di Massachusetts. Semua personal band ini memiliki gelar professor akademik pada bidang musik yang ditekuninya. Grup ini memiliki penggemar setia di Indonesia bernama Dream Theater Fans Club Indonesia.(ant)

RUMAH DIJUAL

KUSUK & LULUR TERAPY MBAK ALIN

Di Komp. Tasbi Medan Blok II No. 1, LT. 221m, SHM, 2 Lantai, KT 5, KM 2, Sudut

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

Hub. Bpk. Siregar 0812.651.0094

AKUPUNKTUR

Tumor/ Kanker/ Stroke/ Jantung/ Diabetes/ Reumatik/ Maag/ Impotensi/ Keputihan/ Miom/ Kista/ Obesitas dan penyakit kronis lainnya Jl. Amaliun No. 253A Telp. 735.2680 HP. 0812.9160.675

RUMAH DIJUAL CEPAT

JL. KAPTEN SUMARSONO GG. BUNTU NO. 177 HELVETIA, LT. 365M², 2 TK, DPN KANTOR PENGADILAN AGAMA, 150M² KE AKBID HELVETIA, HARGA NEGO HUB. 0812.6005.7861

Guru TK min. Lls SMA, Kreatif & Suka dunia anak Hub: Jl. Karya Wisata No. 23A Johor Tp: 786.1690 Medan TANAH TANAH Dijual 23 Rante di Desa Kota Datar Pulo Pandan Tandem Hilir, Stabat, Hrg 5 Jt/ Rante (Nego) Hub. 0812.650.5045 - 0857.6237.5045

TANAH DIJUAL

COCOK UNTUK DEVELOPER LUAS± 1.500 M², HARGA 2 JT/ METER/ NEGO JL. Abdul Harris Nasution (disamping Rumah Makan ACC) Hub. 0812.6040.4505

TERIMA PANGGILAN 0812.2822.4745

ANDA BUTUH

ALAT BANTU DENGAR ? HUB.

MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

A. AMARUDIN

AMANAH UMROH

UMROH DAN MANASIK HAJI

UMROH REGULER 9 HARI 19,27 FEBRUARI, 2,6, 9 MARET MULTAZAM UMROH REGULER 14 HARI 22, 29 FEBRUARI, 14, 12, 21MARET Berpengalaman professional UMROH REGULER 20 HARI 7 MARET BIMBINGAN PENUH MULAI DARI TANAH AIR SAMPAI KE TANAH SUCI UMROH PLUS CAIRO 14 HARI 21 APRIL 1. Umroh Reguler 9Hr, dan 2 Minggu/ 13hari HOTEL MADINAH : AL-HARAM (5*) HOTEL MAKKAH : MAKARIM AJYAD (5*) HOTEL JEDDAH : AL AZHAR (5*) Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jama’ah Tertanggung ASURANSI DAFTAR SEGERA Kantor: Gedung Gelora Plaza Lt. 1 Jl. S. M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

2. Umroh dan Arbain di Madinah 3. Umroh Plus Mesir 4. Umroh Plus Turkey 5. Umroh Plus Jordan Aqsha 6. Umroh Plus India Kashmir 7. Umroh Plus Dubai PEMBUKAAN MANASIK HAJI DILAKSANAKAN PADA FEBRUARI 2012 DAFTARKAN SEGERA KE:

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.6481.828

PELATIHAN DIAGNOSA

MINI & EFEKTIF

“20 MENIT MAMPU DIAGNOSA PENYAKIT SENDIRI, BAYI, DEWASA, LANSIA” TGL. 27 - 29 JAN 2012, BAGI MEDIS & UMUM

IKLANKAN PRODUK ANDA

BURSA

BUSANA & ASESORIS

PECI MAHKOTA MENJUAL PECI TEMPAHAN

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201

DAFTAR: 0811.604.816 (www.holistikmodern.com)

BURSA

MATERIAL

DISEWAKAN

BURSA

Sebuah Ruko di Lt. 1 (dasar), beserta Perlengkapan salon: Spa, Lulur, dll Berminat hubungi Ibu Ani di 0812.644.0718, Salon sudah berjalan ±2 tahun hingga sekarang atau datang langsung ke: Salonku Jl. Kapt. Muslim Ujung No. 291B Helvetia Medan

KHUSUK DAN LULUR YATI

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

RUMAH DIJUAL

JL. SUNGGAL KOMP. SOMERSET BLOK A NO. 6 (HOOK) HARGA NEGO, TP HUB. 0813.9677.6828

MENDESAK !!! SEKOLAH BARU MEMBUTUHKAN

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Teropong Si Bolang 13:00 Laptop Si Unyil 13:30 Aku dan Cita-Citaku. .. 14:00 Dunia Binatang 14:30 Koki Cilik Tamasya 15:00 Home Stay 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 23:30 Dua Dunia **m31/G

TRAVEL/ WISATA Since 1952

BURSA

KOMUNIKASI

Ingin Promosikan Produk Anda Harian

KENANGA CITI HOTEL

WASPADA

My Residence in Medan

Media yang Tepat untuk Iklan Anda

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

SUMATERA UTARA TELP: (061) 9126 3040

PT. MUTIARA KARYA MITRA (Group Rumah Sakit Sari Mutiara) SIUP NO: 629/MEN/2006 JL. KAPTEN MUSLIM NO. 89C MEDAN TELP. (061) 845.2956 - 847.1840 - 846.8759 (dekat ke RSU Sari Mutiara & Millenium Plaza) Contact Person: Mega 0812.6408.0074 0813.6220.2213 Ibu Veronika 0852.6135.3442 Transportasi ke: PT. Mutiara Karya Mitra 1. Dari Amplas: Naik Angkot: Medan Raya Express (Mr. X) Medan Bus 135 2. Dari P. Bulan : Naik Angkot: Koperasi No. 52, 25 dan Medan Bus 135

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat

DIBUTUHKAN Karyawan yang memiliki loyalitas & komitmen yang tinggi untuk ditempatkan posisi: 1. Supervisor Restoran 2. Waiter/ Pelayan 3. Tukang masak/ Cook 4. Tukang potong/ Cook helper

BURSA

KESEHATAN

KLINIK MAK OLOT

FASILITAS: Tempat tinggal & makan ditanggung Perusahaan serta Gaji & Bonus yang menjanjikan Bersedia ditempatkan di cabang (Mall) & Full time

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Antar surat lamaran Anda ke:

SPRING BED DIJUAL MURAH

RESTORAN ASOKA CORNER

No. 4, 5 & 6 (Simp. Jl. Bunga A s o k a ) M e d a n H P. 0813.6210.5778 (melalui SMS)

TELP: 0821.6969.6868 - (061) 6969.6868

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

1 Jam Tuntaskan lemas syahwat - Cepat keluar Bergaransi - Inpotensi, diabetes 100% Alami - Tambah ukuran - Ramuan vagina perawan Kembali, hasil bisa cek dr metode: Biotheraphy dan Ramuan Herbal Office: Mesjid Raya Mdn 600m lurus di Jl. Amaliun No. 125 Bpk. Kosim S.Ag HP. 0812.63700.234 Izin Dinkes: 448/347/2004

Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2

TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PEL. RATU PANTAI SELATAN Ditangani Langsung:

BPK. UMAR & UST. A. AZIS

Melayani berbagai macam keluhan antara lain:

KHUSUS PRIA TAMBAH UKURAN:

- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja depan Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban

HP. 0813 8042 6253

BALAI PENGOBATAN TRADISIONAL

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

ALAT VITAL

Dengan H. TEJA SAEFUL

DITANGANI OLEH AHLINYA: M. SUHERDI

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) H P. 0 8 1 2 . 4 0 3 8 . 3 3 3

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN -

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

Ekonomi & Bisnis

B8

Keuangan Mikro Menjamur, Perlu UU Khusus

Harga Emas Bakal Tembus 1.800 Dolar AS JAKARTA (Waspada): Harga emas kembali melonjak sejak perdagangan semalam hingga hari ini. Setelah beberapa waktu lalu harga komoditas tersebut sempat meredup, harga emas kembali menyentuh level 1.710 dolar AS per ounce. Analis trader dan investasi emas Mulyadi Tjung, memperkirakan kenaikan harga emas ini akan terus berlanjut hingga menyentuh level 1.800 dolar AS per ounce pada Februari. “Harusnya akan mengetes 1.800 dolar AS bulan depan,” kata Mulyadi di Jakarta, Kamis (26/1). Menurut Mulyadi, perdagangan emas hari ini berada pada level 1.710 dolar AS per ounce sejak semalam atau naik 2,68 persen dari sebelumnya. Dia menuturkan, faktor

yang mempengaruhi kenaikan harga emas adalah respons atas hasil pertemuan Bank Sentral Amerika Serikat, The Fed, yang mengumumkan suku bunga akan dipertahankan sebesar 00,25 persen hingga 2014. “Otomatis, dolar AS mengalami pelemahan. Selama bunga masih rendah, emas pilihan menarik dibanding currency,” kata Mulyadi. Sementara itu, harga emas di PT Antam Tbk yang dikutip dari logammulia.com, per Kamis (26/1), disebutkan harga emas batangan Rp553.000 per gram, untuk lima gram Rp521.500 per gram, 10 gram Rp517.500 per gram, dan satu kilogram mencapai Rp511.000 per gram. Harga beli di Antam Rp491.000 per gram. (vvn)

JAKARTA (Waspada): Di tengah menjamurnya lembaga keuangan mikro (LKM), aturan mengenai badan penghimpun dana dari masyarakat skala kecil ini ternyata masih belum terlalu ketat. Selama ini, aturan LKM hanya dibuat dalam satu pasal dalam UndangUndang tentang Bank Indonesia. “Sebetulnya, mengenai LKM sudah diatur dalam UU Perbankan. Di UU perbankan pasal 58 diatur kalau ada penghimpunan dana masyarakat itu, aktivitasnya harus seizin BI,” ujar Menteri Keuangan Agus Martowardojo di Gedung DPR, Jakarta, Kamis (26/1). Data sementara menunjukkan, jumlah LKM dalam bentuk bank desa, lumbung desa, dan bentuk lainnya kini telah mencapai 600 ribu unit. Namun, Agus melanjutkan, dengan jumlah sebanyak itu, belum ada UU khusus yang mengatur mengenai LKM. Pemerintah dan BI saat ini baru menyelesaikan dua aturan terkait penyelenggaraan bank komersial dan Bank Perkreditan Rakyat (BPR). Selama ini, menurut Agus, UU Perbankan hanya mengatur mengenai kewajiban LKM untuk berubah status menjadi BPR dalam jangka waktu tertentu. Namun, dalam praktiknya, belum banyak LKM yang melakukan hal itu. “Pernah ada periode BPR itu di tahun 1990-an menunjukkan

Rupiah Berhasil Menguat Tipis JAKARTA (Waspada): Nilai tukar rupiah terhadap dolar Amerika Serikat (AS) nampaknya terimbas sentimen positif. Rupiah kembali ke kisaran Rp8.900 per dolar AS. Rupiah, menurut kurs tengah Bank Indonesia (BI) ditutup pada level Rp8.995 per dolar AS, dengan kisaran perdagangan Rp8.950-Rp9.040 per dolar AS. Sementara mengutip yahoofinance, rupiah berada di kisaran Rp8.925 per dolar AS, dengan kisaran perdagangan Rp8.925-Rp8.995 per dolar AS. Analis valuta asing Reza Priambada menjelaskan, rupiah masih rawan terkoreksi akibat mata uang eropa yaitu euro. Di mana saat ini investor cenderung memegang mata uang dalam bentuk dolar AS.

“Dolar naik, maka cenderung mata uang lain melemah termasuk rupiah,” ungkap Reza saat dihubungi di Jakarta, Kamis (26/1). Sementara analis Samuel Sekuritas Lana Soelistianingsih mengatakan, pasar AS kembali menguat, tetapi pasar Eropa sebagian melemah. Pasar Asia kemungkinan akan positif seiring dengan rencana the Fed memperpanjang suku bunga rendah hingga 2014. “Rencana ini membuat dolar AS akan menguat, dan rupiah berpotensi,” jelasnya. Pada zona Eropa, terpantau euro menguat terhadap dolar AS dan diperdagangkan di kisaran 1,312 euro per dolar AS, dengan kisaran perdagangan 1,3081,313 euro per dolar AS. (okz)

Harga Minyak Sentuh 100 Dolar AS NEW YORK ( Waspada): Harga minyak mentah kembali naik akibat rencana bank sentral Amerika Serikat (AS) atau US Federal Reserve (Fed) untuk mempertahankan tingkat suku bunganya sampai akhir 2014. Setelah pertemuan untuk membahas kebijakan yang dilangsungkan selama dua hari, the Fed menyatakan perekonomian AS cukup berkembang, meskipun perlambatan pertumbuhan ekonomi global, tingkat pengangguran AS masih tinggi dan perekonomian menghadapi risiko penurunan yang signifikan. “Ini menjadi pertanda baik untuk dolar AS untuk menguat, dan harga komoditas yang lebih tinggi ketika The Fed akan terus menahan inflasi sebagai bagian dari upaya menghidupkan kembali perekonomian AS,” tutur Again Capital LLC, John Kilduff, di New York, seperti dilansir dari Reuters, Kamis (26/

1).

“Kami melihat beberapa pembuat kebijakan dalam the Fed, memilih melihat kenaikan pertama dalam suku bunga tahun ini, dengan beberapa orang lain melirik kenaikan pada 2016. Pada ketentuan itu, investor mungkin jangka panjang mungkin akan ditahan, tentang akomodasi kebijakan dari the Fed,” ungkap analis PFGBest Research di Chicago Phil Flynn. Hasilnya, minyak mentah berjangka AS atau light sweet untuk pengiriman Februari diperdagangkan di 99,40 dolar AS per barel, naik 45 sen, setelah sempat naik ke sesi tertinggi 100,40 dolar AS per barel, dan level terendahnya 97,53 dolar AS per barel. Di London, minyak mentah jenis ICE Brent pada pengiriman Maret diperdagangkan di 109,81 dolar AS per barel, turun 22 sen, setelah mencapai sesi tinggi 110,89 dolar AS per barel. (okz)

Antara

GALAXY TAB 7.7: Seorang model menunjukkan sebuah produk baru Samsung Galaxy Tab 7.7 saat peluncurannya di Jakarta, Kamis (26/1). Tablet tersebut merupakan tablet pertama Samsung dengan layar super AMOLED Plus dengan tingkat kontras warna tinggi dan tampilan lebih tajam.

AirAsia Implementasikan Manajemen Operasional Baru JAKARTA (Waspada): Kini, para penumpang AirAsia dapat merasakan pengalaman terbang yang lebih nyaman bersama maskapai penerbangan hemat biaya terbaik dunia versi Skytrax tersebut. AirAsia telah mengimple-

Antara

PELUNCURAN MOBIL PROTON: Dari kiri General Manager Marketing PT Proton Edar Indonesia, Mazlan Mohd. Zain, Director After Sales and Service PT Proton Edar Indonesia, TaufikWahyu Hidayat, Head of Product Development PT Proton Edar Indonesia, Robby Prakoso, dan Presiden Director PT Proton Edar Indonesia, Gunther Scherz berpose di samping mobil varian Proton Exora Star terbaru di Jakarta, Kamis (26/1). Agen Tunggal Pemegang Merk (ATPM) kendaraan Proton di Indonesia tersebut memperkenalkan Varian mobil Exora Star terbaru yang menggunakan aksesoris produksi Indonesia dengan harga jual (on the road) Rp154 juta/unit hingga Rp199 juta/unit.

Ditjen Pajak Tegaskan Kenderaan Umum Bebas PPnBM JAKARTA (Antara): Direktorat Jenderal Pajak menegaskan kendaraan pengangkutan umum dibebaskan dari pengenaan pajak penjualan barang mewah (PPnBM) sehingga tidak tepat jika disebut pajak menyebabkan harga kendaraan umum menjadi mahal. Direktur Penyuluhan Pelayanan dan Humas Direktorat Jenderal Pajak, Dedi Rudaedi dalam keterangan tertulis Kamis (26/1), menyebutkan, Menteri Keuangan telah menetapkan Keputusan Menteri Keuangan (KMK) Nomor 355/KMK.03/ 2003 tentang Jenis Kendaraan Bermotor yang Dikenakan PPnBM. Berdasar KMK itu, maka kendaraan pengangkutan umum dibebaskan dari pengenaan PPnBM. Yang dimaksud dengan

kendaraan pengangkutan umum adalah kendaraan bermotor yang digunakan untuk kegiatan pengangkutan orang dan/atau barang yang disediakan untuk umum dengan dipungut bayaran selain dengan cara persewaan, baik dalam trayek maupun tidak dalam trayek, sepanjang menggunakan plat dasar polisi warna kuning. Menurut Dedi, untuk memperoleh pembebasan PPnBM, wajib pajak yang melakukan impor atau yang menerima penyerahan kendaraan bermotor wajib memiliki Surat Keterangan Bebas (SKB) PPnBM yang diterbitkan oleh Direktur Jenderal Pajak. “Dengan demikian sepanjang memenuhi kriteria tersebut, maka bajaj tidak akan akan dikenakan PPnBM,” sebut Dedi dalam keterangan tertulis itu.

WASPADA Jumat, 27 Januari 2012

Dedi juga menjelaskan salah satu karakteristik pajak pertambahan nilai (PPN) dan PPnBM adalah pajak konsumsi, yaitu hanya dikenakan pada objek pajak dari kegiatan konsumsi. PPnBM hanya akan dikenakan ke objek pajak yang termasuk kategori mewah. Kendaraan bermotor tertentu termasuk mobil pribadi masuk kategori mewah sehingga dikenakan PPnBM lapisan tarif sesuai aturan berlaku. Menurut Dedi, PPnBM juga berprinsip keadilan mengharuskan wajib pajak kaya membayar pajak lebih tinggi daripada wajib pajak tidak mampu. Bagi wajib pajak yang secara finansial mampu membeli mobli pribadi, sudah sangat adil membayar pajak yang lebih tinggi daripada wajib pajak yang tidak mampu membeli.

mentasikan bagian pertama dari sebuah sistem manajemen yang mutakhir guna meningkatkan efisiensi sisi operasional maskapai. Sistem merlot.aero ini akan meningkatkan optimalisasi pemanfaatan pesawat dan awak kabin AirAsia, sehingga memungkinkan maskapai untuk mencapai tingkat on-time performance yang lebih baik, serta menurunkan biaya di saat yang sama. Bagian pertama dari sistem baru ini, yang mengatur sistem informasi penerbangan dan layanan secara real time ke seluruh saluran sosial media AirAsia, penumpang, bandara dan berbagai layanan pendukung, telah mulai diimplementasikan di seluruh jaringan AirAsia secara global. “AirAsia senantiasa berkomitmen dalam hal peningkatan layanan. Kami memilih perangkat operasional yang canggih ini sebagai upaya memberikan pengalaman terbang terbaik bagi penumpang. Keunggulan sistem baru ini mendukung AirAsia untuk meningkatkan on-time performance dan mengoptimalkan pemanfaatan pesawat guna melayani rute lebih banyak lagi serta meningkatkan frekuensi. Melalui penerapan sistem ini, kami juga mengharapkan adanya penghematan biaya secara signifikan, sehingga tarif hemat

kami dapat terus dinikmati oleh p e n u m p a n g ,” d e m i k i a n Dharmadi, Presiden Direktur AirAsia Indonesia, melalui siaran pers yang diterima, Kamis (26/1). “Sistem ini akan diimplementasikan Grup AirAsia di seluruh wilayah dan juga oleh maskapai afiliasi untuk penerbangan jarak jauh berbiaya hemat, AirAsia X. Kami harap pada pertengahan 2012, seluruh sistem dapat sepenuhnya terimplementasikan,” katanya. “Sistem Merlot.aero secara cerdas dapat memprediksi, mengatur, mengukur serta menghadirkan laporan utilisasi pesawat dan awak kabin secara komprehensif. Hal ini semakin mendukung ketaatan maskapai pada peraturan dalam hal memastikan agar para kru terbang dalam rentang waktu yang diizinkan,” ujarnya. Sederhananya, sistem ini menyentuh seluruh aspek manajemen maskapai penerbangan. Merlot.aero memiliki ketahanan yang sangat dapat diandalkan, didukung juga dengan berbagai model yang lebih hemat biaya dibandingkan dengan model yang tradisional, sehingga sangat pas diimplementasikan oleh maskapai besar seperti AirAsia,” papar Mark McCaughan, CEO dari Merlot yang berbasis di Selandia Baru.(rel)

prestasi kurang baik, sehingga banyak LKM yang ragu-ragu untuk pindah. Tetapi, ini adalah sesuatu yang tidak boleh didiamkan,” ujar dia. Agus mengakui perlunya UU yang khusus mengatur LKM. Hal itu untuk menghindari munculnya kerugian masyarakat penabung yang menyimpan dana di lembaga tersebut. “Tapi, posisi pemerintah tetap untuk izin, untuk pengawasan harus tetap dari BI. Bahwa BI dalam memberikan izin atau melakukan pengawasan itu bekerja sama dengan pemerintah daerah, atau BPR, atau dalam bentuk lainnya, itu bisa dibicarakan,” kata dia. Bank infrastruktur Sementara Ketua Umum Perhimpunan Bank-bank Umum Nasional (Perbanas), Sigit Pramono, mengatakan Indonesia sudah sangat membutuhkan bank infrastruktur. Hal ini karena pembiayaan infrastruktur memerlukan jangka waktu kredit panjang, 7 hingga 15 tahun. Sementara itu, bank-bank umum sumber

dananya sangat pendek. “Bayangkan, sumber dana deposito yang cuma 3 bulanan harus memberikan kredit 7-15 tahun. Ini akan menimbulkan mismatch dalam pengelolaan likuiditas bank,” kata Sigit di Jakarta, Kamis (26/1). Mengenai keraguan sumber dana bagi bank infrastruktur, Sigit mengatakan, tak usah ragu. Sebab, masih banyak sumber dana jangka panjang, seperti modal, penerbitan obligasi, serta pinjaman luar negeri dengan bunga lunak dan jangka panjang. Sebelumnya, pemerintah sepakat membentuk bank infrastruktur untuk membiayai seluruh proyek pembangunan di Tanah Air, baik yang terkait dengan program masterplan percepatan dan perluasan pembangunan ekonomi Indonesia (MP3EI) atau pun tidak. Namun, pemerintah belum bisa menentukan bentuk lembaga keuangan yang tepat untuk konsep bank infrastruktur seperti diharapkan Presiden Susilo Bambang Yudhoyono. Menteri Koordinator Perekonomian, Hatta Rajasa menjelaskan rapat kabinet kemarin menemukan sejumlah opsi dalam membuat bank infrastruktur. Opsi pertama adalah memperkuat lembaga keuangan yang ada seperti PT Sarana Multi Infrastruktur (Persero) dan PT Indonesia Infrastructure Finance (IIF).(vvn)

Iklan FB, Twitter Jadi Pesaing Berat Media J A K A RTA ( Wa s p a d a ) : Kedepan, peran facebook dan twitter akan menjadi pesaing berat bagi layanan iklan di media cetak atau elektronik (tv dan radio). Prediksi tersebut terlihat dari semakin meningkatnya pengguna media sosial ini dari tahun ke tahun. “Peran media sosial (facebook/twitter red-) di Indonesia ke depan akan menjadi ajang promosi yang banyak diminati oleh para pebisnis di tanah air,” kata Iman Brotoseno salah seorang pemerhati dunia media sosial dan sekaligus chairman dari Bllooger di Jakarta, Kamis (26/1).

Menurutnya, saat ini sudah ada 47 juta pengguna facebook di Indonesia, yang merupakan pengguna terbesar nomor dua di dunia setelah Amerika Serikat. “Begitu juga dengan pengguna Twitter yang mencapai angka 55 juta pengguna di Indonesia (ketiga terbesar di dunia), dengan jumlah per hari twit mencapai 1,2 juta,” ujar Iman. Banyaknya follower yang menggunakan media sosial ini, menjadi daya tarik baik bagi dunia usaha maupun dari kalangan politisi. Dari segi bisnis produsen dapat berkomunikasi secara dua arah dengan konsumen. Sedangkan bagi politisi/

pejabat bisa menjelaskan misi kebijakan yang dikeluarkan, seperti yang dilakukan Perdana Menteri India menggunakan twiiter untuk berdialog kepada warganya. Selain itu biaya yang dikeluarkan untuk berinteraksi ini jauh lebih murah dibandingkan dengan komnunikasi melalui media cetak maupun elektronik. Sehingga follower yang ada ini bisa dimanfaatkan oleh para produsen untuk mempromosikan produknya. Iman memberi contoh, pesepakbola Bambang Pamungkas memiliki sekitar 1 juta follower. (j03)

Antara

PUNCAK HARGA BERAS: Pekerja mengangkut beras di Pasar Beras Induk Cipinang, Jakarta, Kamis (26/1).Wakil Menteri Pertanian,Rusman Heriawan,menyatakan harga beras akan mencapai puncaknya pada Januari dan akan turun pada Februari hingga April mendatang dikarenakan siklus panen yang rutin terjadi.

Ekonomi Global Diyakini Terus Memburuk JAKARTA (Waspada): Masih terjadinya krisis perekonomian di sejumlah negara menjadikan kekhawatiran akan perekonomian global semakin menjadi-jadi. Menurut survei dilakukan Pricewaterhouse Coopers Inter-nasional (PWC) dalam “15th Annual Global CEO Survey” menyatakan hampir setengah atau 48 persen dari 1.258 CEO yang disurvei di seluruh dunia percaya bahwa ekonomi global akan semakin menurun dalam 12 bulan ke depan. Hanya 15 persen yang mengatakan perekonomian global akan membaik di 2012. “Namun hampir tiga kali lebih banyak CEO yang percaya dalam prospek pertumbuhan perusahaan mereka untuk 12 bulan ke depan daripada prospek untuk ekonomi global. Hal ini menunjukkan bahwa mereka telah belajar

bagaimana mengelola bisnis untuk melewati masa ekonomi yang sulit dan bergejolak,” ungkap Pimpinan PWC Internasional, Dennis M Nally dalam siaran persnya, Kamis (26/1). Sebanyak 40 persen CEO mengatakan mereka sangat yakin dengan pertumbuhan pendapatan mereka dalam 12 bulan kedepan akan turun dibanding tahun lalu yang 48 persen. Selain itu lebih dari setengah CEO di seluruh dunia mengharapkan untuk meningkatkan jumlah karyawannya dalam 12 bulan ke depan, meskipun proses rekrutmen lebih banyak disektor hiburan, media dan lain-lain. Di sisi lain, penurunan rasa yakin tersebut terjadi mayoritas di kawasan Eropa Barat, karena terjadinya krisis utang. Dengan adanya penurunan rasa yakin tersebut hanya seperempat

CEO dari Eropa yang menyatakan mereka sangat yakin akan pertumbuhan pendapatan usahanya. Hal tersebut mengalami penurunan yang cukup tajam yaitu hampir 40 persen dibandingkan tahun lalu. Keyakinan jangka pendek juga mengalami penurunan di mata para CEO di Asia Pasifik. Di mana rasa yakin para CEO turun menjadi 42 persen dari 54 persen pada tahun lalu. China juga mengalami penurunan yang sangat besar dalam hal ini dimana hanya 51 persen CEO yang memiliki keyakinan akan perekonomian yang turun dibandingkan tahun lalu sebesar 72 persen. “Keyakinan CEO jelas menurun saat mereka berurusan dengan resesi. CEO kecewa jalannya perekonomian global dan langkah pemulihannya. Optimisme yang telah terba-

ngun dengan hati-hati sejak tahun 2008 mulai surut,” kata Dennis. Rasa keyakinan para CEO yang turun tersebut diakibatkan oleh berbagai hal diantaranya 80 CEO memiliki kekhawatiran terhadap pertumbuhan ekonomi yang tidak menentu, 64 persen mengenai ketidakstabilan pasar modal, 66 persen mengenai tanggapan pemerintah akan defisit fiskal dan beban utang, 58 persen mengenai volatilitas nilai tukar, dan 56 persen mengenai peraturan pemrintah. Dan sementara 56 persen dari CEO mengatakan keadaan finansial perusahaan mereka terpengaruh oleh krisis utang Eropa, dan 45 persen mengatakan telah mengambil langkahlangkah untuk merespon. “Krisis utang yang sedang berlangsung di Uni Eropa bersamaan dengan ketidakpastian

ekonomi telah mengempiskan keyakinan dlam pertumbuhan bisnis di seluruh dunia. Bahkan pertumbuhan ekonomi yang cepat di Asia dan Amerika Latin tidak kebal terhadap realitas stagnasi ekonomi, menyangkal gagasan bahwa ekonomi global telah dipisahkan. CEO di seluruh dunia prihatin akan kesehatan ekonomi global,” jelasnya. Kabar baiknya adalah siklus panjang ketidakpastian ekonomi telah mengajarkan para CEO bagaimana mengelola bisnis mereka dengan efisisien. mereka lebih siap untuk berurusan dengan ekonomi yang didefinisikan oleh volatilitas di pasar global, melemahnya permintaan dari negara maju dan ketidakpastian dipasar negara berkembang. Banyak CEO yakin mereka dapat memberikan pertumbuhan pendapatan meskipun dalam kondisi sulit. (okz)

Aceh

WASPADA Jumat 27 Januari 2012

Bersuami Dua, Ibu RT Masuk Bui

Desa Seuneubok Nalan Geger, Pedagang Botot Tewas Dalam Kamar BIREUEN (Waspada): Warga Desa Seuneubok Nalan, Kecamatan Peulimbang, Kab. Bireuen, Kamis (26/1) menjelang sore geger. Pasalnya, mereka mendapat kabar seorang warganya Arjuna Ginting,28, ditemukan tewas di dalam kamar rumah kontrakannya. Namun, belum diketahui motif dan penyebab kematian lelaki yang berprofesi sebegai pedagang barang bekas itu. Informasi yang diperoleh Waspada, Kamis (26/1) sore, seorang warga Seuneubok Nalan ditemukan telah meninggal di rumahnya menjelang sore dan saat itu tidak ada orang lain di rumahnya. Informasi lainnya, Arjuna Ginting yang telah 4 hari ditinggal pergi istri Ratnawati dan anaknya yang baru berumur 3 tahun, ditemukan rekan seprofesinya dalam kamar dalam kondisi tidak bernyawa lagi. Lalu warga melarikan ke RSUD dr Fauziah untuk divisum. Ditemui di kediamannya, Ratnawati istri korban, mengatakan, suaminya ditemukan Nurdin temannya dalam kamar dalam kondisi tak bernyawa lagi, lalu memberitahukan kepada warga desa dan aparat desa dan kepada polisi,” katanya. Tidak lama kemudian, sambungnya, datang sejumlah anggota Polsek Jeunieb dan Polres Bireuen ke lokasi. Korban dievakuasi ke Rumah Sakit dr Fauziah untuk divisum. “Saya sudah empat hari pergi dari rumah, karena saya sering mendapatkan, SMS dari wanita lain di HP-nya (Arjuna-red), sehingga kami sering cek-cok dan saya minggat dari rumah, tiba-tiba saya mendapat kabar dia sudah meninggal dunia seorang diri di kamar,” katanya dengan nada sedih. Menurut Ratnawati, suaminya yang telah menganugerahi seorang anak kepadanya, tidak ada masalah lain dengannya kecuali masalah SMS yang diduga dari wanita lain. Namun akhir-akhir ini suaminya tersebut sering mengeluh sakit dalam perut. “Saya tidak menceritakan masalah keluarga saya selama ini, namun yang ada suami saya sering merintih kalau sakit dalam perutnya kumat,” katanya. Kapolres Bireuen, AKBP Yuri Karsono SIK, melalui Kasat Reskrim, Iptu Benny Cahyadi yang didampingi Kapolsek Jeunieb, Iptu PM Kataren, kepada wartawan Kamis (26/1) sore, menjelaskan, kasus itu sudah ditangani pihaknya. “Kita belum tahu penyebab meninggalnya, apakah karena sakit atau ada dugaan lain, sampai sekarang kita masih melakukan pengembangan untuk proses selanjutnya,” katanya. (cb02)

Puluhan Ha Tanaman Padi Diserang Wereng BAGOK (Waspada): Puluhan hektare tanaman padi warga di kawasan Kecamatan Nurussalam, Kab. Aceh Timur, dilaporkan diserang hama sejenis penggerek batang. Namun warga menyebutkan, tanaman padi warga yang terancam panen itu diserang hama wereng. Bukhari, 54, petani sawah asal Gampong Teupin Pukat,Kamis (26/1) mengungkapkan, tanaman padinya seluas 8 rante miliknya kini dalam kondisinya mati total akibat dihantam hama. Padahal sejak tanaman padi masih muda telah diupayakan menggunakan obat pembasmi hama. “Namun hingga kini padi telah berbuah, tapi tetap saja banyak batang padi yang mati. “Sebelumnya telah saya lakukan penyemprotan hingga 6 kali, namun kondisinya tak juga berubah,” kata Bukhari. Informasi lain menyebutkan, hama yang menyerang tanaman sawah warga di Kecamatan Nurussalam bukan saja di Desa Teupin Pukat, namun dibeberapa desa lainnya juga mengalami hal yang sama. Kebanyakan yang terkena hama tersebut yang menanam bibit padi jenis ciherang. “Sedangkan yang menanam bibit lainnya jarang terkena hama itu,” kata Nurhayati. Kabid Perlindungan Tanaman Pangan Dinas Pertanian Holtikultura Aceh Timur, Murniati ketika dimintai keterangan kepada wartawan mengatakan, kemungkinan terjadinya serangan hama terhadap lahan sawah warga dikawasan itu diperkirakan salah satu penyebabnya akibat curah hujan yang tinggi dalam tahun ini. “Tapi Distan akan melakukan pengecekan terhadap jenis hama di wilayah itu untuk dilakukan pendataan,” katanya. (b24)

Waspada/Muhammad H. Ishak

BUKHARI, salah seorang petani di Teupin Pukat, Kecamatan Nurussalam, Aceh Timur, memperlihatkan tanaman padinya yang diserang hama dan diperkirakan tahun ini puluhan hektare areal persawahan di sana gagal panen. Foto direkam Kamis (26/1).

Aceh Utara Siapkan 42 Gampong Percontohan Syari’at Islam LHOKSEUMAWE (Waspada): Pemerintah Kabupaten Aceh Utara mempersiapkan 42 gampong percontohan Syari’at Islam di 27 kecamatan. Gampong percontohan SI penting dibentuk untuk mengumandangkan gema SI di Bumi Serambi Makkah ini. Diyakini, dengan adanya gampong percontohan, berbagai kegiatan keagamaan akan dapat dihudpkan kembali. Gampong percontohan ini juga dipastikan mampu mengantisipasi pengaruh era globalisasi dan modernisasi. Program ini harus sudah berjalan pada tahun 2012 dibawah tanggungjawab Dinas Syariat Islam, dengan menunjukkan imum mukim sebagai koordinator serta melibatkan jajaran Muspika. “Nanti, gampong percontohan itu harus melaksanakan kegiatan pengajian, shalat berjamaah dan mejelis ta’lim dan lain sebagainya,” kata Pj Bupati Drs HM Ali Basyah. Untuk mendukung kegiatan tersebut, masyarakat diminta memperdalam ilmu agama dengan menjajaki Badan Perpustakaan dan Badan Dayah di Provinsi Aceh. Diharapkan nantinya, 42 gampong percontohan SI bisa menjadi pelopor dalam penegakan hukum islam secara kaffah. (b18)

LHOKSUKON (Waspada) : ES, 32, seorang ibu rumah tangga berparas cantik, asal Desa Dayah, Lhoksukon, Aceh Utara, sejak Kamis (26/1) resmi menjadi tahanan Polres Aceh Utara. Ibu tiga anak itu ditahan terkait kasus poliandri alias bersuami dua, pemalsuan dokumen nikah dan penipuan. “Selain ES, kita juga menahan suami keduanya, ADR, 32, asal Keude Lhoksukon. ES sendiri kita titipkan ke Rumah Tahanan Lhoksukon, karena di Mapolres tidak tersedia sel khusus untuk wanita,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim AKP Marzuki, di ruang kerjanya, kemarin. Kasat Reskrim menambahkan, ES dan AD diproses berdasarkan pengaduan dari suami pertama ES berinisial Z, 37, juga warga Lhoksukon, 6 Januari 2012 lalu. Atas dasar aduan itu, polisi kemudian memeriksa lima saksi hingga akhirnya menetapkan ES dan AD sebagai tersangka dan langsung ditahan. “ES selama ini tinggal bersama orang tuanya di komplek Perumnas Langsa. Suami pertamanya, Z, jarang pulang. Z mengetahui ES Waspada/Musyawir

KASAT Reskrim Polres Aceh Utara AKP Marzuki memperlihatkan duplikat surat keterangan nikah ES dan AD di Mapolres Aceh Utara, Kamis (26/1).

PT PIM Belum Bertanggungjawab

Korban Pencemaran LimbahTuntutGantiRugi LHOKSEUMAWE(Waspada): Pasca positifnya temuan sample pencemaran limbah berbahaya di Sungai Ujung Pacu, kini masyarakat dari desa binaan wilayah berbatasan Kabupaten Aceh Utara dan Kota Lhokseumawe, menuding PT Pupuk Iskandar Muda (PIM) sebagai pelaku tidak bertanggung jawab atas dampak buruk lingkungan yang dialami para korban yang mengalami kerugian secara moril maupun materi. Terkait efek buruk pencemaran lingkungan oleh limbah Amoniak yang kembali terjadi di lingkaran PT PIM telah meresahkan masyarakat sekitar yang kerap mengalami kerugian bukan hanya faktor ancaman kesehatan jiwa tapi juga menimbulkan kerugian materi. Apalagi secara hukum dampak buruk pencemaran limbah oleh PT PIM kini sudah jelas dan memiliki bukti otentik setelah uji sample yang dilakukan Pemerintah Kota Lhokseumawe dan Kabupaten Aceh Utara menunjukkan hasil adanya kandungan racun jenis Amoniak. Salah seorang korban pencemaran limbah Nurdin alias Apadin warga Desa Blang Naleung Mameh, Kecamatan Muara Satu, Lhokseumawe, Kamis (26/1) mengatakan, meski sudah terbukti merusak lingkunghan dengan limbah, namun sampai saat ini pihak PT PIM belum menunjukkan sikap bertanggung jawab. Apadin menjelaskan kasus terakhir pencemaran limbah oleh PT PIM terjadi di Sungai Ujung Pacu yang membuat banyak ikan mati seketika dan menyebar melalui air hingga ikan-ikan dalam tambak warga juga ikut menjadi korban keracunan. Kasus seperti ini, menurut Apadin kerap terjadi dan risiko selalu diterima warga sejak awal tahun 1984 berdirinya PT PIM dan kasus terparah terjadi di tahun 1988, hingga baru-baru ini hasil pembuangan limbah amoniak dari PT PIM berulang kali menyerang kesehatan dan ketentraman warga. Menurut data sementara dari warga lingkungan, terdapat tujuh desa yang menjadi korban pencema-

ran oleh PT PIM. Masing-masingnya wilayah Kabupaten Aceh Utara Desa Paloh Gading, Tambon Baroh dan Blang Karing dan wilayah Kota Lhokseumawe yaitu Desa Blang Naleung Mameh dan Ujung Pacu. “Bukan hanya udara yang segar sumber kehidupan manusia saja yang teracuni limbah, tapi juga meracuni air dan tanah warga warga lingkungan setempat. Karena sering tidak terbukti, maka warga yang menjadi korban pun tidak bisa menuntut kerugian yang dialaminya,” papar Apadin. Akan tetapi Apadin sangat menyayangkan, pada saat pencemaran limbah terjadi, bukan hanya membuat ikan yang mati tiba-tiba, tapi yang mudah ditangkap hal itu juga sempat dikonsumsi oleh masyarakat yang tidak tahu apaapa. Hal serupa juga diungkapkan korban kerugian pencemaran limbah Adam Majid, 47 warga Blang Naleung Mameh. Dia mengaku dirinya mengalami kerugian yang sangat besar pasca pencemaran limbah oleh PT PIM. Adam menyatakan saat itu disaksikan juga petugas PT PIM dan beberapa LSM secara bersama melihat kondisi tambak miliknya tercemar Amoniak dan ratusan ikan ternak jenis Bandeng semuanya mati. Akibat pencemaran limbah itu, sambung Adam, dirinya mengalami kerugian besar secara moril maupun materil. Karena bukan hanya modal membeli dan memelihara ikan bandeng saja yang hangus, tapi yang dialaminya semua ikan mati dan kondisi tambak pun kini sudah teracuni.

Adam menambahkan dirinya hanya salah satu dari ratusan korban lainnya yang menderita kerugian besar, namun masih ada pemilik tambah lain yang mengalami hal yang serupa. Padahal lebih seribu Ikan Bandeng didalam Tambak Adam, hanya tinggal menunggu masa panen pada bulan mendatang. Namun sayangnya sebelum memetik hasil panen yang diimpikannya, keburu limbah Amoniak PT PIM datang membunuh dan menghancurkan semuanya. “Kami menuntut kerugian yang sudah kami alami. Saya habis semuanya, tidak ada yang tersisa lagi dari hasil kerja keras saya selama ini. Semua ikan saya mati dan sekarang nasib tambak saya sudah teracuni,” tutur Addam. Oleh karena warga juga meminta Pemko Lhokseumawe atau Pemkab Aceh Utara agar tidak menutup mata menyaksikan penderitaan masyarakat yang terkena dampak buruk pencemaran limbah oleh pabrik raksasa setempat. Warga desa sekitar kini menuntut ganti rugi, bila tidak para korban akan turun bersama massa untuk melakukan unjuk rasa secara besar-besaran. Sementara Kabag Humas PT PIM Mustafa Thahir yang dikonfirmasi Waspada tidak membantah tudingan tersebut, namun dirinya tidak juga bisa memberi keterangan sebab sedang dalam masa cuti. Mustafa juga meminta Waspada untuk mengkonfirmasi Sekper. PT PIM Syakban. Namun setelah berulang kali dicoba menghubungi via telepon selularnya Syakban juga tidak mengangkat panggilan. (b16)

Waspada/Gito Rolies

PERIKSA PASUKAN:Kasdam IM Brigjen TNI Panduwibowo sedang memeriksa personil kepolisian militer dan Polri, dalam upacara gelar opsgaktib Kepolisian militer tahun 2012, Kamis (26/1) di Lapangan Neusu Banda Aceh.

Tradisi Orang Aceh Mengaji Di Rumah Telah Punah SALAH satu tradisi atau kebiasaan orang Aceh dalam menuntun anak-anak mempelajari ilmu agama adalah mengajarkan membaca Alquran di rumahrumah kepada anak-anak yang masih berusia dini, tapi kini telah tiada. Punahnya tradisi itu diperkiran sejak Aceh dilanda konflik, kemudian diperparah pengaruh globalisasi. Sekilas tradisi orang Aceh mengajari anaknya mengaji, terutama kitab suci Alquran. Anakanak mulai usia lima tahun ketika malam tak ada ruang untuk bermain, nonton televisi dan main play station (PS). Selepas magrib anak-anak disibukkan membaca Alquran yang

selingi belajar mata pelajaran sekolah. Alquran yang dibaca bervariasi, mulai quran ubeut (Alquran Juz’amma) sampai quran rayeuk (Alquran 30 juz). Bertindak selaku guru tak lain kecuali orangtuanya sendiri, baik ayah maupun ibu. Anakanak begitu patuh, tanpa disuruh ia membaca sendiri. Sang guru tak mesti duduk di samping anak-anaknya, cukup mendengar dari jauh, sudah tahu mana yang salah dan benar dibaca maghrajal huruf dan tajwid. Begitulah orangtua dulu, belum lama pun. Melewati setiap rumah, hampir tak terdengar suara bacaan Alquran seperti Aleh Ba Ta Tsa sampai Wassalmu, bacaan ini khusus bagi pemula. Kemudian ada juga yang membaca Anakom, Banakom, Tanakom sampai Wasssalmu. Begitu juga bagi anak-anak yang sudah lancar membaca akan dinaikan

C1

ke tingkat lebih tinggi secara perlahan sampai pada Alquran 30 juz. Sebagian orangtua, apabila anak-anaknya sudah lancar dan mampu, bahkan ada yang sudah bisa menghafal Alquran Juz’amma. Maka akan dikirim ke rumah tetangga yang lebih kompeten mengajari Alquran di segi tajwid dan maghrajal huruf, bahkan mengajari ilmuilmu agama lainnya. Lagi-lagi, mereka tak mengabaikan belajar mata pelajaran sekolah. Ti Arfah, 45, guru ngaji di salah satu desa di pedalaman Aceh Utara, kini masih mengajar beberapa anak-anak. Saat ditemui Waspada mengatakan, ia telah 30 tahun lebih mengajar ngaji bagi anak-anak tetangga, mulai anak-anak usia lima tahun sampai usai 15 tahun. Namun kini, sejak Aceh dilanda konflik, hanya tinggal beberapa orangtua yang masih menitip

anaknya per generasi untuk diajarkan ngaji pada malam hari. Ketika disinggung minatnya, ia mengaku sangat menyukai pekerjaan itu. Alasanya bukan mencari imbalan di segi finansial, tapi sembari ia belajar untuk sendiri, pekerjaan mengajar ilmu agama bagi orang lain sangat mulia di sisi-Nya. Kini perang tidak lagi, Aceh sudah aman dan tenteram apa alasan anak-anak tidak lagi dituntun demikian? Sekretaris Himpunan Ulama Dayah Aceh (HUDA) Kec. Sawang, Aceh Utara dan juga pimpinan dayah, Tgk Jalaluddin mengaku anakanak yang masih usia dini, tentunya mereka belum berpengaruh dengan lingkungan itu tidak lepas dari peran orangtua. Orangtua lalai, sibuk dan tidak open dalam hal agama, maka anak-anak usia dini yang dijumpai sekarang adalah akibat ulah orangtuanya sendiri.

Kerena orang pertama yang menularkan pendidikan kepada anak adalah orangtua, lebihlebih pendidikan agama. Orangtua lihai, peka dan peduli, maka anaknya akan terbentuk dengan sempurna. “Tapi kita dapatkan sekarang pada malam hari, anakanak disibukkan dengan ‘teknologi’, seperti nonton TV dan main PS. Mereka nonton TV, karena ibunya tidak ketinggalan episode sinetron yang silih berganti dan bersambung. Begitu juga ayahnya, selepas magrib langsung menuju warung kopi,” sebutnya. Tambahnya, padahal kalau saja tradisi itu masih berjalan sampai saat ini, anak-anak itu akan mendapatkan ilmu langsung dari orangtuanya, mereka akan menerima bagaimana kasih sayang dan keakraban orangtua. Tapi sayang itu sudah berlalu. Mustafa Kamal

sudah kawin lagi dengan pria lain dari desasdesus warga di sekitar perumnas. Ketika dicek ke kepala kampung ternyata benar. Bahkan kepala kampung menunjukkan surat keterangan nikah yang diberikan ES kepadanya. Duplikat surat keterangan nikah itu sekarang kita sita sebagai barang bukti,” ujar arzuki. Surat keterangan nikah itu ditandatangani dan distempel atas nama Tgk Hasbuh, warga Sungai Raya, Aceh Timur. Menurut polisi, Tgk Hasbuh juga sudah dipanggil sebagai saksi dan dia mengaku tidak pernah mengeluarkan surat tersebut.“Pengakuan saksi ini masih kita dalami. Yang jelas, AD sudah berpuluh kali pulang dan tidur sekamar dengan ES dan ia juga menyatakan ke warga sekitar AD suaminya yang sah,” tutur Kasat Reskrim. ES yang berkulit kuning langsat itu kini terjerat pasal berlapis, antara lain, Pasal 279 ayat 1 dan 2 tentang menghilangkan status perkawinan, Pasal 263 ayat 1 dan 2 tentang pemalsuan dokumen, Pasal 284 tentang perzinahan dan Pasal 335 tentang perbuatan tidak menyenangkan, dengan ancaman hukuman maksimal di atas 8 tahun penjara. (b19)

Suami Main Judi Di Pos Kamling, Kaum Ibu Lapor Ke MPU REDELONG (Waspada): Sejumlah kaum ibu di Kabupaten Bener Meriah melaporkan suaminya bermain judi saat jaga malam di pos kamling. Mereka melaporkan itu ke Majelis Permusyawaratan Ulama (MPU). DemikianTgk Syarqawi Abdussamad, Ketua MPU Bener Meriah. “Ada beberapa kampung yang saat ini telah menerapkan kegiatan jaga malam, malah pos Siskamling itu dijadikan tempat bermain judi. Hal itu dibuktikan dengan beberapa ibu yang melapor kepada MPU Bener Meriah, bahwa suami-suami mereka asyik bermain judi ketika melakukan jaga malam,” kata Ketua MPU ini,Kamis (26/1). Ketika ditanya, siapa dan dari daerah mana ibu-ibu itu? Tgk Syarqawi Abdus Samad mengatakan itu menjadi rahasia mereka. Dan menurutnya, jika diberitahukan kasihan ibuibu itu akan menjadi sasaran kemarahan

suaminya yang bermain judi. Disebutkan, dengan diterapkannya kembali jaga malam di pos-pos di kampung-kampung merupakan kegiatan yang bermanfaat untuk menjaga keamanan dan ketertiban lingkungan, namun hendaknya tidak disalahgunakan menjadi lapak untuk bermain judi. Jika pos-pos jaga malam itu dijadikan tempat bermain judi, justru bukan memberikan rasa aman bagi warga, tetapi sebaliknya membuat warga semakin resah lantaran fungsi maupun kegunaan pos jaga menjadi tempat untuk kegiatan negatif,” ujar Ketua MPU Bener Meriah ini. Melihat kondisi ini, katanya, MPU Bener Meriah, telah berkoordinasi dengan pihak kepolisian setempat agar bisa menertibkan penyimpangan yang terjadi di beberapa pos-pos jaga malam. (b33)

Suami Tunggu Salak, Istripun Menanti Sang Mantan KELAKUAN Er, 29, istri pedagang salak yang tercatat sebagai warga Dusun I Pantonlabu, Kecamatan Tanah Jambo Aye, Aceh Utara, sungguh tak layak ditiru. Disaat suaminya mencari nafkah dengan menunggu mobil salak dari Medan, dia justru bermesum dengan mantan pacar. Kasus ini terjadi di rumah kontrakan Er di Desa Samakurok, Kecamatan Tanah Jambo Aye, Rabu (25/ 1) malam sekitar pukul 20:30. Namun belum semWaspada/Musyawir pat ‘naik ke bulan’, rumah PETUGAS WH menginterogasi MY, tersangka kasus mesum, di kontrakannya keburu di- Mapolsek Tanah Jambo Aye—Pantonlabu, Aceh Utara, Kamis (26/ grebek warga. Er dan man- 1) pagi. tan pacarnya pun harus beruMasih menurut Amir, pasca kejadian, WH rusan denganWilayatul Hisbah atau Polisi Syariat. “Mantan pacar Er berinisial MY, 29, asal segera memanggil aparat desa dan keluarga Desa Meunasah Trieng, Kecamatan Tanah Luas, dari kedua belah pihak untuk proses lebih lanjut. Aceh Utara. Malam itu dia dalam perjalanan “Alhamdulillah, sekarang sudah tuntas. Para pulang dari Idi, Aceh Timur, lalu singgah ke pihak sepakat menyelesaikan kasus ini secara rumah kontrakan Er. Kepada petugas, MY me- kekeluargaan dan MY sendiri diwajibkan ngaku khilaf dan mengakui perbuatannya. Tapi membayar denda kehormatan kepada suami hanya sebatas bercumbu,”kata Danpos WH Er serta menyediakan tanah timbun untuk Meunasah,”tandasnya. (b19) Pantonlabu, Tgk Amirudin, Kamis (26/1).

WH Akan Digabung Kembali Dengan Dinas Syari’at Islam Razia Kasih Sayang Digelar Di Kota Langsa LANGSA (Waspada): Wilayatul Hisbah (WH) akan digabung kembali dengan Dinas Syari’at Islam (SI) Kota Langsa. Sebelumnya, WH berada di bawah instansi SI, tetapi kemudian dialihkan di bawah kendali Kantor Satpol Pamong Praja. Kini sudah ada rencanaWH akan ditarik kembali ke Dinas Syari’at Islam. Demikian Kepala Dinas Syari’at Islam Kota Langsa Ibrahim Latief menjelaskan kepada Waspada di Langsa, Kamis (26/1). Ibrahim Latief mengemukakan, penarikan kembaliWilayatul Hisbah ke Dinas Syari’at Islam sudah disetujuiWali Kota Langsa Zulkifli Zainon. Hal ini dilakukan untuk memudahkan bagi pelaksanaan tugas-tugas dalam upaya untuk melakukan penertiban dan pengawasan terhadap siapapun pelaku pelanggaran qanun tentang Syari’at Islam, baik bidang aqidah, ibadah maupun syi’ar Islam. Dengan demikian, proses penerapan Syari’at Islam secara kaffah akan mudah terlaksana. Seperti diketahui, Wilayatul Hisbah adalah sebuah lembaga yang dibentuk di seluruh daerah Provinsi Aceh termasuk di Kota Langsa. Lembaga WH itu diberi kewenangan untuk melakukan pengawasan terhadap pelaksanaan qanun khusus tentang Syari’at Islam. Personil WH terdiri dari lelaki dan perempuan, untuk Kota Langsa anggota WH tercatat ada 40 orang, katanya. Penempatan WH di Kantor Satpol PP selama ini, sebetulnya tidak ada masalah. Hanya saja, menurut Ibrahim Latief, kurang tepat karena tugas-tugas WH lebih terkait di Dinas Syari’at Islam sehingga diharapkan WH dapat mengemban tugas dengan maksimal dalam penegakan qanun bagi setiap pelaku pelanggaran yang timbul dalam masyarakat di Kota Langsa. Yang utama adalah untuk memudahkan koordinasi di setiap tugas penertiban. Satpol PP dikatakan juga ikut dalam penetiban ini. Kepala Dinas Syari’at Islam Kota Langsa itu mengatakan, WH akan diposkokan di SI terhitung sejak Februari 2012. Sedangkan yang menyangkut dengan penghasilan mareka (gaji/ honor) tetap ditangani Kantor Satpol PP. “Sementara ini, mareka masih bersifat posko dulu di SI. Baru kemudian pada 2013 nanti, mareka secara efektif akan difungsikan penuh,” ujar Ibrahim Latief yang juga Ketua Dai Kota Langsa. Razia Kasih Sayang Kepala Dinas Syari’at Islam Drs H Ibrahim Latief yang baru dilantik sekitar tiga bulan yang

Waspada/Syahrul Karim

KEPALA Dinas Syari’at Islam Kota Langsa Ibrahim Latief ketika menyerahkan buku qanun dan Alquran kepada geuchiek Gampong Daulat, Kecamatan Langsa Kota Zainuddin (kiri) pada acara sosialisasi qanun Syari’at Islam yang dilaksanakan di Meunasah Gampong Daulat, Selasa malam lalu (24/1). lalu, telah melaksanakan berbagai program dan gebrakan. Salah satu di antaranya adalah turun ke gampong-gampong bersama stafnya untuk mensosisalisasikan qanun Syari’at Islam kepada masyarakat termasuk kaum ibu-ibu yang dinilai menjadi unsur terpenting dalam penegakan qanun. Pada kesempatan itu, selain menyerahkan buku qanun juga Ibrahim Latief menyerahkan Alquran disertai terjemah dan transliterasi kepada geuchiek gampong setempat. Dalam waktu dekat ini, SI bersamaWH serta pihak-pihak terkait lainnya, akan menggelar razia kasih sayang. Sasaran utama adalah penggunaan busana di kalangan para remaja putri yang belakangan ini dinilai sudah jauh menyimpang dari aturan yang dibolehkan. Dalam hubungan ini, Ibrahim Latief menilai penggunaan busana muslim sebagian kalangan remaja putri di Kota Langsa sudah waktunya ditertibkan. Busana yang dikenakan sejumlah remaja putri selama ini, sudah menyimpang dari peraturan yang berlaku di Aceh. Oleh karena itu, Dinas Syari’at Islam sebagai instansi pemerintah yang bertanggungjawab untuk itu, perlu segera mengambil langkah-langkah kongkrit dalam penertiban ini. “Untuk sementara ini, belum ada tindakan tetapi lebih bersifat kepada pembinaan,” tandasnya. Dia menambahkan razia kasih sayang tersebut akan melibatkan semua unsur. (b21)

Aceh

C2

WASPADA Jumat 27 Januari 2012

Perubahan Iklim, Pola Tanam Padi Bergeser

Bupati Agara Kembali Mutasi Pejabat KUTACANE (Waspada) : Untuk meningkatkan kinerja dan karier PNS, Bupati Agara H Hasanuddin , Rabu (25/1) di Oproom Setdakab menggelar mutasi terhadap 21 pejabat eselon III dan IV di lingkungan Pemkab Agara. Selain mengangkat Kabid di Dinas Perhubungan, Telekomunikasi dan Informatika menjadi camat serta Kasi menjadi Kabid, mutasi juga mengakibatkan dua pejabat eselon III lainnya dibangkupanjangkan. Dua pejabat yang dibangkupanjangkan yakni, Hataruddin yang sebelumnya Sekretaris Dinas Pengelolaan Keuangan dan Kekayaan Daerah (DPKKD) dan Muhammad Ridwan yang sebelumnya sebagai Camat Lawe Sigalagala, sedangkan satu lagi pejabat eselon III Sunawardi Desky yang sebelumnya Sekretaris di Dishutbun dimutasi menjadi Kabid di kantor Badan Ketahanan Pangan dan Penyuluh. Pejabat eselon III yang dilantik Zul Fahmi sebagai Camat Lawe Sigalagala, jabatan sebelumnya Kabid Darat Dishubtelinfo, Erlandasyah sebagai Kabid Aneka Industri Kecil Disperindag, Hj Purnama sebagai Kabid Promosi di Disperindag, Kamaluddin sebagai Sekretaris Dishutbun. Ramli Desky sebagai Sekretaris Dinas Pertanian dan Tanaman Pangan, Sunan Ramud sebagai Sekretaris Dinas Pengelolaan Keuangan dan Kekayaan Daerah menggantikan Hataruddin, Tamiat yang sebelumnya pembantu Staf Ahli Bupati dipromosikan menjadi Kabid Telekomunikasi di Dinas Perhubungan dan Samsul Bahri sebagai Kabid Darat Dinas Pehubungan. Hasbandi Mamasta yang sebelumnya sebagai Kasubbag di Bagian Ortala Setdakab dipromosikan menjadi Kabid Pendapatan di Dinas Pengelolaan Keuangan dan Kekayaan Daerah Agara. (b26)

LSM Minta Proses Lelang Di Disdik Sesuai Pepres BLANGKEJEREN (Waspada): Terkait proses pelelangan yang dilaksanakan di Dinas Pendidikan Gayo Lues, sejumlah 67 paket dari dana Otsus telah berlangsung di LPSE (internet) dua hari lalu, sejumlah LSM berharap agar ketentuan proses lelang disesuaikan dengan Pepres No.54 Tahun 2010. “Karena kalau tidak diterapkan sesuai dengan pepres tersebut, akan menimbulkan hukum di kemudian hari, selain itu kita juga tidak menginginkan adanya paket-paket yang dimemokan para pejabat tertentu, sehingga kesannya dalam pelelangan ini tidak fair,” ujar Sukran D, Ketua LSM Perlahan, Kamis (26/1). Apalagi tersiar isu bahwa untuk mendapatkan paket tersebut, harus memberikan fee di depan sebesar sepuluh persen dari nilai paket. “Kalau kondisi ini sempat terjadi, kita sangat menyayangkan, karena bagaimana dengan nasib para kontraktor lain, yang tidak mempunyai memo dari pejabat,” ungkapnya. Kabid Bina Program Dinas Pendidikan Jamin tidak mengetahui hal tersebut, mengingat DIPA dari provinsi belum diterima dan juga belum disahkan. (cjs)

Pemkab Gayo Lues Bangun 7 Unit Gedung Di RSUD BLANGKEJEREN (Waspada) : Pemerintah Kabupaten Gayo Lues pada 2012 ini akan membangun 7 unit gedung untuk berbagai fasilitas di Rumah Sakit Umum Daerah (RSUD) sebagai upaya peningkatan pelayanan kesehatan kepada masyarakat. “Pembangunan gedung itu diharapkan dapat dimulai antara Maret atau April, karena saat ini masih proses lelang dan ditargetkan pengerjaannya dapat selesai pada akhir tahun ini,” ujar Bupati Gayo Lues, Kamis (26/1). Menurut dia, pembangunan gedung tersebut akan menggunakan dana dari Otsus 2012 sebesar Rp4 miliar yang merupakan salah satu fasilitas pelengkap untuk menuju akreditasi RSUD. Antara lain fasilitas gedung yang akan dibangun, pembangunan IPAL RSUD Rp500 juta, pembangunan dapur gizi Rp451 juta, pembangunan gedung fisioterapi Rp801 juta, pembangunan instalasi farmasi Rp801 juta, pembangunan gedung radiologi Rp1miliar lebih, pembangunan gedung IPSRS Rp451 juta dan pembangunan gedung laundry Rp451 juta. (cjs)

Polisi Periksa 4 Saksi Kasus Pembunuhan Di Pijay SIGLI (Waspada) : Satuan Reserse Kriminal Polres Pidie telah memeriksa sedikitnya empat saksi untuk kasus pembunuhan sadis yang merenggut nyawa Sulaiman Yusuf, 48, warga Desa Paru Keude, Kecamatan, Bandar Baru, Pidie Jaya, Rabu (25/1). Empat saksi yang diperiksa polisi adalah Ramadhan, Sal, Jal dan Gun. Keempat saksi tercatat sebagai warga Desa Paru Keude, Kecamatan Bandar Baru. “Kasus ini sampai sekarang masih dalam penyelidikan dan belum ada penetapan tersangka. Kemungkinan untuk saksi yang akan dimintai keterangan akan bertambah,” kata Kasat Reskrim Polres Pidie AKP Jatmiko, Kamis (26/1). Jatmiko menjelaskan, keempat warga yang dimintai keterangannya sebagai saksi merupakan orang-orang yang terakhir melihat korban sebelum ditemukan tewas.”Kita berharap kepada masyarakat dapat membantu penyelidikan polisi dalam mengungkap misteri pembununhan Sulaiman,” papar Jatmiko. Mardiana, 43, istri korban ditemui di rumah duka di Desa Paru Keude, Kamis (26/1) mengungkapkan, sebelum Usman, suaminya ditemukan meninggal dunia di dalam kebun coklat oleh warga, suaminya bersikap biasa-biasa saja. Dalam kehidupan seharihari suaminya itu tidak ada sengketa dengan orang lain. “Selasa (24/1), seperti biasa suami saya pergi ke kebun. Kemudian saya susul sambil membawa makanan ringan. Di kebun saya melihat ia sedang menyemprot hama tanaman cabe. Sekira pukul 12:00, saya pamit pulang ke rumah. Namun sampai malam beliau tidak pulang. Kemudian warga ramai-ramai mencarinya dan ditemukan telah meninggal dunia,” kata Mardiana sambil menangis. (b10)

Media Berperan Strategis Dalam Berlalulintas BLANGPIDIE (Waspada) : Kecelakaan lalulintas yang beberapa hari ini santer dibicarakan dan menjadi topik pemberitaan di sejumlah media, dinilai dapat menjadi sebuah ‘pesan’ khusus kepada masyarakat agar selalu waspada dan mengedepankan aturan dalam berlalulintas. Selain itu media dianggap memiliki peran strategis dalam mengemban misi sosialisasi tentang pentingnya penerapan aturan dan kepatuhan dalam mengikuti rambu-rambu lalulintas, sehingga dapat memberikan keselamatan bagi para pengguna jalan. Demikian Kepala Satuan Polisi AKP M SAEFUDDIN Lalulintas (Kasat lantas) Polres Kasat Lantas Polres Abdya Aceh Barat Daya (Abdya) AKP M Saefuddin dalam acara silaturahmi dan diskusi dengan para wartawan di kantor Balai PWI Abdya Blangpidie, Kamis (26/1). Menurut AKP M Saefuddin, selama ini banyak kesan yang muncul di masyarakat bahwa peraturan dan rambu lalulintas yang ada belum menjadi prioritas utama dalam menggunakan kendaran serta menjalani aktivitas di jalan raya, sehingga dengan pemberitaan di media seperti kasus-kasus laka lantas dapat memberikan pemahaman kepada masyarakat tentang pentingnya penerapan aturan dalam berkendara demi terciptanya keselamatan. “Ingin selamat di jalan? Patuhi aturan dan rambu lalulintas,” papar Saefuddin. Kasat lantas juga menyampaikan pesan Kapolres Abdya AKBP Subakti berupa pemantapan dan konsolidasi seluruh personel kepolisian dengan semua mitra kerja di mana wartawan sebagai mitra penting dalam rangka menciptakan ketertiban umum dan peningkatan kewaspadaan lingkungan, sehingga keamanan daerah dapat tercapai. (cb05)

Petani Aceh Tengah Prediksi Gagal Panen TAKENGEN (Waspada): Memasuki awal tahun ini, mayoritas areal persawahan di seputar Aceh Tengah telah selesai ditanami bibit padi. Kendati demikian sebagian petani di daerah dataran tinggi ini memprediksi akan terjadi gagal panen pada musim mendatang. Hal itu menurut sejumlah petani, karena pola tanam padi pada musim tahun ini bergeser di Aceh Tengah, disebabkan perubahan iklim pada akhir tahun 2011. Sawah tadah hujan yang digarap petani mengalami kekurangan air. Padahal lazimnya di setiap akhir tahun curah hujan mampu mengairi lahan persawahan. “Biasanya petani telah menyelesaikan masa tanam pada Oktober, dan paling lambat akhir November setiap tahunnya. Namun kali ini terjadi pergeseran, masa tanam padi terjadi di awal tahun. Perubahan pola tanam ini dikhawatirkan mengurangi hasil panen,” ungkap Donan Aman

Waspada/Irwandi MN

SEORANG petani sedang membersihkan gulma di areal persawahan di Takengen, Aceh Tengah. Petani setempat khawatir perubahan masa tanam pada awal tahun ini menyebabkan gagal panen. Foto direkam baru-baru ini.

Bila Tak Disahkan Akhir Januari

APBA 2012 Bakal Kena Penalti BANDA ACEH (Waspada): Disharmoni DPRA dan Gubernur Aceh bila tidak segera mencair akan berdampak dipinaltinya alokasi RAPBA 2012 sebesar Rp8,7 triliun. Sebab itu, berbagai pihak berharap sebelum akhir Januari ini APBA sudah disahkan oleh legislator Aceh. Keterlambatan penetapan APBA 2012 akibat terjadi tarikmenarik antara eksekutif yang diwakili Irwandi Yusuf dan legislatif yang didominasi Partai Aceh (PA). Gubernur Aceh IrwandiYusuf sendiri sudah melayangkan surat berisi Peraturan Gubernur (Pergub) kepada Mendagri, 18 Januari dan satu hari kemudian, 19 Januari sudah diterima Dirjen Anggaran Kemendagri. Dampak surat Irwandi Yusuf, Mendagri sudah mengutus Direktur Anggaran Kemendagri bertemu DPRA, Rabu (25/ 1) meminta DPRA segera menetapkan APBA 2012 sebelum

akhir Januari. Karo Hukum dan Humas Setda Aceh Makmur Ibrahim, Kamis (26/1) menyatakan, bila 14 hari surat Pergub tentang APBA 2012 tidak disahkan, maka secara otomatis APBA 2012 sudah bisa digunakan. Sedangkan besarnya sesuai dengan PPAS (plafon prioritas anggaran sementara) yang sudah disepakati kedua belah pihak (eksekutif dan legislatif) sekitar Oktober lalu sebesar Rp8,7 triliun. Hal ini, kata dia, sesuai Permendagri No.22/2011, poin IV.9 antara lain disebutkan, apabila dalam November tidak disahkan, maka Kepala Daerah harus menetapkan APBA dengan Peraturan Kepala Daerah. “Peraturan itu ya Pergub,” kata Makmur. Sedangkan kab/kota, yakni keputusanWali Kota dan Bupati untuk APBK. Selain itu, hal itu juga diatur dalam PP No.56/85 tentang Pengelolaan Keuangan Daerah. Bila melihat waktu, kata Makmur, APBA (Anggaran Pendapatan Belanja Aceh) mestinya saat ini sudah dilakukan pengesahan. Sebab di Permendagri disebutkan November sudah dilakukan pengesahan,

lalu dievaluasi di Mendagri sekitar 15 hari dan 15 hari berikutnya SKPA membuat RKA agar program bisa dilaksanakan. Wakil Ketua DPRA Bidang Anggaran Amir Helmi, sehari sebelumnya kepada wartawan tetap optimis pembahasan RAPBA 2012 tetap berpedoman kepada Qanun Aceh. “Saya sudah mendapat informasi APBA sudah disahkan 31 Januari 2012,” kata politisi senior dari Partai Demokrat ini. Dewan Melunak Sementara aktivitas anggota dewan tampak terasa padat. Tujuh komisi di DPRA yang tadinya masih terjadi tolak tarik terhadap anggaran yang diusulkan eksekutif, tampak sudah mulai melunak. Soalnya, bila pembahasan RAPBA 2012 tidak menggunakan Qanun Aceh, maka anggaran dan program aspirasi 69 anggota DPRA yang per orangnya masing masing memperoleh Rp5 miliar itu bakal hilang. Informasi lain, bila sebelumnya ada tiga provinsi di Indonesia yang belum mengesahkan APBA, termasuk Papua, kini tinggal Aceh. Sebab di dua provinsi itu sudah tuntas dan disahkan anggaran di provinsi masing masing. (b01)

Gubernur Nilai DPRA Kekanak-kanakan IDI (Waspada): Gubernur Aceh H Irwandi Yusuf, MSi menilai anggota Dewan Perwakilan Rakyat Aceh (DPRA) khususnya Fraksi Partai Aceh (PA) masih kekanak-kanakan. Sehingga Anggaran Pendapatan Belanja Aceh (APBA) harus dipergubkan. Bahkan, Irwandi mengaku berkas Pergub sudah dikirim ke Mendagri di Jakarta. “Setuju atau setuju, Pergub itu bukan urusan DPRA, tapi itu urusan saya sebagai Gubernur Aceh,” kata H Irwandi Yusuf menjawab Waspada usai peresmian Pelabuhan Perikanan Pantai (PPP) Idi di Kab. Aceh Timur, Kamis (26/1). Menurutnya, DPRA sudah banyak melanggar kesepakatan dengan Gubernur Aceh selaku pemegang tampuk kekuasaan dalam setiap koordinasi. Pelanggaran yang pertama dilakukan oleh DPRA adalah terkait jadwal, dimana Ketua DPRA, Hasbi Abdullah telah berjanji dengan Gubernur Aceh, akhir Desember 2011 persoalan APBA sudah selesai semuanya. Tapi janjinya tidak ditepati. Selain itu, lanjut H Irwandi Yusuf, Ketua DPR Aceh menggeser jadwal ke tanggal 12 Januari 2012. “Karena itikad kita baik maka kita tunggu, tapi itupun tidak ada,” kata Irwandi Yusuf seraya menambahkan, terkait APBA pihak DPRA pernah melakukan protes ataupun komplin

ke Gubernur Aceh, Ketua DPRA tidak mampu mengatur anak buahnya, yaitu anggota DPRA dari Fraksi Partai Aceh (PA). Perlu ditegaskan juga, sambung Irwandi, anggota DPRA dari Fraksi Partai Aceh (PA) dinyatakan oleh Ketua DPRA Hasbi Abdullah tidak bisa diatur oleh Ketua Fraksi PA ataupun Ketua DPRA. “Lalu kemudian jadwal tadi (pembahasan APBA—red) bergeser lagi ke 19 Januari 2012, tapi di tanggal itu juga tidak ada, ternyata bohong saja,” beber Irwandi Yusuf. Sehingga Gubernur Aceh mengaku mendatangani Pengantar Peraturan Gubernur (Pergub) untuk dikirim ke Menteri Dalam Negeri (Mendagri) di Jakarta. “Mendagri sekarang sedang mengirimkan utusannya ke Aceh untuk mencari solusi, karena ada dana-dana yang mungkin tidak bisa dipertanggungjawabkan sebagaimana usulan DPRA, seperti dana aspirasi senilai Rp5 miliar per anggota DPRA,” beber Irwandi Yusuf. Lalu, lanjut Irwandi, anggota DPRA meminta lagi dana komisi sebanyak 7 komisi dengan angka Rp30 miliar per komisi. “Awalnya, saya setuju diberikan dana aspirasi dan dana komisi diberikan, asal diarahkan untuk proyek-proyek yang besar yang dapat dimanfaatkan untuk kesejahteraan rakyat,” katanya

kencang disertai hujan sering kali cabang-cabang itu menyentuh kabel listrik tegangan tinggi. Seorang warga Kota Banda Aceh, Ahmad, Kamis (26/1) menegaskan, sudah seharusnya puluhan pohon Asam Jawa yang berada di bahu jalan itu ditebang lalu diganti dengan tanaman baru yang lain. Menurut Ahmad, sepanjang jalan itu setiap hari dilalui kendaraan karena jalan tersebut

GeRAK Aceh Dukung Pengesahan APBA 2012 Akhir Januari BANDA ACEH ( Waspada): Molornya pengesahan Anggaran dan Pendapatan Belanja Aceh (APBA) tahun 2012 dari jadwal yang telah disepakati akan menjadi catatan hitam atas kegagalan perwujudan tata kelola pemerintahan di Aceh terutama atas tata pengelolaan anggaran yang baik dan taat aturan. Sama dengan kondisi tahun-tahun sebelumnya, sejarah kelam ini akan kembali berulang akibat tingginya gesekan eksistensi budaya kolektif politik antara eksekutif dan legislatif untuk kepentingan masing-masing, sehingga dampaknya berpengaruh pada pengesahan anggaran tepat waktu dan taat aturan. Menurut Kepala Divisi Kebijakan Publik Gerakan Anti Korupsi (GeRAK) Aceh, Isra Safril, Pemerintah Aceh dan DPRA seharusnya berkaca atas proses pengesahan APBA tahun lalu, yakni akibat molornya pengesahan menyebabkan penundaan pemberian Dana Alokasi Umum (DAU) sebesar 25 persen dari total dana yang seharusnya diperoleh, yang dengan sendirinya berakibat fatal terhadap alokasi anggaran program yang sudah diproyeksi dan disepakati antara DPRA dan Pemerintah Aceh. “Penjelasan terhadap penundaan penerimaan DAU tersebut merupakan kesalahan bersama antara DPRA dan Pemerintah Aceh karena lalai dalam menjalankan kewajiban dan tidak taat pada peraturan perundang-unda-

ngan, terutama menyangkut percepatan pengesahan APBA Tahun Anggaran 2012,” katanya, Kamis (26/1). Selain itu, kata Isra, proses pengesahan APBA 2012 harus segera dilakukan karena mengingat Provinsi Aceh sejak 2005 sampai 2011 selalu molor dalam pengesahan APBD di Indonesia. Sehingga kondisi politik menjelang Pilkada 2012 di Aceh harus dikesampingkan dan dihilangkan guna mempercepat proses lahirnya program bagi keberlanjutan pembangunan di segala sisi di Aceh. Tapi jika kondisi ini tidak berubah, dia meyakini akan berakibat secara langsung pada lambatnya proses implementasi pembangunan, baik fisik maupun non fisik, dan tentunya menghambat percepatan pertumbuhan perekonomian dan kesejahteraan rakyat. “Bahkan, jika dibiarkan terus, kita khawatir persoalan ini akan menghambat upaya mengisi dan menjaga perdamaian berkelanjutan di Aceh. Untuk itu, Pemerintah Aceh dan DPRA haruslah obyektif dan arif serta bisa belajar dan tidak mengulangi pengalaman pahit tersebut,” tutur Isra. Terkait dengan itu, GeRAK Aceh mendukung pengesahan APBA 2012 di akhir Januari 2011, dengan mendesak pihak eksekutif dan DPRA untuk segera melakukan langkah-langkah kongkrit untuk membahas RAPBA 2012 secara konsistensi terhadap jadwal yang disepakati. (b04)

Rapat Paripurna DPRK Sabang Diskors Hanya 4 Anggota Dewan Hadir SABANG (Waspada): Rapat Paripurna ke5, masa sidang ke-1, Dewan Perwakilan Rakyat Kota Sabang Tahun 2012 penyampaian kata akhir Fraksi-fraksi terhadap Nota Keuangan dan Rancangan Qanun tentang APBK Sabang Tahun Anggaran 2012 dan Keputusan DPRK Sabang sempat molor. Sesuai dengan undangan yang ditandatangani Ketua DPRK Sabang Abdul Anan, jadwal rapat paripurna dibuka Kamis (26/1) pukul 09:30, namun karena belum mencukupi qourum rapat, acara rapat molor hingga pukul 11:00. Wakil Ketua DPRK Sabang Abdul Muthalib membuka sidang paripurna dewan pada pukul 11:00 dihadiri Wali Kota Sabang Munawar Liza Zainal, unsur muspida dan pimpinan SKPD serta tamu undangan lainnya. Sedangkan anggota dewan yang hadir dan menandatangani

daftar hadir hanya 4 orang dari 20 anggota dewan. Karena tidak mencukupi peserta rapat, makaWakil Ketua DPRK Sabang Abdul Muthalib menskors sidang selama satu jam. Dalam waktu satu jam dilakukan mediasi antara Wali Kota Sabang dengan anggota dewan menyangkut beberapa item kegiatan yang belum bisa dikomunikasikan. Setelah pembahasan secara tertutup akhirnya seluruh anggota dewan menerima program yang dituangkan dalam APBK Tahun Anggaran 2012. Sekira pukul 12:00, pimpinan dewan, Abdul Muthalib membuka kembali sidang untuk mendengarkan kata akhir fraksi. Sidang berjalan tertib dan semua fraksi menerima RAPBK Tahun 2012 dengan rincian pendapatan sebesar Rp355. 340.830.603, belanja sebesar Rp414.660.906.458 dan pembiayaan Rp59.320.075.855. (b31)

Protes Pengadaan Mobil Dinas sembari menyebutkan, ide dan gagasan Gubernur Aceh itu ditolak oleh anggota DPRA, khususnya dari Fraksi PA dari PA mengatakan dana komisi dan aspirasi tidak urusanya dengan eksekutif mengaturnya. Uang Rakyat Harus Diatur H Irwandi Yusuf menambahkan, karena APBA adalah uang rakyat maka pihaknya selaku eksekutif tetap mengaturnya. “APBA bukan hasil rampokan, APBA bukan uang koboy yang bisa seenaknya dipakai oleh siapapun. Semuanya ada aturan main, APBA dimanfaatkan sesuai dengan mekanisme yang ada,” sebut Irwansi Yusuf. Menurut hasil sementara yang didengar pihaknya, tambah Gubernur Aceh Irwandi Yusuf, pembahasan APBA di DPRA akan dibuka kembali 9 Februari 2012, dimana ketika itu IrwandiYusuf tidak lagi menjabat sebagai Gubernur Aceh. “Seharusnya, DPRA berubah dewasa. Bek lagee aneuk miet sabe (jangan seperti kanakkanak selalu—red). Jadi banyak sekali diundur oleh jadwalnya oleh DPRA,” kata H. Irwandi Yusuf sembari menandaskan, ketusannya dalam memPergub-kan APBA 2012 adalah final dan sudah tepat serta tak menyalahi aturan. (b24)

Pohon Tua Di Bahu Jalan Banda Aceh Dan Aceh Besar Ancam Pengguna Jalan BANDA ACEH (Waspada): Puluhan pohon jenis Asam Jawa (bak mee) yang sudah berusia lebih setengah abad yang ditanam di bahu jalan di kota Banda Aceh dan Aceh Besar, keberadaannya mengancam keselamatan pengguna jalan. Karena sudah terlalu tua usianya ditambah rindangnya cabang pohon itu hingga posisinya miring ke badan jalan, sementara jika diterpa angin

Hanifan, petani asal Kampung Paya Sergi, Kec. Kebayakan, Aceh Tengah, Kamis (26/1). Dia katakan, akibat perubahan musim masa bersawah tahun ini, dikhawatirkan padi yang dipanen enam bulan kemudian, akan mengalami gangguan hama seperti serangan hama burung pipit. Selain itu tanah di lahan persawahan diperkirakan mengalami kekurangan air. “Bila petani usai menanam padi pada akhir tahun seperti Oktober minsalnya, maka pada Maret di tahun berikutnya, biasanya petani dapat memanen padi. Artinya pada bulan tersebut masih terjadi curah hujan sedang yang cukup mengairi tanah persawahan,” paparnya. Mariyon, petani padi lainnya di Pegasing mengakui kendati sebagian persawahan mengalami kekhawatiran mengenai perubahan masa tanam padi di tahun ini, namun hal tersebut belum terlalu berpengaruh bagi sejumlah petani setempat. (cb09)

merupakan jalur umum menuju kawasan Pasar Aceh dan ratarata pohon itu tingginya 15 meter dan beberapa pohon kondisinya miring ke badan jalan dan sering mengakibatkan pengguna jalan celaka. Adi, warga Kampong Ateuek menyebutkan, jika keberadaan pohon-pohon tersebut sudah mengancam keselamatan warga sekitar dan pengguna jalan. (b09)

Pimpinan DPRK Aceh Besar Terima Mobil-mobilan KOTA JANTHO (Waspada): Usai sidang paripurna dengan agenda Pengesahan Rancangan Qanun Anggaran Pendapatan dan Belanja Kabupaten (RAPBK) Aceh Besar tahun 2012 menjadi Qanun APBK 2012, pimpinan DPRK Aceh Besar menerima penyerahan 19 mobil-mobilan dari Kaukus Pemuda Aceh Besar. 19 Miniatur mobil berbagai bentuk itu diserahkan Almudassir, juru bicara Kaukus Pemuda Aceh Besar kepada Ketua DPRK Aceh Besar Tgk Saifuddin disaksikan sejumlah anggota dewan dan pejabat kabupaten setempat. Bupati Aceh Besar DR H Bukhari Daud dan Sekdakab H Zulkifli Ahmad yang sempat hadir dalam sidang paripurna itu, langsung meninggalkan gedung DPRK Aceh Besar dengan mobil dinas Sekdakab Aceh Besar begitu sidang paripurna ditutup. “Penyerahan 19 mobil-mobilan itu sebagai wujud keprihatinan Kaukus Pemuda Aceh Besar terhadap kebijakan Pemkab Aceh Besar menyangkut rencana pengadaan kendaraan operasional untuk staf ahli dan para kepala bagian di lingkungan sekretariat daerah, termasuk mobil dinas Wakil Bupati dan Sekdakab Aceh Besar yang kami ketahui anggarannya diplotkan dalam APBK 2012 dan sudah disahkan,” kata Almudassir, Rabu (25/1) petang. Dikatakan, dengan disahkannya APBK Aceh Besar 2012 yang di dalamnya termasuk anggaran untuk pengadaan 19 mobil menunjukkan Pemkab Aceh Besar tidak peka terhadap aspirasi rakyat. “Kita tahu kehidupan sebagian besar petani di Aceh Besar saat ini lagi tidak begitu bagus setelah gagal panen akibat sawah mereka

tidak terairi dengan sempurna. “Selain itu, banyak ruas jalan di Aceh Besar yang rusak perlu perbaikan. Belum lagi ketersediaan sarana dan prasarana yang masih terbatas, sehingga memperlambat perkembangan daerah. Mestinya, masalah-masalah seperti ini menjadi pelajaran bagi Pemerintah Aceh Besar,” ujarnya. Karenanya, ia berharap Pemkab Aceh Besar dapat mempertimbangkan kembali kebijakannya mengenai pengadaan fasilitas bagi pejabat daerah setempat karena kondisi keuangan yang belum memungkinkan. “Pengadaan mobil untuk pejabat masih bisa ditunda dibanding kebutuhan masyarakat dan para petani di daerah ini,” tandasnya. Bupati maupun Sekdakab Aceh Besar yang coba dikonfirmasi tidak berhasil dihubungi karena sedang memimpin rapat. Sidang Paripurna DPRK Aceh Besar dipimpin Wakil Ketua HT Ibrahim, turut dihadiri Bupati DR H Bukhari Daud dan Sekdakab Aceh Besar H Zulkifli Ahmad serta para kepala dinas/ SKPD dan pejabat kabupaten setempat. Dalam sidang itu, empat dari lima fraksi di DPRK Aceh Besar dalam pendapat akhir menerima Rancangan Qanun Anggaran Pendapatan dan Belanja Kabupaten (RAPBK) Aceh Besar tahun 2012 untuk disahkan menjadi Qanun Anggaran Pendapatan dan Belanja Kabupaten (RAPBK) Aceh Besar tahun 2012. Keempat fraksi yang menerima, Fraksi Aceh, Fraksi Demokrat, Fraksi PAN-PDA dan Fraksi Golkar-Bulan Bintang. Sedangkan satu fraksi lainnya yaitu PKS-PPP abstain. (b05)

Program Kerja Pemko Banda Aceh Dievaluasi BANDA ACEH (Waspada) : Pemerintah Kota Banda Aceh, Kamis (26/1) menggelar rapat kerja untuk mengevaluasi program-program yang telah dilaksanakan jajarannya selama lima tahun terakhir. Wali Kota Banda Aceh Mawardi Nurdin, menjelaskan itu dalam masa kepemimpinannya secara umum dapat dikategorikan cukup sukses. “Hal tersebut dapat kita lihat dari indikator infrastruktur yang lebih memadai seperti jalan, drainase, jembatan dan lain sebagainya. Dan juga pelaksanaan Syariat Islam secara kaffah serta pemberdayaan ekonomi masyarakat juga menjadi fokus program kita,” katanya saat membuka acara Rapat Kerja Pemerintah Kota Banda Aceh tahun 2012 di Aula Balaikota. Mawardy menjelaskan, program kerja yang sudah dilaksanakan selama 5 tahun terakhir dievaluasi dan perbaiki melalui Raker 2012 ini, dan hasil Raker ini dimasukkan ke dalam RPJM 2012-2017, walaupun nanti harus disesuaikan

dengan keinginanWali Kota danWakilWali Kota yang terpilih kedepan. Mawardy mengharapkan kepada Wali Kota dan Wakil Wali Kota Banda Aceh yang terpilih nantinya ada visi dan misi yang dijalankan serta disesuaikan dengan program yang telah dirumuskan pada Raker ini agar semua program dapat berlanjut. Ketua panitia Raker Kota Banda Aceh Bahagia dalam laporannya mengatakan, rapat kerja yang dilaksanakan rutin pada awal tahun merupakan bahan evaluasi program kerja tahun 2011 sekaligus sebagai bahan masukan dan upaya untuk melakukan perbaikan-perbaikan dalam pelaksanaan pembangunan di tahun 2012. Tujuan raker untuk mengevaluasi dan mengidentifikasi permasalahan yang masih perlu ditangani di 2011. Dalam rapat kerja juga disinggung rencana capaian berupa indikator-indikator pembangunan untuk 5 tahun ke depan periode 2012-2017. (cb01)

Aceh

WASPADA Jumat 27 Januari 2012

C3 Pimpinan Dewan Aceh Utara Surati Kemendagri

Dishub Bireuen Tertibkan Mopen Dan Mobar Dalam Kota Matang Glumpang Dua PEUSANGAN (Waspada) : Dinas Perhubungan Parawisata Komunikasi dan Informatika Bireuen menurunkan sejumlah petugas untuk menertibkan mobil penumpang umum parkir menaikan dan menurunkan penumpang dan mobar melakukan bongkar muat barang dalam Kota Matangglumpang Dua, Kamis (26/1). Penertiban itu sebagai upaya untuk mencegah terjadi kecelaaan yag tidak diinginkan, untuk semnetara semua bus pnumpang dan mobil barang dalam menaikkan dan menurunkan penumpang serta bongkar muat barang untuk semnetara dipusatkan diTerminal Bus Matang Glumpang Dua. Kadishubparkominfo Bireuen Muhammad Yusuf,SH didampingi Kabid Pariwisata Iskandar Zein,BA mengemukakan itu menjawab Waspada, Kamis (26/1). Dikatakan, mulai Kamis (26/1) semua mopen dan mobar tidak dibenarkan lagi untuk menaikkan dan menurunkan penumpang di jalan dalam Kota Matangglumpang Dua dan Kota Bireuen wajib masuk terminal bus atau tempat mobar bongkar muat barang yang sudah ditentukan. Menurut Kadishub, bongkar muat barang bagi mobar dalam kota Bireuen dan Matang Glumpang Dua izin hanya khusus bagi mobar yang membongkar barang pecah belah, elektronik dan kaca. Jadwal bongkar muat bagi truk yang diizikan untuk Kota Bireuen pukul 14:00 dan untuk Kota Matangglumpang Dua pukul 16:00.(b12)

Rumah Warga Lancok Pante Ara Hangus

Pj Bupati: Mutasi Sudah Sesuai Aturan

Waspada/H.AR Djuli

PARA petugas Dishub Bireuen sedang memberikan pngarahan kepada sopir truk untuk semnetara melakukan bongkar muat barang di Terminal Bus Matangglumpang Dua.

KUALA, Bireuen (Waspada): Kebakaran siang bolong yang menghanguskan rumah Abdul Hadi di Desa Lamcok Pante Ara, Kecamatan Kuala, Bireuen, Kamis (26/1). Para tetangga sibuk mengeluarkan barang dari dalam rumahnya berhamburan di luar rumahnya. Petugas Pemadam Kebakaran dan Badan Penaggulangan Bencana Daerah Pemkab Bireuen yang mendapat informasi kebakaran dari masyarakat Lancok Pante Ara segera meluncut ke TKP untuk memadamkan api. Namun kobaran api yang sangat cepat menghanguskan rumah Abdul Hadi tidak sempat tertolong. Namun kedatangan tiga unit mobil pemadan kebakaran dan dua unit mobil pemadam BPBD Pemkab BIreuen telah berhasil membendung kobaran api yang sedang menjalar ke belasan rumah penduduk sekitarnya yang berderetan dengan kebakaran rumah Abdul Hadi. Sumber yang diperoleh Waspada dari beberapa tetangga di lokasi kebakaran mengatakan tidak mengetahui penyebab terjadi kebakaran rumah Abdul Hadi apakah akibat hubungan pendek arus listrik atau penyebab lainnya tidak diketahui lantaran saat terjadi kebakaran.Abdul Hadi sedang bekerja di bengkel Cot Gapu sedang istrinya Veri Irawati sedang bekerja di sawah. Saat petugas pemadam memadamkan api Abdul Hadi dan istri pemilik rumah belum mentahui rumahnya terbakar. Rumah berkonstruksi kayu beserta seluruh isinya ludes dillap api tidak berhasil diselamatkan. Camat Kuala yang ditemui di kantornya Kamis (26/1) mengatakan, sudah mendapat laporan tentang kebakaran dan pihaknya bersama staf kantor camat akan mengantar alakadar bantuan pangan bagi korban dan keluarga dalam menghadapi masa panik. (b12)

Nelayan Aceh Di India Ditangani Kedubes

Banda Aceh-Seoul Korea Selatan Jajaki Kerjasama

Upaya Pengentasan Kemiskinan Tidak Maksimal

BANDA ACEH (Waspada): Setelah berhasil membangun kerjasama kota kembar dengan berbagai kota di Dunia, seperti kerjasama dengan Apeldorn (Belanda), Yangon (Myanmar), kini Kota Banda Aceh kembali berupaya menjajaki kerjasama Kota kembar dengan Kota Seoul (Korea Selatan). Hal ini diisyaratkan Wali Kota Banda Aceh Mawardy Nurdin, saat menerima kunjungan Duta Besar Korea Selatan untuk Indonesia Kim Yong Sung, kamis (26//1). Didamping Wakil Wali Kota Illiza sa’aduddin djamal, Kadis Pariwisata Reza Fahlevi, Kabag Pembangunan Nurdin, Wali Kota mengatakan Kota Banda Aceh yang merupakan salah-satu anggota dari city-net, yakni persatuan Kota-kota di Asia Pasifik ingin membangun kerjasama kota kembar dengan Seoul (Korea Selatan) sebagai upaya untuk mempercepat pembangunan Infrastruktur, Pariwisata, Pendidikan, kebudayaan dan kesehatan “Meskipun belum memiliki kerjasama, sebelumnya kita sudah pernah melakukan kerjasama dengan Korea, yakni pembangunan IT Samsung Learning Center “ ujarnya. Mawardy juga menawarkan keterlibatan Kota Seoul dalam program Banda Aceh Islamic Cyber City (BAICC) yang sedang digagas Pemko Banda Aceh. “ Mungkin Korea (Seoul), mau membantu dan terlibat dalam program BAICC ini “ tawar Mawardy. Kepada masyarakat Korea, Wali Kota juga mengucapkan terimakasih atas berbagai macam bantuan kepada Aceh, terutama Banda Aceh saat bencana gempa dan tsunami meluluhlantakkan Kota ini pada Desember 2004 lalu.(cb01)

LHOKSEUMAWE (Waspada): Nasib tiga nelayan Aceh asal Gampong Tanoh Anoe, Kec. Muara Batu, Aceh Utara yang ditahan di penjara Port Blair Provinsi Andaman dan Nicobar, India kini ditangani Kedutaan Besar RI untuk India. Karena nelayan itu tidak berstatus pelanggar, diperkirakan sebulan kedepan akan dipulangkan. Hal itu dikatakan Panglima Laot Provinsi Aceh H Bustamam saat dihubungi Waspada, Kamis (26/1). Kata Bustaman, perolehan informasi itu setelah pihaknya melakukan hubungan langsung dengan Kedutaan Besar (Kedubes) RI di India, serta ber-

LHOKSEUMAWE (Waspada): Upaya pengentasan kemiskinan dan pengurangan pengangguran di Lhokseumawe dan Aceh pada umumnya, tidaklah maksimal. Pemberdayaan ekonomi bagi masyarakat luas, terutama bagi penduduk miskin, seharusnya dimulai dari desa. Di desalah sejumlah penduduk miskin tinggal, kata Ketua Kontak Tani Nelayan Andalan (KTNA Kota) Lhokseumawe, Rusli MS, Kamis (26/1). Pemerintah, lanjut dia, bila ingin benar-benar mengentaskan kemiskinan, harus bisa memberdayakan ekonomi, melalui program pemberdayaan desa, terutama menyangkut kepentingan petani sekaligus nelayan. “Memang upaya

dasarkan surat kepada Gubernur Aceh, yang turut ditembuskan ke Kedubes RI. Pun namun, surat ke Gubernur Aceh belum ditindak lanjuti, berdasarkan informasi yang didapatkan dari Kabag Humas gubernur. “Kami harap kepada

pemerintah itu ada, tetapi tidaklah maksimal,” ujarnya. Sebagaimana diungkapkan Gubernur Aceh, titik kemiskinan saat berada di desa-desa, hal ini tidak bisa dipungkiri. Kalau ingin mengentaskan kemiskinan di Lhokseumawe atau Aceh secara keseluruhan, maka masyarakat miskin harus lebih diperhatikan, harus bisa diberdayakan. Namun, kendalanya adalah program-program pemberdayaan desa yang masih beranggaran sangat minim, bahkan sangat jauh sekali bila dibandingkan dengan anggaran belanja legeslatif dan eksekutif. “Anggara belanja untuk mereka, baik untuk kunjungan kerja, pelatihan, sampai pergi pesiar entah ke mana-mana, sangatlah

Pak Gubernur juga sesegera mungkin memproses hal ini ke Kedubes, meskipun sedang ditangani,” ucapnya. Lebih lanjut kata Bustamam, ketiga nelayan itu saat ditangkap bukan karena melakukan pelangaran seperti menangkap ikan di luar zona perairan Indonesia. Hal tersebut mereka tidak akan dilimpahkan ke pengadilan. “Mungkin saat ini, mereka sedang diproses pengurusan pemulangan, saya perkirakan tidak sampai sebulan,” katanya. (cmk)

tak masuk akal. Ini sungguh tidak bisa kami mengerti kenapa demikian,” ucapnya. Rusli juga meminta perhatian Pemerintah Lhokseumawe mengenai ancaman-ancaman yang sering menimpa petani, sebagaimana musibah banjir, serangan hama, pembangunan sarana irigasi, dan penyuluhan yang hanya sekadar dan tidak sebagaimana mestinya. Petani masih harus berusaha keras ketika ditimpa musibah akibat bobolnya tanggul yang dibangun tanpa pengawasan ketat. Untuk masalahmasalah seperti ini, pemerintah harus menyediakan dana tanggap darurat, dan mengucurkannya segera sebelum petani kebingungan dan tidak tahu harus mengadukannya ke mana, pungkasnya. (b14)

Mahasiswa Kumpulkan 129 Kantong Darah LHOKSUKON ( Waspada): Sejumlah mahasiswa yang tergabung dalam Ikatan Mahasiswa Pemuda Kota Lhokseumawe dan Ikatan Intelektual Muda Kecamatan Syamtalira Aron, Aceh Utara, berhasil mengumpulkan 129 kantong darah dari dua kegiatan donor yang digelar di Lhokseumawe dan Aceh Utara. Di Lhokseumawe, donor darah digelar di lapangan Hiraq, Rabu (25/1) dan berhasil mendapatkan 78 kantong darah dari pendonor. Sedangkan di Aceh Utara, kegiatan dipusatkan di Keude Aron, Kamis (26/1) pagi dan terkumpul 51 kantong darah. Kini, darah itu sudah diserahkan ke PMI Cabang Aceh Utara. “Ini bentuk kepedulian sosial kami kepada masyarakat. Khusus di Syamtalira Aron, selain donor darah, kita juga menanam sekitar 600 pohon di seputaran pusat kecamatan, gotong royong dan lomba mewarnai,”kata Koordinator Ikatan Intelektual Muda Aron, Alfiadi, usai kegiatan donor darah di Keude Aron.(b19)

Waspada/Zainal Abidin

Waspada/Musyawir

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur***

12:45

FY 3401 Penang ****

FY3400 Penang ****

14:30

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

2012 sebanyak 121 orang. Maka, kami pimpinan dan seluruh anggota Dewan Perwakilan Rakyat Kabupaten Aceh Utara menyatakan sikap mosi tak percaya kepada Pj Bupati Aceh Utara dan meminta Menteri Dalam Negeri dan Gubernur Aceh untuk menggantikan Drs HM Alibasayah dari Penjabat Bupati Aceh Utara,” kata Jamaluddin Jalil, Abdul Mutalib dan Hj Ida Suryana. Menanggapi pernyataan itu Penjabat Bupati Aceh Utara Drs HM Alibasyah, Kamis (26/1) kepada Waspada mengatakan mutasi yang dilakukannya kemarin telah sesuai dengan peraturan perundang-undangan. Mutasi itu juga dilakukan atas persetujuan dari Kementerian Dalam Negeri. Berdasarkan ketentuan Pasal 132A ayat (1) huruf a dan ayat (2) Peraturan Pemerintah No. 49 tahun 2008 tentang perubahan ketiga atas Peraturan Pemerintah No. 6 tahun 2005 tentang pemilihan, pengesahan pengangkatan dan pemberhentian kepala daerah dan wakil kepada daerah dinyatakan bahwa: Penjabat Kepala Daerah atau Pelaksana Tugas Kepala Daerah dilarang melakukan mutasi dan ketentuan sebagaimana dimaksud pada ayat (1) dapat dikecualikan setelah mendapat persetujuan tertulis dari Menteri Dalam Negeri. Mengacu pada ketentuan itu, prinsipnya Penjabat Bupati Aceh Utara dapat melaksanakan mutasi jabatan struktural di lingkungan Pemkab Aceh Utara, dengan ketentuan: hanya untuk pengisian jabatan yang lowong, tidak boleh memberhentikan pejabat struktural, tidak boleh melakukan penurunan eselon, tidak boleh memindahkan pejabat struktural menjadi pejabat fungsional dan tidak boleh merugikan PNS. “Dalam mutasi yang kita lakukan kemarin, tidak ada poin yang dilanggar, karena itu, mutasi itu sudah sesuai dengan perundang-undangan. Lagi pula mutasi yang kita lakukan atas persetujuan Kementerian Dalam Negeri pada tanggal 20 Januari 2012. Mutasi juga kita lakukan melalui hasil musyawarah dengan Baperjakat dan diteliti kembali oleh Kemendagri. Maka tidak ada penyimpangan,” kata Drs HM Alibasyah, Kamis (26/1) siang di ruang kerjanya. (b18/b11)

Waspada/Abdul Mukthi Hasan

LISNAWATI, korban penculikan yang didampingi suaminya dan Kepala IGD Puskesmas Jeunieb terbaring saat dirawat di ruangan Puskesmas setempat belum lama ini sebelum dibawa pulang keluarganya, Kamis (26/1).

Polisi Didesak Usut Kasus Penculikan Di Minibus BIREUEN (Waspada): Sejumlah agen dan pengurus loket angkutan umum minibus L 300 di terminal dalam wilayah Kabupaten Bireuen meminta penegak hukum untuk mengusut tuntas kasus dugaan penculikan dan penyekapan yang dialami Lisnawati, 21, warga Desa Blang Mee Timu, Kecamatan Jeunieb, yang disebut-sebut dilakukan tiga pria penumpang minibus L 300 belum lama ini. Kami berharap pihak kepolisian mengungkap kasus dugaan penculikan yang dialami Lisnawati dan bisa menangkap pelakunya,” kata M Nur, 40, seorang pengurus loket angkutan umum mobil minibus L-300 di Kecamatan Jeunieb, Kamis (26/1). Didampingi sejumlah awak minibus dan sejumlah agen, M Nur mengatakan, kasus yang dialami Lisnawati sangat disesalkan. Pasalnya, selain dapat menimbulkan trauma di tengah masyarakat juga dapat mencoreng nama besar angkutan di wilayah Bireuen dan Aceh, sehingga

pemilik mobil dan para agen dan pengurus loket dirugikan. Sementara itu, Lisnawati, yang dirawat di Puskesmas Jeunieb sudah dibawa pulang ke kediamannya oleh keluarganya. “Kondisi Lisnawati sudah membaik, walaupun masih mengeluh sakit di bagian kepala, mungkin akibat pengaruh bius,” kata Kepala IGD Puskesmas Jeunieb Irwandi, Kamis (26/1). Kapolres Bireuen AKBPYuri Karsono melalui Kapolsek Gandapura Iptu Aji Wisa Prayogo mengatakan, pihak keluarga korban sudah mendatangi Polsek Gandapura terkait kasus itu, karena kejadian awalnya di kecamatan tersebut, namun untuk sementara korban masih sulit memberi keterangan terkait hal yang dialaminya. “Suami korban sudah melaporkan kejadian yang menimpa istrinya, namun, kita akan memintai keterangan dari korbannya langsung nanti setelah kondisi korban membaik,” kata Kapolsek Gandapura. (cb02/b17)

Rp 11, 8 M Dana BOS Dan Sertifikasi Guru Di Aceh Selatan Belum Disalurkan TOKOH masyarakat Cot Girek, Aceh Utara sedang berkumpul di kantor camat setempat untuk membahas pembangunan WTP bantuan Hungaria yang terancam batal, Kamis (26/1).

MAHASISWA menanam pohon di Keude Aron, Kecamatan Syamtalira Aron, Aceh Utara, Kamis (26/1) siang.

LHOKSEUMAWE (Waspada): Buntut mutasi yang dilakukan, Rabu (25/1) oleh Pj Bupati Aceh Utara, Pimpinan Dewan Perwakilan Rakyat Kabupaten Aceh Utara, Kamis (26/1) melayangkan surat mosi tak percaya Kemendagri terhadap penjabat bupati setempat. Surat mosi tak percaya itu ditandatangani Ketua DPRK Aceh Utara Jamaluddin Jalil, Wakil Ketua Abdul Mutalib dan Wakil Ketua Hj Ida Suryana, Amd. DPRK Aceh Utara menilai mutasi yang dilakukan Pj Bupati Aceh Utara telah melanggaran peraturan perundang-undangan. Berdasarkan keputusan Menteri Dalam Negeri No. 131.11-656 tahun 2011 tanggal 15 September 2011, tentang pemberhentian sementara Bupati Aceh Utara dan pengangkatan Penjabat Bupati Aceh Utara, di mana telah dilakukan pelantikan oleh Gubernur Aceh pada tanggal 10 Oktober 2011 yang sampai saat ini masa jabatannya 3,5 bulan. Dalam masa jabatan itu dewan menilai Penjabat Bupati Aceh Utara, Drs HM Alibasyah telah melakukan beberapa penyimpangan kebijakan dan keputusan yang bertentangan dengan ketentuan perundang-undangan khususnya ketentuan Pasal 132 ayat (1) huruf a, Peraturan Pemerintah No. 6 tahun 2005 tentang pemilihan, pengesahan, pengangkatan dan pemberhentian kepala daerah dan wakil kepala daerah yang menyatakan bahwa: Penjabat kepala daerah pelaksana atau pelaksana tugas kepala daerah sebagaimana dimaksud dalam pasal 130 ayat (1) dan ayat (3), serta pasal 131 ayat (4), atau yang diangkat untuk mengisi kekosongan jabatan kepala daerah karena mengundurkan diri untuk mencalonkan atau dicalonkan menjadi calon kepala daerah atau wakil kepala daerah, serta kepala daerah yang diangkat dari wakil kepala daerah yang menggantikan kepala daerah yang mengundurkan diri untuk mencalonkan atau dicalonkan dilarang melakukan mutasi. “Dalam kenyataannya Drs HM Alibasyah, Penjabat Bupati Aceh Utara telah melakukan mutasi terhadap para pejabat di lingkungan Pemkab Aceh Utara pada tanggal 25 Januari

Rp23 M Bantuan Hungaria Terancam Ribuan Warga Cot Girek Kerahkan Massa COTGIREK ( Waspada): Bantuan dari Hungaria untuk memenuhi kebutuhan air bersih warga pedalaman di Cot Girek, Aceh Utara terancam batal, karena lokasi pembangunan WTP belum mendapat izin dari PTPN-1. Warga bersama tokoh masyarakat setempat akan melakukan demo ke Kantor Administrasi perusahaan BUMN itu, bila tidak mengizinkan pinjam pakai lahan seluas 0,5 hektare. Imum Mukim Banda Baro, Cot Girek, Abdulah Daud di kantor camat setempat, Kamis (26/1) menegaskan, krisis air bersih telah lama terjadi di kawasan itu. Dari 23 gampong baru dua gampong di sekitar boster PDAM Tirta Mon Pase mendapat air bersih. Kemampuan suplai air hanya 1 liter per

detik, sehingga untuk dua gampong saja belum maksimal mendapat air bersih. Untuk memenuhi kebutuhan air bersih, warga Cot Girek terpaksa menggunakan air sungai dan sumur. “Namun ketika musim kemarau sumur kering,” jelas Abdullah dalam musyawarah antar tokoh masyarakat di Kantor Camat Cot Girek. Dalam kesempatan itu ikut dihadirkan Direktur PDAM Tirta Mon Pase Zulfikar Rasyid dan sejumlah wakil dari Pemkab Aceh Utara. Beberapa waktu lalu, warga meminta PDAM Tirta Mon Pase membangun Water Treatmen Plant (WTP) air bersih di Cot Girek. Warga meminta bekas WTP peninggalan Belanda dibangun kembali untuk memenuhi kebutuhan air bersih. “Sebelumnya, kami gem-

bira karena menurut PDAM ada bantuan WTP dari Hungaria,” tutur Kepala Desa Cot Girek lama, Asnawi. Namun dia dan warga lain kecewa, ternyata bantuan tersebut belum bisa direalisasikan, karena PTPN-1 belum menyetujui bekas WTP peninggalan Belanda digunakan oleh PDAM Tirta Mon Pase. Tokoh masyarakat Cot Girek yang terdiri dari imum mukim, imum meunasah, kepala desa dan perangkat gampong lainnya dalam pertemuan di kantor kecamantan sepakat melakukan demo agar pembangunan WTP bisa direalisasi. “Kami akan mengerahkan massa agar PTPN-1 mengizinkan penggunaan lahan seluas 0,5 ha untuk WTP,” kata M Hasan, Imum Mukim Cot Girek Baro. (b15)

TAPAKTUAN (Waspada):Sebesar Rp 11,8 miliar dana bantuan operasional sekolah (BOS), dana sertifikasi guru dan non sertifikasi triwulan IV tahun angagran 2011, di Kabupaten Aceh Selatan, hingga Kamis (26/1) belum disalurkan. Kondisi itu membuat para kepala sekolah dan guru di daerah penghasil komoditi pala itu menjadi resah. Karena telah memasuki tahun anggaran 2012, sampai saat ini belum diketahui nasibnya. Diduga keras dana tersebut telah ludes dilalihkan untuk kepentingan lain. Sejumlah kepala sekolah dan guru kepada wartawan di Tapaktuan, Kamis (26/1) menyebutkan, belum disalurkan dana BOS dan dana sertifikasi guru maupun non sertifikasi itu, telah menimbulkan tanda tanya di kalangan para pendidik di sana. Pasalnya, menurut sejumlah kepala sekolah, dana bos triwulan pertama tahun anggaran 2012 telah cair dan dikirim ke rekening masingmasing sekolah. Sementara dana BOS triwulan IV tahun 2011, tidak jelas rimbanya. “Ini aneh bin ajaib,”sebut seorang kepala sekolah yang enggan ditulis jatidirinya seraya menambahkan mereka telah mempertanyakan prihal tersebut ke Dinas Pendidikan, tetapi tidak diperoleh jawaban tentang alasan keterlambatan, dan hanya memperoleh informasi dana tersebut akan disalurkan akhir Januari ini. Akibat belum disalurkan dana, baik kepala sekolah maupun guru mengaku kepepet untuk menanggulangi berbagai keperluan sekolah seperti alat peraga dan lainnya serta kesulitan memenuhi kebutuhan hidup sehari-hari. “Seharusnya dana ini, jangan dipermainkan,” sebut Anjani,34, seorang guru kepada Waspada.

Adapun dana Rp 11,8 miliar yang belum disalurkan itu meliputi tiga pos, masing-masing dana BOS Triwulan IV sebesar Rp 3,7 miliar untuk 196 SD dan 46 SMP, dana sertifikasi guru triwulan IV tahun 2011, sebesar Rp 4,5 miliar untuk 583 guru Disdik Aceh Selatan. Sedangkan 83 orang lainnya dibayar langsung melalui propinsi. Jumlah tersebut sudah dikurangi guru pensiunan, pindah dari struktural ke fungsional dan meninggal dunia sebayak 13 orang. Selain itu, dana guru non sertifikasi (tunjangan fungsional), priode semester-II(Juni-Desember 2011), sebesar Rp3,6 miliar bagi 2.408 orang. Kepala Dinas Pendidikan Aceh Selatan H Karman,SPd yang ditanya wartawan di kantornya, Kamis (26/1) membenarkan. Ia mengaku tidak mengetahui persis tentang proses keterlambatannya, padahal pihaknya telah mengirimkan surat permintaan pembayarannya, be“Kami sudah mengirimkan surat perintah membayar (SPM) ke bendahara umum daerah akhir Desember lalu, tetapi sampai saat ini belum jelas pembayarannya,’’ urainya. Menyangkut pembayaran dana sertifikasi guru dan non sertifikasi sebesar Rp 8,1 miliar, Karman mengaku bingung. Pasalnya dana tersebut telah pernah dikeluarkan SP2D, tetapi pencariannya keburu batal dan ditarik kembali ke Kasda. “Saya benar-benar tidak mengerti sistem pengeloaan keuangan saat ini, dimana SPMnya sudah keluar tetapi pembayarannya bisa dibatalkan pihak keuangan di Dinas Pendapatan, Pengelolaan Keuangan dan Kekayaan Daerah (DPPKKD),”ucapnya.(b30)

C4

Daftar Khatib Shalat Jumat Taqwa Jl. Setia No. 30 Tg. Gustaq

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ar-Ridho Jl. A.R. Hakim Gg. Sepakat No. 6 Al-Chairat Jl. A.R Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al.-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Manar Jl. Laksana No. 47 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jami’ Darul Ikhlas Jl. Batu No. 13 Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. B-A T.S. III Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Gromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Agus Taher Nasution Muchlis Muaz, S.HI Drs. Zainal Arifin G., MA Syahril Bashrah, S.HI, S.Pd.I Ibnu Hajar Harahap Muhammad Soleh, S.Ag Drs. H. Legimin Syukri Nailus Syaib Nasution Badu Amin Nasution, S.Ag Drs. H. Zainal Abidin Zen Drs. H. Pandi Filham Lubis M. Tohir Ritonga M. Yusri Indra, Lc H. Burhanuddin, Lc Drs. H. Nazaruddin Idris, Lc H. Zulham Zainal Arifin, BA H.M. Nasir Akram, MA H. Arief Muhammad, S.Pd.I Drs. Indra Suheri Drs. H. Nizar Idris, MA H. Ismail Malik Drs. H. Jalaluddin Hasibuan Mhd. Siddiq, S.HI Drs. H. RamlanYusuf Rkt., MA Prof. Dr. Nawir Yuslem, MA Rustam Harahap, S.Ag Drs. H. Nasrun Zakaria Ibrahim Yunan, S.Pd.I Drs. Zulkifli Rusehan Nawawi, BA H. Munawar Khalil Riswan Hasibuan, S.Ag Dr. Sudirman,MA Jamaluddin Al Bathani

MEDAN AMPLAS Al-HidayahMapolda Sumut Jl.S.M. Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ridho Shobirin Jl. Garu IV Harjosari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III No. II-G Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Km. 5,5 No. 1 Kel. Harjosari-I Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1-B

Drs. H. Fakhrrurizal, M.SI Drs. H. Al-Ahyu, MA Drs. Marwan Tanjung Khairuddin Daulai, S.Ag Drs. Muhammad Arsyad Drs. Sofyan Ahmad Mahyuddin Siregar, S.Pd.I Drs. M. Alfarabi, M.Ag Drs. Asmanuddin Damanik Drs. H. Darwansyah Simanjuntak Ir. Khairuddin T. Bolon Drs. Khairuddin Siregar Muhayyan, S.HI M. Yusuf Mudin Pohan, S.Pd.I Mhd. Fadhly, S.Pd.I Drs. H. Abd. Halim Ibrahim, SH, MH Drs. M. Zainuddin Drs. Hasanuddin, MA

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede 42 Nurul Huda Jl. K.H.Wahid Hasyim Asrama Brimob

Drs. H. Syakira Zandi, M.SI Prof. DR. Hasan Bakti Nst., MA H. Muhammad Tuah, S.Ag H. Jasmi Assayuthi Dedi Rahmad, S.Ag Drs. Ahmad Syafi’i Khamidal Wirya, S.Ag H. Syarifuddin El Hayat H. Sultan Syahrir Dalimunthe,S.Ag Drs. H. Natarudin Hasibuan

MEDAN BARAT At-Taqwa Jl. Putri Hijau No. 14 Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Jihad Jl. K.M. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Wiraji Jl. Karya Gg. Sosro Lingk. XVI Kel. Karang B. Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Syuhada Komplek Trikora Jl. Danau Toba No. 2 Taqwa Jl. Karya Gg. Madrasah No. 24

Drs. H. Amhar Nasution Irwansyah, MA Drs. H. Mahyudin Nst., M.Ag Amal J.P. Pasaribu, S.Ag Drs. Mhd. Maudin Nasution Drs. H. Syahrinal Azhar Lubis Sayuti Lubis, S.Ag H. Azwardin Nasution Drs. M. Yahya Siregar Drs. Rajuddin Sagala Drs. Muchtar Hasim H. Mufti Achmad Nasichin, Lc Drs. H. Yahya Tambunan Drs. K.H. Amrin Siregar Drs. H. Hasrat E. Samosir, MA

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

H. Burhanuddin

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Jam’iyyatush Shoolihin Kel. Tg. Mulia Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

Ahmad Sayuti Azhar Rohani H. Horman, BA Drs. Saparuddin, MA Shofyan, M.S. H. Muhd. Daud S., S.Ag Drs. H. Nurman, S. Abdul Kadi, S.Pd.I Drs. Syayuddin Sagala Suriat

MEDAN DENAI Amal Bakti Jl.Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Kel. TSM. Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Al-Hidayah Jl. Menteng Indah VI Kel. Medan Tenggara Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hasanah Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl. Selamat Ujung Gg. Subrak Sp. Limun Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lorong Sedar Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10

Drs. H. Jamhir, M. Drs. H. Ismail Rajab Dalimunthe Saiful Akhyar, S.HI Drs. M. Hayat Harahap Drs. H. Muniruddin, M.Ag Drs. Mohyiddin Masykur Drs. H. Muri Damri Drs. H. Akhiruddin Muhid Ahmad Humaidi Dahler Effendi Hasibuan, S.Ag Edi Sahputra Siregar, S.HI Drs. Amri Susanto Abdul Halim Fadlan, S.Ag H. Baharuddin Ahad, SH Drs. Muhiddin Masykur Drs. Jamaluddin Mhd. Saleh Rambe Armansyah, SE, MM

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia Drs. H. Rahmad S. Pohan An-Nur Jl. Budi Luhur No. 75-A Drs. H. Ismail Mukhtar Ar-Raudhah Jl. Persatuan No. 22-AR Helvetia Timur Drs. H. Marasonang Siregar As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Drs. Sonaji Harahap Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. Abdul Majid Al-Huda Jl. Balai Desa/Beringin V No. 116 Kel. Helvetia Mardian Idris Harahap, MA Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Hakimuddin Saragih, S.Ag Al-Hasanah Jl. Setia No. 41 Tg. Gusta M. Yusuf AR, MA Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Drs. Syafrudin Haris Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. Abd. Majid Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut M. Ridwan, S.Ag Al-Ikhlas Jl. Setia Luhur No. 180 Lingk. XI Dwikora H. Muhsin Siddik Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk. VI Kel. T.Gusta Umar Hasibuan, S.Ag Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Drs. Ali Mukti Hasibuan Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Drs. H. Syarifuddin Siagian Darussalam Jl. Asrama No. 11 Suwarno, S.Pd.I Ikhlasiyah Jl. Amal Luhur No. 29 Kel. II Dwikora Drs. H. Irwan Sulaiman Lubis Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Asrizal Tanjung, S.HI Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadomo Budiman, S.Pd. Taqwa Jl. Kapten Sumarsono Gg. Safar Syaiful Bahri, M.Ag Taqwa Jl. Kamboja Raya No. 319 Blok 4 Perum Helvetia M. Ridwan Hisda

Drs. Kholidin Musa

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Hidayatullah, SE Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Drs. Fakhruddin Rokan Annazhirin Jl. Karyawisata Kel. Gedung Johor Drs. H. Hafiz Yazid Ar-Raudhah Komplek Risva I Blok V Kel. Gedung Johor Drs. Syarifuddin Sinda Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur H. Nurdin Rustam, Lc Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Drs. Agus Salim Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor To’at, S.Pd.I Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Drs. H. Legimin Sukri Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Drs. Darwin Pasaribu Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Drs. H. Fahmi Ahmad Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Drs. H. Ilyas Purba Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Drs. H. Zulham Effendi Batubara Al-Muslimin Jl.Suka Luhur Drs. H. Khaidir Tanjung Al-Muharram Jl. Eka Budi Kel. Gedung Johor M. Aslah Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Mhd. Jamil, S.Pd.I Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Abdul Mu’min, S.Pd.I Al-Muhajirin Komplek Medan Permai Drs. Maad Rais Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV Drs. H. Qamaruddin Sagala Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur DR. H. Aswir Ibnu Aziz Fajar Ramadhan Perumahan Johor Indah Permai II Drs. H. Bahrum Saleh Hsb., MA Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslim, S.Ag Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur M. Yasir Tanjung Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Ir. H.MMB. Damanik, MSc Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Ahmad Suhardi Lubis, S.Pd.I Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Devrizal Lubis, S.Pd.I Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Drs. Sariman Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Drs. Abd. Jalil Tanjung Sholihin Jl. Karya Jaya No. 160-G Gedung Johor Drs. H. Irfan Batubara MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Mutttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7

Drs. Muhammad Natar Hsb. Drs. Rizaluddin Siregar Syahlan Hasibuan Drs. Baldan Drs. Askolan Lubis, MA H. Khairul Hamdi, Lc Abdul Azis, S.Pd.I Drs. H. Yusdarly Amar Drs. Lukman Hakim Drs. H. Syauri Syam, Lc Abd. Majid, S.HI Prof. DR. H. Hasyimsah Nst., MA M. Yusuf Marpaung, S.HI Drs. Fakhruddin AR, S.Ag Drs. H. Syarikun Manurung Drs. H. Abdul Razak Drs. H. Lukman Hakim, M.Pd H. Usman Ismail Drs. H. Ulumuddin Siraj

MEDAN LABUHAN Al-Amal Jl. Banten Gg. Amal No. 170 Dusun IX-A Akmal Al-Walad, MA Al-Husain Jl. Jala Raya Griya Martubung M. Soleh Harahap Baitul Ikhwan Jl. T. Lestari 12/9198 Blok V Gr. Martubung Drs. Azwilman Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Drs. Najib Kamal Simbolon MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Jl. Brigjen Katamso Gg. Mesjid No.53 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati

Drs. Gulmat Nasution Drs. Pangihutan Siregar Hidayat Harahap, S.Pd.I Drs. H. Burhanuddin Lubis Drs. Ruslan Batubara Drs. H. Marjan, A.N. Abdul Majid, S.HI

MEDAN MARELAN Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir

H. Sarto Syarif, Lc, MA Amin Utomo, S.Ag Drs. H. Azhar Razak Lubis

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. Syahlul Amri Harahap Ar-Rahman Jl. Prof. H.M. Yamin SH No. 363 Miksan Al-Qadri,S.Pd.I Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Khairuzzaman, S.HI, S.Pd.I Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Abdul Mutholib Nst., S.Pd.I Ar-Ramlah Jl. Sejati No. 16 Drs. Mhd. Husni Ritonga Al-Amin Jl. Prof. H.M. Yamin SH, 482 Drs. H. Musa Yahya Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Drs. Sangkot Nasution Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 33 Miftahul Chair, S.HI Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Sarwan Nasution, S.Pd.I Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Drs. H. Bahauddin Nst., Lc Al-Hurriyah Jl. M. Yakub No. 17 Edy Sahputra Siregar,S.HI, MA Al-Huda Jl. Malaka No. 117 Drs. H. Muhiddin Gurning Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Drs. Zakaria Al-Muslimin Jl. Gerilya No. 1 Drs. Ali Imran Siregar Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Armia Yusuf Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Drs. Marwanuddin, S. Ikhwaniyah Jl. M. Yacub No. 3 Drg. H. Aspan Bahri Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Syahlul Amri, S.Ag Ikhlashiyah Jl.Sei Kera No. 314 Kel. Sei Kera Hulu Drs. Adnan Ritonga, MA Istiqomah Jl. Bambu Runcing/Pahlawan Drs. H. Taufik Lubis Jamik Al-Ikhwan Jl. H.O.S. Cokroaminoto Kel. S.K. Hulu Drs. Zuhri Pulungan Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. H. Efendi Rambe Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Drs. H. Abd. Rahman Kasbi Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir DR. H. Syarbaini Tanjung, MA Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan DR. H.M. Roihan Nst., MA Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat M. Suud Tambunan, S.Ag Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Drs. H. Kasman, MA Taqwa Jl. Karantina Ujung Asrama Drs. Bahari Ahmad MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Annas Kompleks Diskes Jl. Ibus Raya/Jl. Rotan Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Al-Mukhlisin Jl. Darussalam/ Sei Rokan No. 2 Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Drs. Saiful Bahri, S. Drs. H. Amhar Nasution, MA H. Fajar Hasan Mursyid, Lc, MA Mawardi H. Jamaluddin, Lc A. Junaidi Drs. H. Mukhtar Baijuri Drs. H. Sudarto Drs. H. Rumalis Drs. H.M. Abu Sammah Pulungan Drs. H. Yulnaidi Drs. H. Zainal Arifin DR. H. Abdullah Jamil, M.SI Drs. H. Zulkarnain, S.Pd.I Drs. H. Ali Imran, Skd.

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No 11 Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

M. Iqbal Siregar, S.HI M. Abdullah Hasibuan, MA M. Amin, D., S.Ag, S.Pd.I Raza’i Has, BA DR. H. Darwin Zainuddin, Lc, MA Drs. Abdul Majidsyam Drs. H. Syahroni Husin Ahmad Faisal Nasution, MA M. Juhri Fitri Drs. H. Ismail Malik

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Al-Amri Jl. Nusa Indah Asam Kumbang Al-Furqon Jl. Setiabudi Pasar I Tg. Sari Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Al-Ikhlas Pasar 7, Padang Bulan Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Al-Muhtadun Jl. Karya Sembada No.179 Kom.Koserna Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan

Drs. H. Arifinsyah Abu Bakar Nasution, S.Pd.I Drs. H.M. Irfan Al Fuadi Lubis Fakhurrozi, S.Ag Drs. Darmolen Siregar Drs. H.Z. Anshori Drs. H. Nazaruddin Hasibuan Drs. Zulkifli, S.Pd.I H. M.B. Irawan Hutasuhut,S.Ag Drs. Burhanuddin Harahap Drs. H. Rajuddin Harahap

WASPADA Jumat 27 Januari 2012

Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. H. Komaruddin, S. Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari DR. H. Ahmad Juhri, MA Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. M. Sholihul Amri Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Roymansyah, S.Pd.I Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan H.M. Arianto, BA Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Drs. H. Suparmin Sareh Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Khairul Akmal Rangkuti Salamiyah Jl. Bunga Kesuma No. 50-D Kel. P.B.S. II Drs. Awaluddin Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Legino, S.Pd.I Taqwa Kampus II UMA Jl. Setia Budi No. 79-B Ahmad Sampurna, MA MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Badar Jl. Binjai Km. 6,8 Medan Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Jihad Jl. Sunggal No. 129 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Dermawan Jl. Rajawali No. 19 Sei Sekambing-B Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Raudotussuffah Jl. Pinang Baris Kel. Lalang Riyadhussholihin Jl. Sunggal No.198 K.S.Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km. 13,7 Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo

Drs. Saukani Muda, MA Buyung Syafruddin H. Misto, AR Drs. Idrus Uteh Drs. H. Adlan Sirait Ja’far Hasibuan, S.Ag H.M. Nazrul Fahri Drs. Abd. Majid Irwansyah, S.Pd. Bustami Drs. H. Syafi’i Zaini Drs. Zainal Arifin Purba, MA Drs. H. Poniman, S. Nur Azmi Hamyar, S.Ag Drs. Affan Suhaidi Drs. Hamdan Hamidi Prof. H. Ramli Abd. Wahid, MA Agus Suhaidi, S.Pd Drs. Hasby Tanjung Prof. DR. H. Hasan Bhakti, MA Drs. H. Muhammad Nur Hsb. Drs. Ismail, MM. Drs. Bakri Pasaribu Azhar Fauzi, S.Ag Drs. H. Tuah Sirait, M.Ag Safrizal, S.Pd.I Drs. Mahmuddin Sirait Asman Ali Nur Harahap Drs. Ardiansyah Prof. Dr. Ir. A.Rauf, MS. Syamsul Yahya, S.HI Drs. H. Mahmuddin Sirait Taufik Abdillah, S.Sos.I Drs.Bahrin Manik Drs. Abdul Kadir, Z.

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ar-Ridho Kel. Sidorame Timur As-Sholah Jl. Pendidikan No. 39 Glugur Darat I Al-A’la Jl. Pembangunan No. 46 Kel. Glugur Darat II Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Rabithatul Muslim Lingk. 14 Glugur Kota Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Pulo Brayan Bengkel Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap

Eriyanto, S.Pd.I, S.HI Drs. H. Juliardi Drs. Thaharuddin Drs. M. Zukhri Pulungan Drs. Bustami, HA Drs. Saleh Rambe Edy Susanto, S.Ag Drs. Dairobi Husni Thamrin Rambe, S.Ag H.M. Ajir Lubis A.Md H. Abdul Aziz Paqih, S.Pd.I Drs. Syahrin, AW. Drs. Zulkifli Nasution H. Salman Al-Farizi, Lc, MA Drs. H. Sokon Saragih Drs. H. Djuanda Sirait Drs. H. Lahmuddin Ritonga Drs. M. Nur Yunan Silalahi Drs. Syaifuddin Hazmi Lubis Ruslan Idris, Batubara Jaka SM Tambunan Drs. H. Dahron Hasibuan Mar’an Sabuqi Siregar, S.FIL.I Drs. Syafruddin Syam, MA Drs. H. Azwardin Nasution Drs. Zakaria Batubara K.H. Abdul Syukur H. Nahar A. Gani Lc, MA Hasburrahman, S.Pd.I Drs. H. Sutikno Fahmi Drs. H. Burhanuddin, MA Drs. Kayat Drs. Dalail Ahmad, MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan At-Tawwabin Jl. Pimpinan No. 1 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Falah Jl. Pukat Banting IV No. 10 Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Ikhlah Jl. Pasar V Gg. Al-Ikhlash Dusun XIII Durian Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Baiturrahman Kampus UNIMED Jl. Williem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo Jamik Al-Jihad Jl. Besar Tembung Desa Tembung Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Taqwa Jl. Letda Sudjono No. 15 Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo

H. Abdul Karim Hasbullah, Lc Drs. Ibrahim Isa Drs. Nadran Jamal Nasution Drs. H. Thoharuddin,AG Drs. H. Kamidin Selian Amrizal Aziz, S.Ag Thumari Drs. Nur Sarianto Drs. Satiman H. Halomoan Lubis, Lc M. Halim Harahap, S.Ag Drs. Hasbi Dasopang Ediyanto, MA Khoiruddin Daulay, S.Sos Drs. Anshoruddin Nasution Parlaungan Lubis, MA H. Sorimonang Burhanuddin Siagian, MA Kaliman Drs. M. Fadli Said, MA Drs. H. Tahlaq Mahmud Drs. H. Fahmi Fuad Said Abd. Rahman M. Saleh, S.Pd.I Maulana Siregar, MA Prof. Dr. Lahmuddin Lubis, M.Ed Drs. Muslim Wahid Siregar Drs. Musdar

MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani

Amin, S.Ag Drs. Indra Budiman Drs. H. Sholahuddin Lubis H. Andi Wahyudi, Lc, M.Ag H. Ali Asikin, BA H. Solihin Adin, S.Ag Drs. Basaruddin, D.I. H. Rajab Asri Masweil, Lc Ibrahim Fansuri, S.Pd.I Aminuddin, SH, S.Pd.I Drs. Saukani, M.Ag

DELI SERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo At-Taubah Dusun XX Lr. Pertanian Blok Gading Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC Al-Hafiz Hamparan Perak Kec. Hamparan Perak Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Al-Jihad Jl. Pembangunan No. 26 Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Al-Mukhlisin Komplkek Namori Village Al-Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah As-Salam Jl. Raya Medan-Namorambe Kel. Deli Tua Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Baitussalam Dagang Kerawan-Tg. Morawa H.M. Asjro Effendi Jl. Haji Misbah No. 22 Jami’ Lubuk Pakam

M. Fadli Lubis, S.Ag Achmad Jais, M.Ag Karpono Drs. H. Abd. Rahman Kasmi Abd. Fatah Nur,S.Ag H.Zulkarnain Drs. Khaidir Lubis Drs. Syafril Azmi, MA Misnan Al Jawi, SH Drs. Sopan Sofyan Awaluddin Pulungan, S.HI Abu Aliyan, S.HI Betha Asky Perkasa, MA Drs. H. Alman Drs. H. Asro, SH, M.Ag Ahmad Syukri (Bersambung ke hal C5 )

Mimbar Jumat

WASPADA Jumat 27 Januari 2012

C5 I’TIBAR Infaq Fi Sabilillah H M Hafez Lc MA

BERSALAMAN : Puluhan da’i dari seluruh kabu/kota se-Sumatera Utara, menyalami Plt.Gubsu, H Gatot Pujo Nugroho ST, pada acara Evaluasi dan Pembinaan Da’i 2012, serta Pelatihan Manajemen Administrasi Keuangan Bazda Sumut di Asrama Haji Medan pekan lalu.

BERBINCANG: Plt.Gubsu, H Gatot Pujo Nugroho ST dan Ketua Badan Amil Zakat Nasional (Baznas) Prof H Didin Hafiduddin berbincang di sela acara Pelatihan Manajemen Administrasi Keuangan Bazda Sumut. Secara nasional, Potensi zakat di Indonesia, mencapai Rp 203 triliun.

Membangun Umat Dengan Potensi Zakat Zakat merupakan ibadah yang memiliki dimensi ganda. Tidak saja berhubungan dengan Sang Khaliq, tetapi juga terkait erat dengan sosial kemasyarakatan di antara manusia. Untuk itu, jika dikelola secara optimal, maka berbagai forum zakat di daerah ini akan memberikan

kontribusi yang tak sedikit untuk pembangunan umat. Hal inilah yang ditekankan Plt Gubernur Sumut, H Gatot Pujo Nugroho ST, pada acara Evaluasi dan Pembinaan Da’i 2012 serta Pelatihan Manajemen Administrasi Keuangan Badan Amil Zakat Bazda Sumut, pekan lalu di

Asrama Haji Medan. Plt Gubsu mengatakan, pengefektifan forum-forum zakat seperti, Pos Keadilan Peduli Umat (PKPU) dan lainnya, bertujuan untuk lebih menjalin hubungan dan memaksimalkan fungsi dari forum-forum tersebut kepada umt. “Sebaiknya,

forum-forum zakat yang ada bisa dihidupkan kembali. Agar ada sinergitas antar forum-forum zakat yang ada,” katanya. Mengenai zakat, Plt Gubsu Gatot Pujo Nugroho menuturkan, potensi umat soal zakat maal atau harta terutama di Sumut cukup banyak, hanya saja

dibutuhkan manajemen yang lebih baik. “Selama ini belum termanage dengan baik. Sementara potensi umat soal zakat maal cukup banyak. Ini harus menjadi pijakan. Karena pada prinsipnya, zakat itu adalah kebiasaan,” ungkapnya. Senada dengan Gatot, Ketua Badan Amil Zakat Nasional (Baznas), Prof Didin Hafiduddin pada kesempatan itu menyatakan, zakat merupakan satu cara yang mampu untuk mengentaskan kemiskinan. Kembali lagi, capaian itu bisa diraih bila pengelolaan zakat yang ada dijalankan dengan baik. “Potensi zakat se Indonesia, sebesar Rp 203 triliun. Dengan pengelolaan yang baik, ini menjadi satu cara untuk mengentaskan kemiskinan dengan cara yang cepat. Zakat itu bukan mengurangi, tapi akan menambah,” tandasnya.(m28)

FOTO BERSAMA : Plt.Gubsu, H Gatot Pujo Nugroho didampingi Kepala Kanwil Departemen Agama Sumut, Ketua Badan Amil Zakat Nasional (Baznas) dan Ketua Badan Amal Zakat Daerah (Bazda) Sumut, berfoto bersama puluhan da’i dari seluruh kabu/kota se-Sumut pada acara Evaluasi dan Pembinaan Da’i 2012, serta Pelatihan Manajemen Administrasi Keuangan Bazda Sumut, di Asrama Haji Medan pekan lalu.

Allah SWT berfirman: “Dan belanjakanlah (harta bendamu) di jalan Allah, dan janganlah kamu menjatuhkan dirimu sendiri ke dalam kebinasaan, dan berbuat baiklah, karena Sesungguhnya Allah menyukai orang-orang yang berbuat baik.” Ayat ini langsung mendapat respons positif dari kader-kader terbaik dakwah yang telah dibina Rasulullah SAW seperti, Abu Bakar As-siddiq, Umar bin Khattab, Usman Bin Affan, Abdul Rahman bin Auf dan sahabat lainnya. Mereka adalah orang-orang yang sudah terbukti dan diakui sebagai donator dakwah Islamiyah yang dinahkodai Rasulullah SAW, bahkan beberapa ayat Alquran turun sebagai legitimasi tentang kebenaran pengorbanan dan jihad mereka yang luar biasa terhadap harta benda. Manakala kita kembali membuka dan meneliti lembaran sejarah Islam di sana kita jumpai orang-orang kaya yang sangat darmawan. Contoh dalam perang Tabuk Abu Bakar menginfakkan semua harta kekayaannya, Umar bin Khattab menginfak-kan setengah harta bendanya, tidak kalah Usman bin Affan yang dengan ringan menginfak-kan sepuluh ribu ekor unta lengkap dengan logistik dan peralatan perangnya. Sebelumnya kita juga mengenal di awal perjuangan dakwah Rasulullah SAW seorang pengusaha wanita yang akhirnya menjadi istri Rasulullah SAW Khadijah binti khuwailid, beliau menghabiskan semua hartanya yang diinfak-kan untuk pembiayaan semua aktifitas dan agenda dakwah Rasulullah SAW dan kaum Muslimin. Konsep harta yang dipahami Rasulullah SAW dan para pengikutnya menjadikan harta itu sendiri sebagai sarana kapitalisasi dakwah Rasulullah dan sebagai senjata untuk mematahkan serangan musuh-musuh Islam pada masa itu. Allah SWT juga mentitahkan agar umat Islam senantiasa berinfak di jalan Allah untuk memperjuangkan dan meninggikan panji-panji Islam ataupun untuk memperluas program sosial mengentas kemiskinan dan mensejahterakan rakyat dengan agenda ekonomi kerakyatan. Bahkan perintah infaq fi sabilillah sangat tegas Allah nyatakan dalam Alquran, dan bagi orang yang tidak peduli dengan infaq fi sabilillah dianalogikan ibarat orang yang menjerumuskan dirinya kedalam jurang kehancuraan. Maka tidak salah di masa khalifah Abu Bakar, beliau sangat concern memerangi para murtaddin (orang-orang murtad) dan orangorang yang tidak mau membayar zakat sebagai kewajibannya. Banyak sekali aktifitas positif dari infaq fi sabilillah ini, di antaranya: 1.Mengentas atau memutus matarantai kemiskinan yang merajalela di tengah masyarakatrdaya. 2.Pemberdayaan ekonomi bagi UKM masyarakat menengah ke bawah. 3.Memperluas penyebaran dan jaringan dakwah Islamiyah. 4.Menyiapkan sarana-sarana dakwah untuk mengimbangi kemajuan tekhnologi dan sarana komunikasi kontemporer, seperti : menyiapkan kantor berita, satelit, TV, koran, laboatorium ilmu pengetahuan, dan lain-lain. 5.Pembangunan sarana-sarana ibadah, pendidikan, kesehatan dan sosial. Hanya saja infak ini agar produktif dan tepat sasaran perlu dikelola secara profesional dalam satu lembaga resmi milik pemerintah atau swasta yang dapat dipertanggungjawabkan dan diaudit di hadapan publik. Dalam terminologi Islam pengelola zakat dan infak ini disebut ‘amil. Peran dan tugas ‘amil zakat dan infak sangat mulia sekali di hadapan Allah SWT. Banyak sumber yang bisa dikonsulidasikan lewat tangan ‘amil untuk mengumpulkan potensi zakat dan infak. Karena ‘amil termasuk bagian dari faktor dinamisasi pemberdayaan zakat dan infaq fi sabilillah untuk mewujudkan kesejahteraan sosial, dan pengembangan dakwah Islamiyah.

Santri Ar Raudhatul Hasanah Juarai Seluruh Cabang MQK Medan Wacana Pembentukan Kongres Kebangkitan Pemikir Ekonomi Islam Pemahaman dan perhatian terhadap ekonomi Islam sangat terbatas. Sebabnya, perlu dibangkitkan kesadaran pada umat guna memberdayakan ekonomi Islam. “Perlu ada upya membangkitkan ekonomi Islam. Peran itu berada pada pakar dan pemikir ekonomi Islam. Selama ini, para pakar belum memberikan sumbangsihnya guna memberikan pemahaman dan dorongan kepada umat untuk memanfaatkan ekonomi Islam untuk kesejahteraan umat,” ungkap Rektor Universitas As-Syafiiyah, Tuty Alawiyah, di Jakarta baru-baru ini. Ia mengaku prihatin pemahaman umat terhadap ekonomi Islam hanya terpaku pada per-

bankan saja. Padahal wakaf dan zakat juga bagian dari penggerak ekonomi Islam. “Pandangan masih sempit. Sebabnya, peranan para ahli ekonomi jadi sangat penting,” kata dia. Menurutnya, umat Islam tanah air memiliki kesempatan untuk sejahtera secara merata. Alquran dan hadist telah memberikan petunjuk itu. Selanjutnya, adalah tugas para ahli untuk mengkaji lalu memanfaatkan untuk kepentingan umat. Sebab itu, Tuty mengatakan, ada rencana untuk memb u a t s e m a c a m k o n g re s k e bangkitan pemikir ekonomi Islam. Melalui kongres ini, para pakar ekonomi Islam dapat menyebarkan pengetahuannya pada masyarakat melalui

Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua Jami’ Jl. Irian No. 79 Kel. Pekan Tj. Morawa Jami’ Al-Ihsan Jl. Imam Abdul Desa Selemak Kec.H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr Setia Khairul Fatihin Dusun II Tj. Morawa-A Kec. Tj. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Raya Jl. T. Raja Muda Lubuk Pakam Syuhada Kec. Galang Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

beragam bentuk, semisal buku atau pendidikan. “Kita sudah memulainya melalui beragam diskusi, tapi dalam skala sporadis. Karenanya, perlu ada ruang berbagi dalam skala yang lebih besar, dan terarah,” kata dia. Namun, Tuty belum bisa memastikan kapan memulai kongres ini. Yang pasti, tahapan-tahapan menuju persiapan pem-bentukan kongres tersebut telah dimulai. Harapannya kongres itu segera diterlaksana mengingat saat ini perekonomian dunia tengah lesu, adalah momentum yang tepat guna negara-negara Islam, utamanya Indonesia, untuk mengoptimalkan faedah ekonomi Islam.(gc/m20)

Suhadi Ajmain Amin Drs. H. Syarifuddin Zainuddin, S.Pd.I Drs. Ali Mansur Lubis Drs. Ngadimin Hamdan Fauzi Selian, S.Pd.I Drs. H.A. Taufiq Lubis, S.Pd.I K.H. M. Husein Kasim T. Radian, S.Ag Drs. M. Yunus Daulay, MA Zainal Abidin Nasution

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahman Turiam Jl. Ikan Kakap No. 1 Tanah Tingi Al-Huda Kel. Pahlawan Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi Al-Mushlihin Kel. Satria Al-Qadar Griya Payaroda Indah Kel. Payaroba Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Jamik Athohirin Kec. Binjai Utara Nurul Falah Jl. S.M. Raja No. 60 Kel. Tanah Tinggi Nurul Yaqin Jl. S.M. Raja Kel. Tanah Tinggi

Prof. Dr. H.M. Hatta Drs. M. Syukur Yahya Drs. H. Farhan Rawi DR. H.M. Jamil, MA Syahrin Pasaribu, S.Pd.I Zainuddin, S.Ag H.M. Effendi, MA H. Nurbain Tuah, Lc Drs. H. Jaharuddin Batubara, MA Drs. Zainul Basri Drs. H. Muslim Rawi Drs. H. FarhanRawi Drs. H. Juniwan Aksara Drs. Yahya

STABAT Ar-Raudah Dusun VII Masjid Desa Kebun Balok Al-Furqan Lingkungan I Kel. Kwala Bingai

M. Sapri Nasution, S.HI, S.Pd.I H. Syahrizal, S.Sos., M.SI

TEBING TINGGI Amal Muslimin Kp. Rao Amaliyah Jl. K.F. Tandean No. 344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Lingk. I

Mulkan Azhima Ibrahim Ahmad Zulkarnain, S.Ag Drs. Jakfaroni,SH

SALAH satu ciri khas pesantren yang dipertahankan sampai saat ini adalah kemampuan santri-santriwatinya untuk membaca dan menelaah karya-karya ulama terdahulu. Istilah yang lebih dikenal untuk hal ini adalah fahmu kutub at-Turats. Demikian Direktur Pesantren Ar Raudhatul Hasanah Ustadz Drs. H. Rasyidin Bina MA, terkait ke-16 santrinya meraih juara untuk seluruh cabang pada Musabaqoh Qira’atil Kutub (MQK) yang digelar Kementerian Agama (Kemenag) Kota Medan, Selasa (24/1). Seluruh santri-santriwati itu berlomba dalam empat cabang perlombaan pada dua tingkat, yaitu wustho dan ulya. Empat cabang yang diperlombakan adalah tafsir, hadis, fikih dan akhlak. Untuk materi tafsir, Kemenag Kota Medan sebagai pihak penyelenggara menetapkan kitab Tafsir Jalalain untuk tingkat wustho dan

Al-Hidayah Kampung Keling Kel. Tg. Baru Hilir Al-HIdayah Jl. Jenderal Ahmad Yani No. 50 Al-Hasanah Jl. Kartini No. 16-A Al-Haq Kel. Deblod Sundoro Kec. Padang Hilir Al-Khairani Jl. Baja Lingk. VI Kel. Teb. Tinggi Al-Ihsan Simpang Dolok Kel. Sri Padang Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Kel. Teb. Tinggi Al-Mukhlis Kel. Pasar Baru Kota Teb. Tinggi Al-Muthmainnah Lingk. I Kel. D.Sundoro Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal Jl. K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Komplek Kodim Lingk. 04 Kel. Lalang Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79 Taqwa Jl. Bakti Kel. Satria Kec. Padang Hilir

kitab Tafsir Ibnu Katsir untuk tingkat ulya. Kitab Bulughul Maram digunakan sebagai materi perlombaan bidang hadis untuk tingkatan wustho dan Subulussalam untuk ulya. Selanjutnya, ada fathul Qorib (Fikih Wustho), Fathul Mu’in (Fikih Ulya), Kifayatul Atqiya’ (Akhlak Wustho) dan Ihya Ulumuddin (Akhlak Ulya). Perlombaan yang diikuti seluruh pesantren se-Kota Medan menetapkan 13 orang santri Raudhah sebagai juara pertama, sedangkan 3 orang lainnya mendapat juara kedua. Mereka adalah; Abdan Syakura (Tafsir/ Juara I) Syukriman Adi (Hadis/I) Syahputra Oloan (Fikih/II) Rizaldi Pulungan (Akhlak/I) Mar’I Rezeki Simarmata (Tafsir/I) Muhammad Aditya Wirawan (Hadis/I) Muhammad Aidil Akbar (Fi-kih/II) Muhammad Abdurrahman Afif Hsb (Akhlak/ I) Raudhatul Mukromah (Tafsir/I) Nirma Indiarni Brampu (Hadis/II) Siti Maulida Kamaliyah (Fikih/I) Fitri Randia Ningsih (Akhlak/I) Faizatul

Romadhansyah Lubis H.M. Yusuf Rekso Ibnu Kasim, S.Pd.I H. Sujarno, S.Ag, MM Ilyas Hibban, S.Ag Zainul Arifin, S.Ag H. Ishak Ibrahim, S.Pd.I Drs. Daulat P. Sibarani, MA Almya Andhika, S.Ag H. Moh. Thoir, SH H.M. Syamsi Yusnan Harahap H. Asdi Akmal Nasution Yusnul Adhary, SE Yusnan Harahap Drs. Ruslan Purba Salim H. IrhamTaufik Umri, SH, MAP Drs. Abdul Khalim, M.AP Muqarabin Abrar,S.Pd.I

INDRAPURA Jami’ Indrapura Kota

mampu untuk memetik ibrah dalam berdakwah, baik melalui lisan maupun tulisan. Lewat buku santri dapat berdakwah lewat tulisan, melalui pemahaman santri berdakwah melalui lisan,” katanya. (m43)

Waspada/dede

Para santri foto bersama dengan para ustadz usai menerima hadiah ketika mengikuti Musabaqoh Qira’atil Kutub (MQK) yang digelar Kementerian Agama (Kemenag) Kota Medan, Selasa (24/1).

Nuur-Assyiam Kel. Lestari Siti Zubaidah Jl. Budi Utomo No. 285

Dedi Andri, S.Ag H. Imran Mahdin, M.Ag

BATUBARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al Mukhlisin PT. Moeis Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Jl. Raya Medan-Kisaran Km. 108

Subanak Ahmad Hadian Muslim Syahrin Umar

TANJUNGBALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

Amari Syahputra, S.Ag

A SA HA N Arif - Al Azhim Polres Asahan

Dahmul Daulay, S.Ag, MA

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur Kel. Martoba

Albar Suheri, S.Ag

RANTAU PRAPAT Al-Qodar Jl. Terpisang Mata Atas

H. Muhammad Effendi

SIDIKALANG Bakhtiar K. IBR

KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Kel. Gambir Baru Kel. Kisaran Timur Nurul Yaqin Jl. K.H. Agus Salim Kel. Teladan Nurul Yaqin Kantor Direksi - Kisaran Nurul Huda Jl. Malik Ibrahim No. 37

Azmah (Tafsir/I) Annita Maulyza Lubis (Hadis/I) Melita Muliza (Fikih/I) dan Ulfa Ramadhani (Akhlak/I). “Dengan membaca dan menelaah kitab-kitab klasik ulama muslim terdahulu, santri diharapkan

Drs. H.Nummad Adham, SH, M.Hum Drs. Hasanuddin Siregar H. Mhd. Syafiq STP. MMP H. Syakban Nasution Dahmul Daulay,S.Ag Imron Ariadin, S.Pd.I Drs. Ismail Nasution Drs. H. Abdur Rasyid K.H. Alimuddin Siregar, S.Pd.I H. Sulaiman Nasution Hotmah, S.Pd.I Raja Dedi H., S.Ag, SH, S.Pd.I H. Samsul Qodri Marpaung H. Usman Darus

Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Talaga Zam-zam Jl. Ahmad Yani Batang Beruh

H. Sunaryo, S.Ag Syafrizal Sitorus, S.Ag Drs. H. Ahmad Musa Hsb., MA

BIREUEN Masjid Agung Bireuen Masjid Taqwa Kec. Gandapura Masjid Besar Kec. Makmur Masjid Besar Kec. Kuta Blang Masjid Besar Kec. Peusangan Masjid Besar Kec. Peusangan Siblah Krueng Masjid Besar Al-Furqan Kec. Kota Juang Masjid Ridha Kec. Jeumpa Masjid Baitunnur Peudada Masjid Besar Kec. Kuala Masjid Baiturrahim Jeunieb Masjid Besar Baitul Huda Kec. Juli

DR Saifullah S.Ag M.Pd Tgk H Ismuar Yusuf Tgk Saifuddin Tgk. Busmadar Tgk. Dahlan Bentara Tgk H Lahmuddin Tgk Safruddin Tgk Nasruddin Yudun Tgk Rusli Ismail Tgk Irwan Efendi Tgk Sulaiman Tgk Nurdin Ali

Mimbar Jumat

C6

Jika Ulama Dan Tokoh Duduk Di Warkop Oleh H.M. Nasir Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah

D

uduk di “warung kopi” atau sejenisnya, bukanlah tradisi para ulama dan ustadz, apalagi seorang tokoh atau pejabat, menjumpai di kantornya saja begitu sulit, apalagi duduk bersama di warung adalah suatu tradisi yang tak terbiasa dilakukan. Lagi pula warkop tidaklah tempat yang terhormat untuk membicarakan hal-hal yang dianggap sakral, seperti fatwa-fatwa agama, ayat-ayat Alquran dan hal-hal yang berhubungan dengan persoalan-persoalan umat. Demikian persepsi kita terhadap warkop dan marwah seorang ulama serta tokoh masyarakat, sehingga pembicaraan-pembicaraan, diskusidiskusi ringan di warkop tidak dianggap sesuatu yang berharga, apalagi dijadikan pegangan hidup. Dan persepsi ini agaknya dari dahulu hingga kini belum berubah, malah di salah satu tradisi masyarakat jika seorang imam atau ustadz duduk di warung kopi dapat dikenakan ta’zir (sanksi moral) berupa dinonaktifkan menjadi imam dan khatib. Dan sanksi moral ini beralasan karena warung-warung kopi, cafe-cafe dan sebagai-nya dapat dikategorikan kepada kelompok laghwun (sia-sia) yang seyogianya dijauhi oleh orang-orang mukmin yang shaleh. Seperti dikatakan di dalam surat Al-Mukminun ayat 1-3; orang mukmin yang sukses adalah khusu’ di dalam shalat dan meninggalkan laghwun (hal yang sia-sia). Realitanya memang demikian, warkop-warkop dan cafe-cafe selalu dipenuhi oleh anak-anak muda dan orang-orang yang banyak waktu yang terluang (untuk tidak menyebut pengangguran). Apalagi di pedesaan, warkop-warkop biasanya diramaikan dari pagi hingga malam, membahas persoalan yang berkembang di tengah-tengah masyarakat dan debatdebat kusir yang tidak menghasilkan kesimpulan yang tidak diperhitungkan. Sejatinya, gambaran negatif terhadap warkop-warkop dan cafecafe dapat berubah-ubah jika para tokoh masyarakat merakyat dalam pergaulannya tanpa membedakan level masyarakatnya, dan para ustadz-ustadznya merakyat dalam dakwahnya hingga ke warung-warung kopi dan cafe-cafe. Hal itu telah dirintis oleh seorang da’i populer di Mesir yaitu Imam

Syahid Ikhwanul Muslimin Hasan Albanna. Dengan metode dakwah “global”nya, yang bebas dari pengaruh hegemoni para pejabat dan penguasa, menjauhi hubungan dengan organisasi-organisasi dan partai-partai, agar komunitas dakwahnya jernih dari pengaruh warna lain yang keluar dari tujuan dakwahnya. Sasaran empuk dakwah Hasan Albanna adalah generasi muda yang belum terkontaminasi pikiranpikirannya oleh najis politik, termasuk warung-warung kopi terbebas dari berbagai kepentingan. Metode dakwah global yang dilakukan oleh Hasan Albanna tersebut dengan pasang surutnya perjuangan ikhwanul muslimin sampai saat ini masih diperhitungkan di Mesir dan negaranegara Arab lainnya.

Bahrum Ahmad, alm. Syeikh H. Jalaluddin Abdul Muthalib, MA, Prof. Dr. Ramli Abdul Wahid, MA, H. Rostanof, SH, KH. Zulfikar Hajar, Lc, dan lain sebagainya, dan masih berlanjut hingga sekarang. Ternyata pertemuan-pertemuan di warung kopi yang dimeriahkan dengan sarapan pagi, lontong, teh susu telor yang dibubuhi dengan minyak zaitun dan madu dari Yaman, bukan saja menyegarkan badan, akan tetapi dalam “celoteh” para ulama dan tokoh masyarakat yang berbagai latar belakang keilmuannya, ada sesuatu yang bermanfaat untuk dipetik, yaitu keakraban yang obyektif terlepas dari kepentingan politik, partai, LSM, dan kepentingankepentingan sukyektif lainnya. Lebih dari itu, dengan keakraban yang telah terbangun lewat wadah

Tahu diri untuk tidak terlalu merangkul para penguasa dan pejabat-pejabat karena akan mengganggu kenetralannya sebagai ulama dalam beramar ma’ruf nahi munkar. Terlalu “melangit” apa yang saya maksud dalam judul tulisan ini bila dibandingkan dengan dakwah global Hasan Albanna yang tersusun rapi yang dapat menggoncang negara Arab saat sekarang ini, sehingga pemimpinnya berjatuhan satu persatu. Meskipun itu diklaim sebagai kemenangan demokrasi, akan tetapi banyak sedikitnya pengaruh ikhwanul muslimin dalam memenangkan partai-partai Islam tidak dapat dinafikan. Hanya sekedar mempererat silaturrahim, duduk di warung kopi bersama para pejabat dan ulama dan ustadz para akademisi di hari libur selepas ceramah subuh pada pagi Sabtu atau Minggu misalnya dapat mempererat silaturrahim, dan pada gilirannya akan melahirkan ide-ide yang cemerlang yang bermanfaat untuk kepentingan umat dan terlepas dari berbagai kepentingan. Gagasan yang tidak populer ini sudah pernah dilakukan oleh beberapa orang, yang terdiri dari ulama, pejabat, akademisi, imam-imam mesjid, dan masyarakat lainnya, seperti alm. Syeikh H.

yang tanpa nama dan tanpa bentuk ini, para ulama dan tokoh-tokoh itu tidak segan-segan memperlihatkan jati dirinya, siapa dia sebenarnya, bahkan kritikan-kritikan tajam diiringi tertawa lebar tidak menimbulkan emosional apapun, malah diterima dengan rasa syukur. Penulis sendiri, dalam suatu pertemuan di warkop tertentu di hari libur imlek yang lalu, merasa terkesima (tercengang) mendengar suatu kritikan dan sekaligus ide yang dilontarkan, bahwa saatnya para ulama kembali kepada jati dirinya, yaitu tahu diri untuk tidak terlalu merangkul para penguasa dan pejabat-pejabat karena akan mengganggu kenetralannya sebagai ulama dalam beramar ma’ruf nahi munkar, dalam bahasa ekstrimnya para ulama dan ustadz-ustadz jangan menjilat ke atas tapi kembalilah ke habitat keulamaannya. Yang membuat saya tercengang, ide dan kritikan tersebut bukan keluar dari mulut seorang ulama itu sendiri, akan tetapi dari seorang pejabat. Betapa seorang pejabat menyadari pentingnya peran seorang ulama dalam beramar makruf nahi munkar,

karena jika para ulama dan ustadz membaur dalam “lingkaran setan” kenetralannya akan dipertanyakan, ditambah lagi ulama bukan milik penguasa, partai, LSM tertentu bahkan gelar ulama tidak diperoleh di lembagalembaga agama, universitas atau pesantren, akan tetapi pemberian Allah Swt, dan disosialisasikan oleh umat. Saya memahami dari ide sekaligus kritikan yang dilontarkan kepada ulama tersebut, bahwa pejabat di negeri ini sudah tidak ada lagi yang bersih dari “najis politik” dan “najis kekuasaan” berikut partai-partai dan LSM-LSM yang ada di negeri tidak lebih untuk memperjuangkan kepentingan kelompok mereka, dengan mengatasnamakan rakyat banyak. Benar seperti yang dikatakan Alquran: Setiap kelompok berbangga dengan kelompoknya masing-masing. (QS. Al-Mukminun: 53). Dari “celoteh” yang berkembang, muncullah suatu ide untuk membuat suatu lembaga selektivitas masyarakat terhadap siapa saja yang ingin menjadi pejabat mulai dari tingkatan yang serendah-rendahnya hingga setingkat walikota dan gubernur lembaga itu berwenang untuk menyeleksi calon-calon kepling, lurah, camat, walikota, hingga gubernur, dari sisi wawasan keagamannya, paling tidak wajib lulus membaca Alquran, terserah apa nama wadah tersebut boleh “lembaga selektivitas masyarakat” atau boleh juga “klinik Alquran masyarakat” ternyata ide tersebut disambut baik oleh peserta diskusi warkop. Bayangkan betapa dari “celoteh” ulama dan para pejabat sekalipun dilakukan di tempat yang tidak dipandang sakral, dapat melahirkan ide-ide yang cemerlang. Jika ide ini dilontarkan di DPR tentu akan mengalami tarik ulur kepentingan yang luar biasa dan memakan biaya rapat tidak sedikit, dan belum tentu mendapat keputusan dalam waktu singkat, seperti halnya Rancangan UU Pornografi dan Pornoaksi, sampai sekarang belum disahkan. Pendek kata, ulama dan pejabat di manapun mereka duduk, seogianya memberi manfaat untuk umat, meskipun di warkop, paling tidak melahirkan ide-ide yang cemerlang untuk umat ini, semoga ide tersebut tidak kandas hanya dengan secangkir kopi. Wallahua’lam bil ash-shawab.

Pintu-pintu Setan Oleh Junaidi Dosen di PGRA UMSU

B

ertarungan setan dengan manusia ibarat dua petinju yang sedang bertanding di atas ring. Satu petinju ditutup matanya dan yang lain tanpa penutup mata. Petinju yang ditutup matanya adalah manusia yang memang tidak bisa melihat lawan. Sedangkan petinju yang tanpa penutup mata itulah setan yang dengan bebas dapat menghantam manusia dari arah mana saja yang ia suka. Secara akal sehat, bisa dipastikan manusia tidak mungkin bisa memenangkan pertarungan tersebut. Oleh sebab itu, agar pertarungan antara manusia dan setan bisa seimbang, maka diantara caranya adalah mencari tahu manamana saja tempat yang biasa dilalui (pintu) setan untuk menggoda dan menguasai manusia. Pintu-pintu yang digunakan setan Sejak terusirnya setan/iblis dari surga, ia berjanji akan senantiasa berusaha dengan semaksimal mungkin untuk menjerumuskan manusia.

Sehingga berbagai macam cara ditempuh untuk mewujudkannya. Kisah ini diabadikan oleh Allah dalam surat al-A’raf ayat 16 dan 17 yang artinya “Iblis menjawab: “Karena Engkau telah menghukum saya tersesat, saya benar-benar akan (menghalang-halangi) mereka dari jalan Engkau yang lurus. kemudian saya akan mendatangi mereka dari muka dan dari belakang mereka, dari kanan dan dari kiri mereka. Dan Engkau tidak akan mendapati kebanyakan mereka bersyukur.” Berbicara tentang pintu-pin-tu setan, maka paling tidak ada lima pintu yang biasa digunakan setan dalam menggoda manusia, yaitu: Pertama: Marah. Merupakan manifestasi kesedihan dan kesombongan. Orang yang sedang marah terlihat dari respon anggota tubuhnya, seperti tangan gemetar, muka merah, dan jantung berdebar kencang. Kondisi tersebut menunjukkan bahwa orang yang sedang marah pada hakikatnya membe-

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI ALQURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H. Yusdarli Amar), 082163203233 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustadz yang saya hormati, surat dan ayat apa yang cocok untuk kita baca pada setiap siang dan malam, khusus hari jum’at apakah hanya surat yasin saja? Mohon penjelasan. Dari Hamba Allah . Jawab : Terima Kasih atas pertanyaannya. Dari keterangan yang kami dapatkan bahwa malam dan siang Rasulullah tidak meninggalkan membaca beberapa surat yaitu; surat yasin, surat Al-mulk, surat waqi’ah dan surat Ad-Dukhon. Hal ini hendaknya dibaca pada waktu subuh dan asar. Sebab ada hadis Rasul yang diriwayatkan Abi Hurairah, Rasulullah bersabda: “ bergiliran malaikat mengunjungi kamu, ada malaikat malam dan malaikat siang. Mereka sama-sama berkumpul sewaktu kamu shalat subuh dan shalat asar, maka amalan kamu diangkatkan Allah yang Dialah yang menurunkan malaikat itu kepada mu. Lalu Allah bertanya kepada malaikat-sedang Dia lebih mengetahui tentang keadaan kamu. “bagaimana keadaan hamba-Ku sewaktu kamu tinggalkan?” malaikat menjawab: “ kami datang kepada mereka, mereka sedang ibadah kami tinggalkan mereka, mereka sedang ibadah. Masalah khusus hari Jum’at, malam Jum’at membaca surat yasin, Ad-Dukhon dan Al-kahfi, siang hari Jum’at membaca surat yasin, ad-Dukhon, al-kahfi dan surat hud. Ulama menjelaskan , membaca surat yasin dan ad-dukhon itu, bisa saja kita baca pada malam atau siangnya, misalnya surat yasin dan addukhon di baca malam jum’at sedang siang hari dibaca surat kahfi dan surat hud. Yang penting surat-surat itu terbaca pada malam dan siang Juma’at itu, agar keutamaan surat-surat itu tidak terluput dari kita. Demikian keterangan dari Pengarang buku Tajwid Qur’an oleh Abdullah qori ibn haji Sholeh. Klantan 1972. halaman 152. Wallahu A’lam Al-ustadz H. Ismail Hasyim. MA

Perut Kenyang, pintu kedua yang digunakan setan untuk menggoda manusia. bani otak, pembuluh darah, dan jantungnya dengan beban berat. Marah merupakan pintu setan yang utama. Jika manusia sedang marah, maka setan bisa mempermainkannya seperti anak-anak yang mempermainkan kelerengnya. Orang yang sedang marah adalah orang yang sangat lemah dihadapan setan, sehingga orang tersebut akan lebih mudah diarahkan oleh setan. Rasulullah SAW memberikan arahan kepada umatnya cara meredakan marah. Adapun cara yang diberikan Rasulullah adalah Membaca Ta’awudz/Isti’adzah. Ketika kita sedang marah, hendaklah membaca ta’awudz/isti’dzah (a’udzubillahi minasy syaithaanir rajiim). Cara Kedua: Diam. Bila kita sedang marah, maka berusalah untuk diam atau tidak banyak bicara, sebagaimana sabda Rasululullah SAW yang diriwayatkan oleh Ahmad yang berbunyi “Apabila salah seorang di antara kamu marah, maka diamlah”. Ketiga: Mengubah Posisi. Dalam sebuah hadis riwayat Muslim “Apabila salah seorang di antara kamu marah, dan ketika itu ia dalam keadaan berdiri, maka hendaklah ia duduk. Karena hal itu akan menghilangkan marahnya. Dan kalau tidak, maka hendaklah ia berbaring.” Cara Keempat: Berwudu’. Pesan ini disampaikan Rasul dalam hadis yang diriwayatkan oleh Abu Daud “Marah itu datangnya daripada setan, dan setan itu diciptakan daripada api, sedangkan api itu hanya dipadamkan dengan air.Oleh sebab itu itu apabila salah seorang diantara kamu marah, maka hendaklahia berwudhu”. Pintu Kedua adalah Perut Kenyang. Dalam satu riwayat diceritakan bahwa Iblis pernah menampakkan diri dihadapan nabi Yahya bin Zakariya. Beliau melihat pada setan beberapa belenggu dan gantungan pemberat seraya bertanya “wahai iblis, pemberat dan gantungan apakah ini?’ iblis menjawab “ini adalah syahwat yang aku gunakan untuk menggoda anak cucu Adam”. Yahya bertanya lagi “apa hubungannya antara pemberat ini dengan manusia?” iblis menjawab “bila kamu kenyang maka aku gantungkan

pemberat ini sehingga kau enggan untuk berzikir pada Allah”. Rasulullah SAW berpesan agar kita berhenti makan sebelum kenyang. Pintu ketiga yang digunakan oleh setan untuk menggoda adalah wanita. Setan selalu menggunakan wanita sebagai anak panahnya yang siap untuk menembus siapapun. Berapa banyak manusia yang terperdaya oleh bujuk wanita. Nabi Yusuf a.s sendiri mengakui bahwa seandainya Ia tidak dilindungi Allah niscaya Ia akan terkena bujuk rayu Julaikha. Dalam buku yang berjudul 35 fitrah wanita, dijelaskan bahwa hadis tersebut menjelaskan suatu kejadian pada diri Rasulullah. Pada suatu hari Rasul melihat seorang wanita lewat dihadapannya dan beliau tertarik, lalu beliau segera pulang kerumah menemui istrinya Zainab binti Jahsyi. Saat itu Zainab sedang membersihkan kulit hewan lalu Rasul memanggilnya dan menumpahkan keinginan berhubungan dengannya. Lalu Rasul keluar menemui para sahabat dan bersabda “Wanita baik dilihat dari depan maupun dari belakang tetap menampilkan fitnah kepada laki-laki yang melihatnya.” Pintu Keempat: Hasad. Orang yang memiliki sifat hasad maka akan menginginkan sesuatu yang dimiliki orang lain, sehingga ia akan menjadi orang yang buta hatinya. Jika hati sudah buta maka setan akan lebih mudah dan leluasa untuk masuk ke dalam diri manusia karena kebutaan tersebut menjadi seseorang tidak bisa membedakan mana yang baik dan mana yang buruk, serta yang halal dan yang haram. Pintu Kelima: Mencintai Harta. Kecintaan seseorang terhadap uang dan harta benda akan menjadi alat hebat bagi setan. Bila seseorang memiliki cinta yang kuat terhadap harta maka hatinya akan menjadi kosong. Dalam pikirannya adalah harta-harta dan harta, sehingga semua aktivitas yang dilakukan adalah semata-mata untuk mencari harta. Tidak sedikitpun hatinya tertuju kepada Allah. Di saat itulah hatinya menjadikan harta sebagai tuhan. Wallahu A’lam.

WASPADA Jumat 27 Januari 2012

Keluar-Masuk Masjid Surga Balasannya Berakrab ria dengan rumah Allah atau masjid-masjid merupakan keharusan bagi umat Islam, sehingga bagi mereka yang bertetangga dengan masjid hendaklah melaksanakan shalat berjamaah di masjid. Tidak lagi di rumah, kecuali tempat tinggal atau rumahnya jauh dari masjid, bolehlah ia beserta keluarga shalat berjamaah di rumah masing-masing. Allah SWT sangat menganjurkan umat Islam rajin ke masjid guna memakmurkan masjid. Tidak hanya melaksanakan ibadah shalat, tapi juga melakukan berbagai kegiatan kemasyarakatan nan-islami yang sejalan dengan syariat Islam (Al-Quran dan hadis). Semakin rajin ke masjid, sering keluar dan masuk masjid maka imbalan pahalanya semakin banyak/besar dan Insya Allah mengganjarnya dengan penempatan di surga. Justru itu mari kita makmurkan masjid. Jangan sampai masjid kosong tanpa kegiatan ibadah dan kemasyarakatan yang positif bagi peningkatan iman dan takwa kepada Allah SWT. Jangan pula sampai ada masjid tergusur karena lingkungannya kurang peduli, begitu pula dengan para ulama dan ustad hendaknya rajin berdakwah agar masjid semakin makmur, masjid berfungsi optimal dalam bidang pendidikan, dakwah, dan pemberdayaan ekonomi syariah. Berikut ini kita simak hadis Sabda Rasulullah SAW: “Barangsiapa yang datang menuju masuk dan keluar dari masjid (keluar masuk masjid untuk ibadah) maka Allah jadikan setiap ia keluar dan masuk itu derajat lebih tinggi baginya di surga” (HR Bukhari). (Disarikan dari kumpulan hadis shahih)

Jangan Lebai Oleh Fachrurrozy Pulungan Sekretaris Dakwah Al-Washliyah Sumatera Utara

“W

ahai anak manusia (bani Adam), panikmat yang telah dianugerahkan Nya kepada hamba kailah pakaianmu yang indah setiap Nya “. H.R. Nasai dan Ibnu Majah dari Umar bin kamu masuk masjid (melakukan ibaSyu’aib. Dalam hadis lain sebagaimana diriwadah). Makan dan minumlah, dan jangan berlebihyatkan, Nabi SAW bersabda, “ Tak ada tempat yang lebihan. Allah tidak suka dengan orang-orang yang paling buruk selain perut yang diisi manusia. Cuberlebih-lebihan “. QS al A’raf ayat 31. kuplah bagi manusia beberapa suapan sekedar Kata ‘lebai’ tidak akan pernah dijumpai dalam untuk menegakkan tulang punggungnya. Jika ia mekamus besar Bahasa Indonesia. Kata ini cuma ada ngisi perutnya, maka sepertiga untuk makanannya, dalam kamus bahasa gaulnya anak-anak muda Insepertiga untuk minumannya, sepertiga untuk donesia. Kata lebai diartikan sebagai sesuatu yang bernafas “. H.R. Nasai dan Turmudzi, dari Mikdam berlebihan (melampaui batas). Sementara dalam bin Madi. Hadis ini juga diriwayatkan oleh Bukhari. konteks Islam kata lebai bisa dipersamakan dengan Dari ketiga kategori yang ditampilkan oleh Al‘asrafa’, seperti ayat pembuka di atas. Dalam ayat quran pada intinya, adalah sikap hidup seseorang tersebut betapa Alquran mengecam orang yang suka yang dalam kehidupannya dilakukan secara berberlebihan dalam lebihan (tusrifu). berpakaian, maBetapa banyak kan dan minum Betapa miris nya, ketika kita melihat orang yang kedan sebagainya. terserap orang-orang yang lebai dalam meman- mudian Ibnu Katsir daoleh sikap berlelam tafsirnya menbih-lebihan dafaatkan rezeki yang ada padanya, jelaskan bahwa ayat lam kehidupan, di atas adalah sebasementara yang lain harus berjalan sehingga megai kritikan sekalinimbulkan kemenantang maut menyeberangi sungai gus bantahan terhahancuran baik dap orang-orang dalam rumah untuk sebuah pendidikan. musyrik yang melatangga negara, kukan ibadah (thamasyarakat, dan waf) di Baitullah menyengaja dengan tanpa pakaian. negara. Di rumah tangga misalnya, suami yang Laki-laki melakukan thawaf pada siang hari, sedang merasa superior dapat menimbulkan tekanan psikis perempuan pada malam hari, perbuatan seperti itu terhadap istri dan anak-anaknya. Demikian juga dianggap berlebihan. Karena itu Islam memerintahkan dengan istri, yang berlebihan dalam mengatur pada setiap pemeluknya untuk memakai pakaian yang kehidupan rumah tangganya, berakibat tidak baik (ziinah) dalam setiap shalat atau pergi ke masjid harmonisnya kehidupan rumah tangga itu. Sama haluntuk shalat berjamaah atau shalat Jum’at . Suatu hal nya di masyarakat, jika seseorang warga dari yang dianggap lebai bila seseorang shalat hanya dengan masyarakat itu berprilaku berlebihan, menganggap menutupi auratnya. Dalam sebuah hadis sebagaimana dirinya dan keluarganya sebagai warga kelas satu, diriwayatkan Thabrani dan Baihaqi dari Ibnu Umar, sementara warga lain nya sebagai warga kelas dua, Rasulullah bersabda, “ Apabila seorang di antara kamu akan menimbulkan friksi-friksi yang pada gilirannya melaku-kan shalat, maka hendaklah mengenakan dua menimbulkan gesekan yang berujung pada perkehelai pakaiannya. Karena sesungguhnya Allah Azza lahian antar warga. Dan ini yang kemudian banyak Wajalla Zat yang paling patut dihadapi oleh orang yang terjadi di negara ini secara kasat mata kita saksikan. berhias .Jika orang itu tidak memiliki dua pakaian, maka Fitrah manusia yang menyenangi perhiasan dan pakailah kain apabila dia salat, dan jangan ada seorang ingin menikmati rezeki yang baik, pada dasarnya kamu menutup aurat dalam shalat nya seperti yang adalah motifator terpenting dalam memperluas dilakukan oleh orang-orang Yahudi “. Sama ada imam pekerjaan, baik di bidang pemerintahan, politik, Syafi’i, Ahmad dan Bukhari telah mengeluarkan satu ekonomi dan perdagangan, pertanian, pendidikan, riwayat dari Abu Hurairah bahwa Nabi SAW mengidakwah dan sebagainya. Kedua fithrah manusia itu ngatkan, “ Jangan sekali-kali seorang diantara kamu tidak tecela memanfaatkannya, kecuali diukur dengan melakukan shalat dengan memakai sehelai kain yang tindakan berlebihan (lebai) di dalamnya serta pada tengkuknya tak ada kain “. mengabaikan atau lalai dalam mensyukuri nikmat AlDari ayat Alquran dan Hadis di atas secara fiqih, orlah. Artinya, ketika kita memanfaatkan kedua fitrah itu ang yang shalat hanya menggunakan pakaian sekedar dan memperoleh hasilnya, tidak menjadikan kita menutupi auratnya, atau bertelanjang dada tetap sah, lengah, menutup mata dengan apa yang sedang terjadi tetapi tidak bernilai disisi Allah. Hal demikian bisa di hadapan kita-kemiskinan dan penderitaan. diqiyaskan pada orang yang pergi ke Mal untuk belanja Rezeki yang diperoleh seseorang tidak untuk tapi tidak mengenakan pakaian secara utuh. Orang dinikmati sendiri, tapi untuk berbagi dengan setersebut pasti ditolak oleh satpam, tidak diperkenankan sama. Itu sebabnya mengapa Alquran demikian masuk, dan bahkan dianggap orang gila. Berhias, atau ba-nyak menyebutkan kata ‘anfaqu’/mengeluarmemakai pakaian yang bagus itu bisa berbeda-beda kan harta/rezeki yang diberi Allah untuk disebar sesuai kondisi dan situasi, tetapi jangan lebai. luaskan sebagai bukti keberimanan seseorang, Perintah untuk mengenakan pakaian yang bagus seperti hadis Nabi SAW yang menyatakan, sesungdalam setiap melakukan shalat atau pergi ke masjid guhnya Allah senang melihat bekas nikmat Nya merupakan prinsip agama dan sosial di kalangan Islam. atas hamba Nya. Betapa mirisnya, ketika kita Hal untuk untuk menunjukkan kepribadian nya sebagai melihat orang-orang yang lebai dalam memanseorang manusia yang berbudaya, dan ber-akhlak. Apa faatkan rezeki yang ada pada nya, sementara yang yang dilakukan Islam itu kemudian mendapat respon lain harus berjalan menantang maut menyepositif dari banyak kalangan orientalis yang bersifat berangi sungai untuk sebuah pendidikan. netral, bahwa tersebarnya Islam di dunia memberi Siapa pun kita , apa pun status sosial kita, jaanugerah besar bagi dunia Industri pertekstilan di nganlah lebai. Sebagai kepala pemerintahan, Eropah yang menjadi sebab lakunya perdagangan kain. penegak hukum (polisi, jaksa dan hakim), pelaksana Sebagaimana hal itu dilakukan oleh Ali bin Abi Thalib ra pendidikan (rektor, dekan, dosen, guru), pelaku dakyang membeli pakaian yang bagus yang menutupi wah (ulama, muballigh, ustadz-ustadzah), dan ortubuhnya mulai dari pergelangan tangan hingga kedua ang-orang yang menamakan dirinya wakil-wakil mata kaki. Ketika ia memakainya, ia berucap, “ Segala rakyat dan wakil-wakil daerah harus berprilaku puji bagi Allah yang menganugerahkan kepadaku proporsional, adil dalam bertindak dan menindak. pakaian dari bulu yang kugunakan untuk bergaya di Khusus nya lagi bagi pelaku dakwah, karena masih antara manusia dan untuk menutupi auratku “. (tafsir banyak yang berprilaku lebai dengan menetapkan ibnu Katsir). Bergaya dengan pakaian yang bagus tarif untuk satu show dakwahnya. Jika Allah saja sudianjurkan, namun sekali lagi, jangan lebai. dah tidak suka dengan prilaku berlebihan, maka Makan makanan secara berlebihan, dan minum apalah artinya ibadah yang dilakukan seseorang minuman halal secara berlebihan juga dikecam dalam yang ia persembahkan kepada Allah. Manusia lain Islam.Mengkonsumsi secara berlebihan dapat merusak pun tidak akan suka dengan setiap prilaku yang berpencernaan yang berakibat timbulnya penyakit. lebihan. Sederhana dalam berprilaku, itulah yang Rasulullah SAW bersabda mengingatkan kita semua diperintahkan kita pada nya, sebagaimana hadis bagaimana makan dan minum, “ Makanlah, minumlah, Nabi SAW, “ Sederhana dalam kekayaan, sederhana dan bersedekahlah tanpa kesombongan dan berlebihdalam kemiskinan, sederhana dalam beribadah” lebihan (wa la sarafa). Sesungguhnya Allah ingin melihat HR. imam ahmad dari Huzaifah.Wallahu a’lam.

Mimbar Jumat

WASPADA Jumat 27 Januari 2012

C7

Etos Wakaf Untuk Ketakwaan Umat Berdoa Agar Dijauhkan Dari Setan Allah SWT menciptakan manusia berpasang-pasangan. Nabi Muhammad SAW memberi isyarat agar umatnya berumah tangga, menciptakan keluarga sakinah, mawaddah, dan warahmah. Para pemuda yang sudah cukup usia dan memiliki pekerjaan/penghasilan dianjurkan segera menikah jika sudah menemukan calon pasangannya. Jangan ditunda-tunda untuk hal yang baik, menghindari dari perbuatan negatif, apalagi sampai mendekati zinah. Apalagi kalau mereka sudah lama berpacaran, segeralah mengikat janji, naik pelaminan melakukan akad nikah. Namun bagi pasangan pengantin baru sangat disarankan untuk belajar etika dan ilmu berumah tangga, mengetahui apa saja tanggung jawabnya, —baik bagi suami maupun si istri. Jangan hanya memikirkan hal-hal yang enak-enak saja, tapi rumah tangga harus berdasarkan niat baik untuk memperoleh keturunan. Jadikan sebagai sarana ibadah sehingga setiap langkah dan perbuatan kita mendapat bimbingan dari Allah SWT. Mengapa semakin banyak anak-anak yang bandel, melawan orang tua, terjangkit penyakit masyarakat, terperangkap kriminal, narkoba dll. Jawabnya, tidak semata-mata karena kesalahan si anak. Tapi, peran orang tuanya cukup besar. Tidak mampu mendidik sang anak. Sangat mungkin ‘’dosa’’ dari orang tuanya, saat berhubungan suami-istri tidak ingat Allah, lupa membaca doa, sehingga setan ikut berperan dan hubungan yang seharusnya bernilai ibadah itu menjadin sia-sia dan tidak memperoleh berkah, malah berdampak negatif pada sang jabang bayi. Oleh karena itu Rasulullah SAW bersabda : “Jika di antara kalian bersetubuh dengan istrinya (atau istri dengan suaminya), seraya berdoa wahai Allah jauhkanlah setan dari kami, wahai Allah jauhkanlah setan dari anugerah yang akan Kau berikan pada kami. Maka jika ditentukan bagi mereka anak, tak akan di perangkap setan.” (HR Bukhari). (Disarikan dari kumpulan hadis shahih)

Kerinduan Pada Ulama Kharismatik

(Catatan Peluncuran Buku Syekh H.M Arsyad Thalib Lubis: Pemikiran dan Karya Monumental)

Oleh Prof Dr H.Ramli Abdul Wahid, MA Pembantu Rektor IV IAIN Sumatera Utara

P

enulis tidak pernah belajar kepada Syekh H.M Arsyad Thalib Lubis, tidak pernah mendengar ceramahnya, dan tidak pernah melihat wajahnya. Penulis mengetahui beliau melalui buku-buku yang dikarangnya, melalui murid-muridnya, dan cerita-cerita orang yang mengenalnya. Sedang wajahnya, penulis hanya dapat menatapnya melalui foto-fotonya. Penulis sudah beberapa kali menulis tentang Syekh H.M Arsyad Thalib Lubis, baik secara khusus tentang biografinya, seperti dalam Ensiklopedi Islam yang terdiri atas tujuh jilid dan buku Syekh. H. M Arsyad Thalib Lubis: Pemikiran dan Karya Monumentalnya yang diluncurkan di UNIVA tanggal 25 Januari 2012, maupun secara umum dalam buku penulis yang berjdudul, Sejarah Pengkajian Hadis di Indonesia dan makalah-makalah dalam seminar-seminar. Namun 23 Januari 2012, penulis mendapat kesempatan berbincang-bincang dengan puteri Syekh H. M Arsyad Thalib Lubis, Hj. Nur Aziah yang sengaja datang dari Jakarta untuk menghadiri acara peluncuran buku tersebut di atas. Perbincangan secara fokus tentang kehidupan Almarhum Syekh H.M Arsyad Thalib Lubis sehingga banyak hal terungkap yang mungkin tidak dike-tahui banyak orang, kecuali hanya putraputerinya saja. Bagaimana perasaan tidak tersentuh, seorang ulama besar yang pernah menjadi Kepala Kantor Wilayah Kemenag SU dan pernah menjadi anggota Konstituante, tapi kehidupannya sederhana. Diberi rumah dinas, tapi tidak diterima. Be-liau lebih mengutamakan rumah pribadi walaupun sederhana. Diberi mobil dinas, tapi hanya digunakan untuk kepentigan dinas. Anak-anaknya tidak boleh menaikinya kecuali waktu ziarah ke kuburan orangtuanya di Stabat. Pernah satu kali, puterinya bernama Khairat menahan mobil dinasnya yang sedang lewat di Jl. Ismailiyah karena kebetulan puterinya ini sekolah di sana. Mobilnya meluncur lewat saja tidak berhenti mengambil puteri yang kepingin naik mobil dinas Buyahnya ini.Waktu dirumah, puterinya bertanya mengapa mobilnya tidak berhenti tadi. Almarhum Buyahnya menjawab, “Mana ada hakmu naik mobil dinas ini”. Pera-saan siapa yang tidak tersentuh dengan perlakuan seperti ini dari seorang pejabat kepada anaknya karena menjaga amanah dan kejujuran. Sungguh membuat kita rindu kepada pejabatpejabat seperti itu di zaman sekarang. Sebagai seorang ulama besar, ketika hendak diberikan penghargaan gelar professor oleh UISU kepadanya, Syekh H. M Arsyad Thalib Lubis menolaknya. H.M Arsyad Thalib Lubis menjadi anggota Konstituante dari fraksi Masyumi. Karena Masyumi membuat konsep penerapan hukum syariat di Indonesia, Soekarno membubarkannya. Beliau pun mengundurkan diri dari statusnya sebagai PNS, kembali mengajar , menulis buku dan mempersiapkan kader bersama kawan-kawannya. Pernah satu waktu beliau diberi hadiah sebuah mobil oleh seorang dermawan untuk memperlancar kegiatan dakwah. Ketika menjelang wafat beliu berwasiat bila beliau meninggal agar mobil dikembalika kepada pemberinya karena mobil itu diberi untuk kepentingan dakwah. Ketika beliau meninggal, mobil dikembalikan kepada pemberinya karena dakwah sudah tidak lagi dilaksanakan. Begitu Almarhum meninggal, anak-anaknya melaksanakan amanah. Namun, orang yang memberi mobil tidak menerima dengan alasan bahwa haknya sudah tidak ada lagi pada mobil itu. Sementara ucapan untuk dakwah— katanya—sekedar alasan agar Almarhum menerimanya. Tanpa alasan seperti itu, Almarhum tidak akan menerimanya. Namun, anak-anak tetap menjaga pesan orangtua. Lalu mereka sepakat untuk menyerahkan mobil ke UNIVA. Almarhum juga berwasiat agar mengembalikan mesin ketik yang dipinjamnya dari Kantor Kemenag. Almarhum selalu berkata-kata baik kepada anakanaknya. Kalau ada yang tidak cocok, beliau menegurnya dengan bahasa yang singkat tetapi penuh makna. Suatu kali, beliau tidak meninggalkan belanja. Anak-anak sepakat untuk menghidangkan nasi saja. Anak-anak sudah ketakutan. Buyah membuka makanan, ternyata nasi saja. Buyah berkomentar,“Bagus-bagus, kan kalian tidak susahsusah masak”.Suatu kali, tamu puterinya yang bernama Khairat datang berkunjung ke rumah. Yang datang itu ada laki-laki dan perempuan. Sesudah mereka pulang, Buyah memanggil semua anak-anaknya dan berkomentar,

“Laki-laki berkawan dengan laki-laki dan perempuan berkawan dengan perempuan”. Keterangannya singkat, tapi maknanya mendalam bagi anak-anak. Pada suatu kesempatan, Almarhum diundang oleh PT. Moeis untuk menyampaikan ceramah. Waktu pulangnya diberikan uang oleh yang mengundang. Kemudian beberapa waktu kemudian, Almarhum diundang lagi. Beliau menolaknya dengan alasan, “Apa yang sudah saya ajarkan sudah cukup untuk mereka amalkan.” Ini mungkin bermakna bahwa pemberian honor yang terlalu besar kurang disenangi oleh Almarhum. Almarhum berwasiat agar waktu mengantarnya ke pekuburan, kerandanya jangan di depan pengantar dan jangan di belakang, tapi di tengah-tengah pengantar. Maksudnya beliau ingin tetap berada di tengah-tengah umatnya sampai waktu pemakamannya. Ternyata pesannya tidak bisa dipenuhi karena pelayat terlalu banyak dan semua ingin mengangkat jenazahnya. Karena banyaknya manusia pelayat, kerandanya tidak bisa diusung lagi, melainkan berjalan di atas kepala pengunjung, seperti perahu yang bergerak di atas lautan manusia. Almarhum juga berpesan agar karya-karya tulisnya dibiarkan seperti apa adanya. Jangan diubah-ubah, kitab-kitabnya jangan dipisah-pisah agar dapat digunakan anak cucunya yang mampu membacanya. Karena itu, anak-anaknya tidak berani memberikan atau mewakafkannya kepada siapa pun. Namun karena khawatir buku-bukunya rusak sebab tidak dipelihara, maka putera-puterinya berpikir untuk menempatkannya di sebuah tempat yang dapat dibaca oleh banyak orang. Misalnya, ditempatkan ruang khusus di Fakultas Agama, UNIVA dengan status tetap milik ahli waris dan dibaca serta digunakan orang yang memerlukannya di ruang tersebut, sepanjang belum ada dari ahli waris yang bisa menggunakannya. Syekh H.M Arsyad Thalib Lubis bukan hanya menguasai ilmu yang luas, tapi juga memiliki visi yang jauh ke depan. Ketika penandatanganan pemisahan daerah dari Pemerintahan Pusat, yang dikenal dengan Dewan Gajah, Syekh H.M Arsyad Thalib Lubis tidak bersedia menandatanganinya sehingga banyak orang mengritiknya sebagai penakut. Sesudah itu, beliau mengarang buku yang berjudul Pemberontakan dalam Islam. Dalam buku ini, beliau men-jelaskan syarat-syarat boleh melakukan pemberontakan, kriteria penguasa yang diprotes, dan cara-cara pemberontakan. Ternyata buku ini dilarang beredar dan beliau ditahan sebagai tahanan kota, tidak boleh keluar dari Jakarta untuk selama beberapa waktu.Syekh H.M Arsyad Thalib Lubis sangat hormat kepada tamu. Beliau berusaha menyuguhkan apa yang layak disuguhkan secara maksimal. Kemudian, kalau tamu yang datang perempuan, beliau meminta puteri-puterinya keluar ke ruang tamu untuk menghindari fitnah. Karena sifatnya yang demikian agung, putera-puterinya sangat sayang, cinta, hormat dan kagum kepada orangtua mereka. Karena itu pula, mereka sangat hati-hati memberikan persetujuan kepada permintaan izin untuk sesuatu yang berkaitan dengan orangtua mereka, sehingga kadang-kadang terkesan sombong dan “jual mahal”. Sebenarnya tidak demikian. Suatu kali mereka diminta persetujuan untuk menggunakan nama orangtua mereka, Syekh H. M Arsyad Thalib Lubis sebagai nama bagi UMN. Mereka tidak menyetujuinya. Pada kesempatan lain, permohonan izin juga disampaikan kepada mereka untuk menggunakan nama tersebut menjadi nama asrama di UNIVA. Mereka juga tidak dapat menyetujuinya. Sebenarnya mereka mengerti bahwa permohonan-permohonan izin menggunakan nama orangtua mererka itu bertujuan sebagai penghargaan dan penghormatan kepadanya. Akan tetapi, karena sangat hati-hati, mereka khawatir kalau persetujuan yang mereka berikan bisa berakibat tidak sejalan dengan prinsip orangtua mereka. Menurut hemat penulis, semua orang hormat dan kagum kepadanya, termasuk orang-orang yang disebutsebut sebagai ulama di tengah-tengah masyarakat sekarang ini. Bila mengingat dan membaca sejarah keilmuan dan keperibadian Syekh H.M Arsyad Thalib Lubis wajar merasa malu karena terlalu jauh perbedaannya. Karena itu, buku-bukunya masih dibutuhkan dibaca orang sehingga ahli waris setiap tahun tetap menerima royaltinya. Sikap dan prinsipnya tetap dikenang dan dirindukan orang.

Kalau ada yang tidak cocok, beliau menegurnya dengan bahasa yang singkat tetapi penuh makna.

Oleh Azhari Akmal Tarigan Pengurus Perwakilan Badan Wakaf Sumatera Utara.

A

pa yang akan anda lakukan, jika anda memiliki sebidang tanah yang amat subur. Tanah itu sangat produktif sehingga apa saja yang ditanam, akan tumbuh dan menghasilkan buah-buahahan dan sayur-sayuran yang amat segar. Intinya nilai ekonomis tanah itu sangat tinggi. Saya menduga jawaban kita akan bervariasi. Ada yang akan mengolah tanahnya menjadi tanah pertanian yang subur. Ada yang menjualnya dengan harga tinggi. Saya tidak tahu apakah ada yang memutuskan untuk mewakafkan tanahnya yang subur tersebut!. Merujuk pada sejarah kehidupan sahabat, kita akan menemukan satu babakan sejarah yang indah. Adalah Umar Ibn Al-Khattab, memiliki sebidang tanah di Khaibar. Tanah itu dikhabarkan sangat subur dan bernilai ekonomis yang tinggi. Yang menarik adalah, Umar Ibn Al-Khattab tidak mengolah tanahnya.Tidak pula menjualnya dengan harga tinggi. Umar memilih untuk mewakafkan hartanya. KetikaUmarmemintapendapatRasul, Nabi yangmulia itu mengatakan, jika engkau ingin, tahanlah zatnya dan ambilmanfaatnya.Inilahmaknawakaf dalam pengertian peraktisnya. Di dalamsabdanyaRasulinginmengatakan, serahkanlahhartamukepadaAllahdan berikan kemanfaatannya buat umat. HartawakafadalahhartaAllahswtyang pemanfaatannya kembali kepada umat. Umar Ibn Al-Khattab sesungguhnya telah menunjukkan sikap terpuji terhadap aset yang kita miliki. Demikianlah, etos wakaf sahabat pada masa Nabi Muhammad SAW. Para sahabat semuanya ingin tampil menjadi orang yang terdepan dalam melakukan kebaikan-kebaikan terlebih lagi dalam kaitannya dengan kepentingan umat Islam. Jika kita merujuk ke dalam Q.S Fathir ayat 32, setidaknya ada tiga golongan hamba Allah yang dipilihnya untuk mewarisi Al-Kitab. Ada yang disebut zhalimun li nafsih (mereka yang menzalimi dirinya sendiri), ada pula yang muqtashid (moderat) dan ada yang paling baik. Alquran menggunakan istilah sabiqun bi al-khairat. Kelompok yang terakhir ini adalah mereka yang selalu ingin mengambil kesempatan pertama dalam melakukan kebaikan-kebaikan. Mereka ingin di depan jika ada ruang untuk berbuat baik.Tidak perlu menunggu orang lain yang lebih dahulu melakukannya baru kemudian ia menyusul di belakang.

Di antara instrument ekonomi Islam yang belakangan ini mendapat perhatian serius di kalangan ahli dan peraktisi ekonomi Islam adalah masalah wakaf. Berbeda dengan instrument ekonomi Islam lainnya yang relatif lebih stabil, seperti zakat, infaq, sadaqah, perbankan syari’ah, asuransi dan lainnya. Wakaf dipandang memiliki potensi yang besar. Tentu saja wakaf yang dimaksud dalam

bangkan. Al-muhafazhat ‘ala alqadim al-salih wa al-akhz bi al-jadid aslah (mempertahankan tradisi lama yang baik dan mengambil gagasan baru yang lebih baik). Di antara pergeseran paradigma berpikir tentang wakaf adalah, antara keabadian dan kemanfaatan. Berpegang pada keabadian ‘ain (materi) wakaf kerap membuat kita tidak bisa memproduktifkan harta wakaf.

Umar Ibn Al-Khattab tidak mengolah tanahnya. Tidak pula menjualnya dengan harga tinggi. Umar memilih untuk mewakafkan hartanya. konteks ini adalah wakaf produktif bukan wakaf konvensional. Bahkan, wakaf jauh lebih potensial untuk memberdayakan ekonomi umat. Di antara faktornya adalah aturan-aturan wakaf yang relatif lebih fleksibel. Kehadiran UU No 1 Tahun 2004 tentang Wakaf dan PP Nomor 42 Tahun 2009 tentang Pelaksanaannya adalah sebuah momentum di mana kita telah memasuki era baru fikih wakaf. UU tersebut tidak saja akomodatif terhadap aturan-aturan normatif tentang wakaf tetapi juga sangat progresif dalam merespon perkembangan modern. Di dalam UU di atur wakaf uang yang selama ini masih ditabukan dikalangan sebagian ulama. Demikian juga wakaf muaqqat (berjangka) yang tidak diberi ruang. Tidak kalah menariknya adalah UU tersebut juga mengatur tentang Manajemen Wakaf, Badan Wakaf Indonesia, nazhir dan segala sanksi yang melingkupinya. Dari sisi perangkat peraturan, eksistensi wakaf kita jauh lebih baik dari masa lalu. Persoalannya sekarang adalah bagaimana meningkatkan etos wakaf umat. Meningkatkan etos wakaf umat bukanlah hal mudah. Langkah pertama yang harus dilakukan adalah merubah paradigma wakaf umat. Mindsetumatkitatentangwakafmasih merujuk kepada konsep wakaf yang dirumuskan ulama klasik, beberapa abad yang lalu. Tentu tidak semuanya salah. Namun keterikatan kepada pemikiran masa lalu, kerap membuat kita terbelenggu. Sampai di sini, idiom yang berlaku di dalam NU (Nahdhatul Ulama) layak untuk kita pertim-

Keabadian atau baqa’ wakaf juga membuat kita tidak bisa memperluas objek wakaf. Oleh sebab itu, definisi wakaf yang menegaskan tahan zatnya dan ambil manfaatnya harus dipahami secara seimbang. Demikian juga dengan larangan Rasul untuk mewarisi, menjual atau menghibahkan tanah wakaf itu harus diletakkan dalam konteks yang tepat. Sejatinya, manfa’at wakaf tidak saja diposisikan sebagai tujuan (goal) wakaf tetapi harus dijadikan asas dalam pengembangan wakaf. Menerapkan konsep keabadian wakaf akan sangat sulit jika kita bicara tentang wakaf uang. Apa lagi jika ada yang memahami keabadian wakaf itu adalah materi atau benda uang itu sendiri. Pada hal uang akan bermanfaat jika dikelola dan diputarkan secara ekonomis. Jika keabadian wakaf uang dipahamipadanilai,ternyatanilaiuang juga mengalami fluktuasi. Sampai di sini,pentinguntukmemahamiintiwakaf itu adalah bagaimana harta yang dimiliki memberi kemanfaatan yang lebih luas buat kemanusiaan. Sampai saat ini, penulis melihat masih ada dika-langan umat Islam bahkan ulama dan cendikiawannya yang belum bisa menerima wakaf uang dengan alasan definisi yang telah ditetapkan ulama masa lalu. Sebagai lanjutannya, menurut penulis, rubu’ wakaf harus diletakkan pada rumpun mu’amalat. Tidak lagi ditempatkan pada rubu’ ibadah. Posisi ini menentukan bagi majal al-ijtihad (ruang ijtihad). UU Wakaf memberi peluang untuk menukar, mengganti dan menjual harta wakaf kendatipun

prosedurnya sangat rumit dan sulit. Tentu ini penting untuk menghindarkan kesewenang-wenangan para nazhir jika keran tabadul wakaf ini di buka sedemikian luas. Intinya, perubahan peruntukan wakaf itu diperkenankan sepanjang sesuai dengan undang-undang. Bukankah, manfaatnya akan kembali kepada umat juga.Yang salah adalah jika harta wakaf ditukar untuk kepentingan pemilik modaldankaumkapitalis.Tanahwakaf yang tidak termanfaatkan atau tidak produktif bisa saja dijual dan hasilnay kembali dibelikan kepada tanah yang memiliki nilai ekonomi dan potensial untuk dikembangkan. Ijtihad-ijtihad seperti di atas sangat diperlukan dalam upaya mengoptimalkan wakaf. Tidak saja diperlukan keberanian intelektual untuk berijtihad tetapi juga keberanian moral. Pada saat inilah, integritas nazhir akan dipertaruhkan. Apakah upayanya dalam memproduktifkan wakaf disisipi kepentingan pribadi atau golongan ? ataukah semata-mata demi kepentingan umat. Pada gilirannya, upaya untuk memproduktifkan wakaf membutuhkan Sumber daya Insani yang tangguh. Dalam hal ini, keberadaan nazhir menjadi niscaya. Nazhir bukan orang yang tinggal di masjid atau yang rumahnya dekat dengan objek wakaf. Nazhir juga bukan famili atau anak dari pewakif.Maknanazhirdalamundangundang adalah sumber daya manusia yang tangguh, cerdas dan bermoral serta mampu memproduktifkan wakaf. Mampu memberi nilai tambah terhadap wakaf. Intinya, ia mampu untuk memberdayakan harta wakaf untuk kemanfaatan yang sebesarbesarnya buat umat. Point yang ingin penulis sampaikan adalah, tugas kita sebagai khalifah sesungguhnya adalah bagaimana membuat umat ini meningkat ketakwaannya dan meningkat pula kesejahteraannya. Kita tidak bisa mendorong umat untuk bertakwa namun hidupnya sengsara. Tidak boleh juga kita biarkan umat tenggelam dalam kesejahteraan materialnya, namun miskin secara spiritual. Tugas kita adalah mendorong etos wakaf umat. Kerjasama dan keteladanan ulama dan umara serta masyarakat menjadi penting. Hanya dengan kerjasama yang baik inilah, ketakwaan dan kesejahteraan umat akan sama-sama bisa kita bangun.

Bagaimana Sebenarnya Kedudukan Isbal? Oleh Nursanjaya, SAg, MPd Kepala Perpustakaan MAN Langsa, Dosen STAIN Zawiyah Cot Kala Langsa

D

alam suatu pengajian, penulis pernah ditanyakan oleh salah satu jamaah. Pertanyaan itu seperti ini: “Ustadz, saya ada pertanyaan, Sebenarnya bagaimana hukumnya isbal (meman-angkan kain sampai melebihi mata kaki untuk laki-laki?) Ada yang mengatakan hukumnya haram dan juga ada yang mengatakan bahwa masih terdapat perbedaan pendapat dan mengatakan bolehnya isbal karena dalam menghukumi suatu perbuatan juga harus melihat kondisi sosio-antropologi zaman Nabi SAW dulu. Mohon penjelasan selengkapnya”. Apa yang ditanyakan ini sebenarnya adalah sebuah polemik berkepanjangan yang tidak pernah ada habisnya. Dan melibatkan begitu banyak pihak sepanjang zaman serta telah menghabiskan begitu banyak energi, waktu, kesempatan serta potensi terpendam umat ini. Sungguh, begitu banyak maksiat dan keretakan persaudaraan di dalam tubuh umat Islam lantaran meributkan urusan ujung celana. Mutlak haram Tidak sulit untuk mencari literatur pendapat yang mengharamkan isbal secara mutlak. Fatwa-fatwa dari kalangan ulama Saudi umumnya cenderung memutlakkan keharaman isbal. Kalau boleh disebut sebagai sebuah contoh, ambillah misalnya fatwa Syaikh Abdullah bin Abdul Aziz bin Baaz rahimahullah. Jelas dan tegas sekali beliau mengatakan bahwa isbal itu haram, apapun alasannya. Dengan niat riya’ ataupun tanpa niat riya’. Pendek kata, apapun bagian pakaian yang lewat dari mata kaki adalah dosa besar dan menyeret pelakunya masuk neraka. Beliau amat serius dalam masalah ini, sampai-sampai fatwa beliau yang paling terkenal adalah masalah keharaman mutlak perilaku isbal ini. Setidaknya, fatwa inilah yang selalu dan senantiasa di copy-paste oleh para murid dan pendukung beliau, sehingga memenuhi ruang cyber dimana-mana. Berikut ini adalah salah satu petikan fatwa beliau: “Apa yang di bawah kedua mata kaki berupa sarung maka tempatnya di Neraka” (HR. Bukhari dalam Shahihnya). Atau dalam hadis lain: “Ada tiga golongan yang tidak akan dilihat oleh Allah di hari Kiamat, tidak dilihat dan tidak disucikan (dari dosa) serta mendapatkan adzab yang sangat pedih, yaitu pelaku isbal (musbil), pengungkit pemberian dan orang yang

menjual barang dagangannya dengan sumpah palsu” (HR. Muslim). Kedua hadis ini dan yang semakna dengannya mencakup orang yang menurunkan pakaiannya (isbal) karena sombong atau dengan sebab

mendapatkan kemaafan ketika pakaiannya turun. Karena hadis shahih yang melarang melakukan isbal bersifat umum dari segi teks, makna dan maksud. Hendaknya juga itu dilakukan karena takut

Maka klaim bahwa isbal itu haram secara mutlak dan sudah disepakati semua ulama adalah klaim yang kurang tepat. lain. Karena Rasulullah SAW mengucapkan dengan bentuk umum tanpa mengkhususkan. Kalau melakukan isbal karena sombong, maka dosanya lebih besar dan ancamannya lebih keras. Tidak boleh menganggap bahwa larangan melakukan isbal itu hanya karena sombong saja, Rasulullah SAW tidak memberikan pengecualian hal itu dalam kedua hadis yang telah penulis sebutkan tadi, sebagaimana juga beliau tidak memberikan pengecualian dalam hadis yang lain. Nabi SAW menjadikan semua perbuatan isbal termasuk kesombongan karena secara umum perbuatan itu tidak dilakukan kecuali memang demikian. Siapa yang melakukannya tanpa diiringi rasa sombong maka perbuatannya bisa menjadi perantara menuju ke sana. Dan perantara dihukumi sama dengan tujuan, dan semua perbuatan itu adalah perbuatan berlebihan-lebihan dan mengancam terkena najis dan kotoran. Adapun ucapan Rasulullah SAW kepada Abu Bakar ash-Shiddiq ra., ketika berkata: “Wahai Rasulullah, sarungku sering melorot (lepas ke bawah) kecuali aku benar-benar menjaganya”. Maka beliau bersabda: “Engkau tidak termasuk golongan orang yang melakukan itu karena sombong” (HR. Bukhari dan Muslim). Yang dimaksudkan oleh Rasulullah SAW bahwa orang yang benarbenar menjaga pakaiannya bila melorot kemudian menaikkannya kembali tidak termasuk golongan orang yang menyeret pakaiannya karena sombong. Karena dia (yang benarbenar menjaga) tidak melakukan isbal. Tapi pakaian itu melorot (turun tanpa sengaja) kemudian dinaikkannya kembali dan menjaganya benarbenar. Tidak diragukan lagi ini adalah perbuatan yang dimaafkan. Adapun orang yang menurunkannya dengan sengaja, apakah dalam bentuk celana atau sarung atau gamis, maka ini termasuk dalam golongan orang mendapatkan ancaman, bukan

kepada kemurkaan Allah dan hukuman-Nya. Dan Allah adalah sebaik-baik pemberi taufiq. Wallahu a’lam bish-shawwab.(Fatwa Syaikh Abdullah bin Baaz yang dinukil dari Majalah Ad-Da’wah, hal 218). Haram dengan niat riya’ Sedangkan pendapat para ulama yang tidak mengharamkan isbal asalkan bukan dilakukan karena riya’, di antaranya adalah pendapat al-Hafizh Ibnu Hajar al-Asqalany, seorang ulama yang dengan sukses menulis syarah (penjelasan) kitab Shahih Bukhari (Fathul Bari). Kitab beliau ini boleh dibilang kitab syarah yang paling masyhur dari Shahih Bukhari. Beliau adalah ulama besar dan umat Islam berhutang budi tak terbayarkan kepada ilmu dan integritasnya. Khusus dalam masalah hukum isbal ini, beliau punya pendapat yang tidak sama dengan Syaikh bin Baaz yang hidup di abad 20 ini. Beliau memandang haramnya isbal tidak bersifat mutlak. Isbal hanya haram bila memang dimotivasi sikap riya’. Isbal halal hukumnya bila tanpa diiringi sikap itu. Ketika beliau menerangkan hukum atas sebuah hadis tentang haramnya isbal, beliau secara tegas memilah masalah isbal ini menjadi dua. Pertama, isbal yang haram, yaitu yang diiringi sikap riya’. Kedua, isbal yang halal, yaitu isbal yang tidak diiringi sikap riya’. Berikut petikan fatwa Ibnu Hajar dalam Fathul Bari: “Di dalam hadis ini terdapat keterangan bahwa isbal izar karena sombong termasuk dosa besar. Sedangkan isbal bukan karena sombong (riya’), meski lahiriyah hadis mengharamkannya juga, namun hadis ini menunjukkan taqyid (syarat ketentuan) karena sombong. Sehingga penetapan dosa yang terkait dengan isbal tergantung kepada masalah ini. Maka tidak diharamkan memanjangkan kain atau isbal asalkan selamat dari sikap sombong” (Lihat Fathul Bari li Syarh Shahih Bukhari, hadis no. 5345). Selain itu, ada juga seorang ulama

besar lagi yang bernama al-Imam Yahya ibn Sharafuddin an-Nawawi rahimahullah, seorang ulama besar di masa lalu yang menulis banyak kitab, di antaranya Shahih Muslim bi Syarhin Nawawi. Kitab ini adalah kitab yang menjelaskan kitab Shahih Muslim. Beliau juga adalah penulis kitab hadis lainnya, yaitu Riyadhus Shalihin yang sangat terkenal, termasuk kitab al-Arba’in an-Nawawiyah. Di dalam Syarah Shahih Muslim, beliau menuliskan pendapat: “Adapun hadis yang mutlak bahwa semua pakaian yang melewati mata kaki di neraka, maksudnya adalah bila dilakukan oleh orang yang sombong. Karena dia mutlak, maka wajib dibawa kepada muqayyad, wallahu a’lam. Dan Khuyala’ adalah kibir (sombong). Dan pembatasan adanya sifat sombong mengkhususkan keumuman musbil (orang yang melakukan isbal) pada kainnya, bahwasanya yang dimaksud dengan ancaman dosa hanya berlaku kepada orang yang memanjangkannya karena sombong. Dan Nabi SAW telah memberikan rukhshah (keringanan) kepada Abu Bakar ash-Shiddiq ra seraya bersabda, “Kamu bukan bagian dari mereka.” Hal itu karena panjangnya kain Abu Bakar bukan karena sombong”. Maka klaim bahwa isbal itu haram secara mutlak dan sudah disepakati semua ulama adalah klaim yang kurang tepat. Sebab siapa yang tidak kenal dengan al-Hafizh Ibnu Hajar alAsqalany dan al-Imam an-Nawawi. Keduanya adalah ulama besar sepanjang zaman. Dan keduanya mengatakan bahwa isbal itu hanya diharamkan bila diiringi rasa sombong. Maka haramnya isbal secara mutlak dalam pandangan penulis (Insya Allah, wallahu a’lam) adalah masalah khilaf, bukan masalah yang qath’i atau ijma’ semua ulama. Para ulama berbeda pendapat dalam masalah ini. Dan itulah realitasnya. Bila satu ijtihad berbeda dengan ijtihad yang lain, bukan berarti kita harus panas dan naik darah. Sebaliknya, kita harus mawas diri, luas wawasan dan semakin merasa diri bodoh. Kita tidak perlu menjadi sok pintar dan merasa diri paling benar dan semua orang harus salah. Sikap yang demikian bukan ciri seorang thalabatul ‘ilmi yang sukses, sebaliknya ini adalah sikap para juhala’ (orang bodoh) yang ilmunya terbatas. Semoga Allah SWT selalu menambah dan meluaskan ilmu kita serta menjadikan kita orang yang bertafaqquh fiddin. Wallahu a’lam bish-shawwab.

Mimbar Jumat

C8

WASPADA Jumat 27 Januari 2012

Kuliner Dunia Islam Abad Pertengahan Catatan sejarah menunjukkan teknik pembuatan makanan seperti pasta dan es krim dimulai pada masa Islam. Jatuhnya Kekaisaran Romawi pada abad ke-5 M membuat berhentinya kemajuan peradaban manusia. Pada abad ke7 M peradaban lain yang sebanding muncul di daerah yang sama sekali tak terduga: Peradaban dari Arabia. Peradaban ini dipercaya akan mengisi periode transisi bagi dunia, dan Islam berkembang pesat secara luas bagi seluruh umat manusia. Seperti halnya berbagai bidang sebelum Islam, dunia Arab kemudian mengenal berbagai macam buah-buahan dan sayur-sayuran yang sebelumnya tidak mereka kenal. Transplantasi keanekara-gaman tanaman dan pohon buah-bantalan untuk iklim yang berbeda menjadi tantangan yang memotivasi pertanian revolusi Islam. Misalnya pada abad ke-4 SM Yunani telah melaporkan dari India ‘tumbuh di pohonpohon, tanpa lebah madu.’ Maka kemudian para agronomers Muslim memenuhi tantangan transplantasi untuk tanaman ini, sehingga membawanya ke budidaya di Mesir, Suriah, Afrika Utara dan bahkan Spanyol dan Sisilia. Penciptaan kekayaan adalah salah satu warisan dari revolusi pertanian ini, perdagangan itu dikembangkan dan perjalanan dengan akibat peningkatan manusia kontak dan pertukaran pengetahuan dan ide-ide. Jika sebelumnya tidak diketahui bumbu dan rempahrempah dan menjadi otoritas yang dominan dalam menentukan apa yang harus makan dan kapan harus memakannya. Tetapi kemudian jumlah para dokter ahli gizi bermunculan dengan berbagai karyakaryanya. Beberapa karya penting Islam dalam hal ini adalah: Thaabit bin Qurrah (836-901):

beberapa risalah, Abuu Bakr alRaazii (865-925): Al-Haawii fii ‘ttibb (Continens), Ibnu Sina (9801037): Al-Qaanuun fii ‘t-tibb (kanon medis), Sa’id bin al-Qurtubi (abad ke-10): Kitaab khalq al-janiin wa tadbiir al-hibaala (diet untuk ibu hamil), Abu Marwan bin Zuhur (1092-1161): AlTaysiir fii ‘l-mudaawaat wa-ltadbiir Kitaab al-aghdia (buku tentang nutrisi dari bin Zuhur ‘s Al-Taysir). Dengan demikian, dalam domain Islam seni kuliner tidak berkembang secara acak. Sebaliknya, ini adalah seni berdasarkan penelitian medis yang menyeluruh dan nasihat ahli diet. Bahan dipilih, kemudian tersebar untuk masyarakat luas. Piring memiliki terapeutik kebajikan dan bertindak sebagai obat preventif oleh memperkuat tubuh untuk melawan penyakit dan memperlambat proses penuaan. Akibatnya, ada Hadis yang mendefinisikan kewajiban manusia terhadap kesehatan tubuh-Nya: ‘Ina li-jasadika alay-ka haqqan’ yang berarti: ‘tubuh Anda berhak atas Anda’. Sebagai jumlah resep yang meningkat, penulis mulai menuliskannya ke dalam buku-buku resep. Kemudian untuk pertama kalinya, dalam peradaban Islam, beberapa makanan yang sebelumnya telah tersedia hanya di istana menjadi kemudian tersedia untuk seluruh penduduk. Gizi telah berkembang menjadi sebuah terapi, mempromosikan kesehatan warga sesuai dengan lingkungan mereka dan musim tahun. Pada abad ke-13, buku-buku dan tabib dan kompilasi dari resep menarik perhatian penguasa di Barat. Ketertarikan tersebut meningkat ketika Ferrara, Salerno, Montpellier dan Paris menjadi pusat untuk mempelajari karya medis Muslim. Di Eropa, dalam lingkaran aristokrat, permintaan bahan makanan dan

rempah-rempah Muslim meningkat dengan cepat. Namun, rakyat biasa, khususnya di Eropa Utara, memiliki hanya pembatasan, hanya makan daun bawang, bawang, kubis (kale), apel dan roti, dengan penambahan kadang-kadang daging atau ikan. Orang-orang Eropa Selatan memiliki kehidupan agak lebih baik dengan jenis makanan salad, berbagai buah-buahan dan sayuran. Tapi yang paling penting, minyak untuk frying, manis makanan penutup dan keju. Aristokrat Eropa membenci penggunaan sayuran dan makan terutama diet daging. Akibatnya, secara luas mereka menderita encok. Kehadiran permen, selai dan menjaga dibuat masalah lain: sembelit, melalui mengabaikan rekomendasi dokter Muslim. Namun, ada satu monarki Eropa yang merawat untuk mengikuti Muslim, dengan mengimpor produk mahal dan buahbuahan mereka. Dia adalah Cristina Ratu Denmark, Swedia dan Norwegia yang berpisah dengan suaminya di tahun 1496 dan hidup pada anggaran yang ketat. Dia bahkan berpuasa lebih dari gereja, untuk menghemat uang untuk membeli seperti rarities, karena Denmark sendiri bisa memasok hanya apel dan gandum. Ketersediaan buku-buku resep terjemahan obat dan masakan dari bahasa Arab telah menjadi panduan untuk kepentingan dokter dan koki. Taciunum Sanitatis (pemeliharaan kesehatan) dari abad ke-11 dibentuk kompendium dasar untuk dokter dan isinya banyak meniru peradaban Muslim. Masakan ternyata sarana untuk menunjukkan keperkasaan. Beberapa buku masak yang muncul dalam periode ini. Untuk makanan di dunia Muslim seperti salad atau sup, sebagai makanan penutup me-

rupakan rekomendasi ar-Razi ‘s dan bin Zohr. Lalu apa adalah hidangan dari dunia Islam yang ditransmisikan melalui terjemahan dan kontak dalam masyarakat kala itu? Ada banyak daftarnya, beberapa contoh utama adalah: Pasta. Penggunaan pasta yang direkam oleh orang-orang yang melanglangbuana seperti Al-Bakri (abad ke-11 Masehi). Juga dalam riwayat resmi misalnya sebuah biara di Utara Spanyol yang mencatat membawa wanita Muslim membuat pasta untuk perjamuan. Semua ini sebelum Marco Polo. Lihatlah pembungkus pasta, Anda akan melihat bahwa itu dibuat dari gandum dan tidak, seperti mie China, dari beras. China bahkan tidak memiliki gandum, yang tinggi kadar perekatnya, sehingga meningkatkan elastisitas adonan. Jenis khusus sulit gandum diperkenalkan oleh Muslim ke Sisilia dan Spanyol pada abad ke-10. Bahkan lebih penting adalah turunan dari lasagna dari bahasa Arab lisan yang berarti lidah. Es Krim. Di Italia ‘cassata’ berasal dari qashda (cream dalam bahasa Arab). Ibn Abdun mencatat (seorang pengamat pasar Abda ke 12 di Sevilla) untuk memberi perhatian terhadap penjual krim/qashda, juga sorbets musharabiya di abad ke 1112 Masehi. Teknik mengawetkan dan menyimpan es secara luas dibuktikan dan diperkenalkan dengan ice houses. Beberapa dokter seperti Al Rhazi dan Ibn Sina menjelaskan bahaya minuman es sedingin untuk saraf. Patisserie: adalah ironis untuk melihat bahwa Perancis hari ini adalah ibu dari kue kering ini. Sementara di abad ke 14 mereka menjadi adalah orang yang baru pertama kali melihatnya ketika raja memajangnya di toko-toko. Sejarah menunjukkan bahwa dokter Muslim adalah

Lukisan Ottoman perjamuan yang diberikan oleh Panglima Lala Mustafa Pasha Yeniceri di Izmit, 5 April 1578 (Topkapi Palace Museum perpustakaan). ayah dari masakan terapi ini yang dipengaruhi dunia dan dibawa kemudian oleh wisatawan Eropa ke dunia baru.

Tulisan ini menunjukkan bagaimana Eropa di abad pertengahan berjuang bagaimana agar seni kuliner bersaing un-

tuk perdagangan di eksotis rempah-rempah lain yang berasal dari dunia Islam. (m07/MuslimHeritage)

Menggairahkan Konsumsi Halal Umat Islam Tipe Pemimpin Thaghut Dalam Alquran (Menyambut Muzakarah Halal MUI Sumatera Utara) Oleh Prof Dr H. Hasan Bakti Nasution, MA

Dosen Fak. Tarbiyah IAIN Sumatera Utara dan Pengurus el-Misyka Circle.

Sekretaris Umum MUI Sumut

P

ada hari Ahad (29-01-2012) akan datang MUI Sumatera Utara akan mengadakan muzakarah tentang Halalan Thayyiba. Muzakarah yang akan digelar di kantor MUI Sumatera Utara ini menghadirkan pelaku produksi halal dari negara jiran Malaysia, yaitu sebuah pabrik (kilang) makanan halal yang terdapat di Kuala Kangsar Ipoh, yati Islamic Manufacturing Practices (IMP). Muzakarah ini dipandang penting, karena tiga alasan. Pertama, dirasakan bahwa makanan halal yang beredar selama ini masih didominasi oleh makanan yang tidak halal atau tidak jelas kehalalannya. Kondisi ini terus berlanjut, karena kesadaran umat Islam tentang halal masih rendah, sehingga tidak begitu peduli apakah makanan halal atau haram. Kedua, terbatasnya alternatif pilihan makanan yang diproduksi umat Islam, sehingga mau tidak mau terpaksa mengkonsumsi ma-kanan yang diproduksi non Muslim. Ketiga, tidak adanya kemestian produksi makanan halal, karena tidak ada UU yang dijadikan sebagai payung hukum. Konsep makanan dalam Islam Sebagai sebuah agama yang ajarannya mencakup seluruh as-pek kehidupan, konsep tentang makanan menjadi bagian dari ajarannya. Secara sederhana, konsep makanan dalam Islam tertuang dalam surat al-Baqarah: 168, yang artinya: “wahai manusia makanlah segala yang ada di bumi yang halal dan thayyib”. Dari ayat sederhana ini ada dua persyaratan makanan yang bisa dikonsumsi umat Islam, yaitu: Pertama, halal. Halal bermakna legal atau dibolehkan/diizinkan, yaitu dibolehkan memakannya. Biasanya dikaitkan dengan makanan dan minuman. Halal dapat dilihat dari tiga sisi, yaitu zatnya, cara memperosesnya, dan cara memperolehnya. Halal dari segi zat, berarti tidak termasuk yang haram dari segi zat yang ditetapkan Alquran dan hadis, seperti babi, anjing, darah, dan lainlain. Halal dari segi memproses, yaitu tidak bercampur dengan yang haram, misalnya bercampur dengan lemak babi. Haram dari cara memperoleh, seperti diperoleh tidak melalui pencurian, perampokan, perjudian, dan sebagainya. Kedua, thayyib. Thayyib mengandung dua arti, yaitu memiliki gizi dan tidak jorok. Selain halal, makanan harus bergizi, sehingga memiliki dampak positif bagi yang mengkonsumsinya. Pengertian kedua ialah baik, tidak jorok, karena jorok adalah pertimbangan lain halalnya

suatu makanan. Dahak dan air liur, misalnya, pada dasarnya adalah halal, namun jika sengaja dikumpul untuk dikonsumsi menjadi tidak boleh karena termasuk yang jorok. Pentingnya halal bagi umat Islam Ada empat pertimbangan mengapa umat Islam harus mengkonsumsi yang halal, yaitu: Pertama, pertimbangan teolo-

dengan zat yang digunakan memang semuanya halal. Atau jika diolah secara teknologi modern, harus dibuktikan dengan adanya sertifikat halal dari LP POM MUI. Jadi pertimbangannya ialah jelas kehalalannya atau tidak, bukan pada enak atau tidak. Kedua, pengusaha Muslim. Mensiasati bahwa masih dikonsum-

“You are what you eat”, Anda seperi apa yang dimakan. Jika manusia memakan haram, ia akan terbiasa dengan yang haram. gis, yaitu bagi Islam makanan menentukan bagi kehidupan umat Islam di akhirat nanti. Dalam sebuah hadits digambarkan bahwa “seseorang yang mengkonsumsi yang haram, nerakalah tempatnya di hari kiamat”. Kedua, pertimbangan kesehatan, yaitu makanan yang dikonsumsi umat Islam haruslah berdampak positif bagi kesehatan, bukan sakit. Salah satu indikator makanan sehat ialah yang halal. Ketiga, pertimbangan integritas individu, karena dalam Islam, makanan akan menentukan perilaku. Hal ini mendapat dukungan dari pandangan umum, sehingga muncul teori “you are what you eat”, Anda seperi apa yang dimakan. Jika manusia memakan haram, ia akan terbiasa dengan yang haram. Jika menyangkut hewan, seorang akan seperti hewan yang dimakan. Keempat, pertimbangan bisnis, karena mayoritas masyarakat Indonesia adalah Muslim yang menjadikan halal menjadi pertimbangan utama dalam makanan. Andai saja umat Islam hanya mengkonsumsi halal yang diproduksi pengusaha Muslim yang haqqul yaqin kehalalannya, tentu menjadi sebuah peluang bisnis. Sayangnya pangsa pasar yang besar ini hanya dimanfaatkan pengusaha non Muslim, sehingga Islam larut dalam keterpaksaan. Dalam bidang roti, misalnya, hampir tidak ada pengusaha Muslim, sehingga umat Islam terpaksa berurusan dengan merek roti tertentu yang entah siapa tukang masaknya, apakah ia bersuci atau tidak, mandi junub atau tidak, karena memang bukan menjadi standar produksi bagi pengusahanya. Apa yang harus dilakukan Jika demikian halnya, apa yang harus dilakukan. Dengan mengamati gambaran di atas, umat Islam harus mengadakan perubahan mindset. Pertama, umat Islam harus berupaya semaksimal mungkin hanya mengonsumsi jika telah jelas kehalalannya. Hal ini dibuktikan

Oleh Achyar Zein

sinya makanan haram atau diduga haram karena tidak ada pilihan lain, ini tentu menjadi PR (pekerjaan rumah) bagi para pengusaha Muslim. Para pengusaha Muslim seharusnya menjadikan kondisi ini sebagai peluang bisnis, terutama bisnis makanan. Bagaimanapun semakin meningkatkan kesadaran mengkonsumsi halal akan sangat berimbas pada semakin tingginya kebutuhkan akan jaminan halal. Apa yang ada selama ini hanya atas dasar sertifikat halal semata yang belum haqqul yaqin sepenuhnya halal, karena bisa saja pengusaha merubah unsur campuran bahan makanan ketika sudah memiliki sertfiikat halal Ketiga, legislatif. Begitu juga mensiasati bahwa masih beredarkah makanan yang tidak jelas kehalalannya karena tidak ada payung hukum yang meniscayakan pengusaha memproduksi makanan halal, maka adalah menjadi tuags para legislator agar sesegera mungkin mensahkan UU produksi halal tersebut. Dengan disahkannya UU ini diharapkan bahwa setiap produk yang dihasilkan dan dipasarkan harus mencantumkan data kehalalan, jika tidak, tidak bisa dipasarkan. Ini penting untuk melindungi umat Islam dari makanan haram. Penutup Demikian semoga muzakarah kali ini tidak hanya sekedar NATO, no action talk only, melainkan membawa perubahan baru bagi umat Islam. Maka selain ulama yang terus menerus berkoar-koar akan pentingnya yang halal, masyarakat juga harus meningkatkan kesadaran mengkonsumsinya—didukung oleh penguasa Muslim, dan para politisi kita dengan menghasilkan UU jaminan halal, sebagai tanggungjawabnya kepada masyarakat dan Tuhan. Inilah saatnya, dan umat Islam harus berubah. Akhirnya, selamat bermuzakarah, semoga sukses. Paling tidak ini sebuah pertanggungjawaban kita kepada Tuhan.

A

llah adalah pemimpin bagi orang-orang yang beriman karena Dia mengeluarkan mereka dari kegelapan (kekafiran) kepada cahaya (iman). Thaghut adalah pemimpin orang-orang yang kafir karena mengeluarkan mereka dari cahaya (iman) kepada kegelapan (kekafiran). Mereka itu adalah penghuni neraka dan ke-kal di dalamnya. (Q.S. al-Baqarah ayat 257). Ayat di atas mengisyaratkan tentang dua pola kepemimpinan yang berbeda yaitu kepemimpinan Tuhan dan kepemimpinan thaghut. Perbedaan ini dapat ditandai melalui misi masing-masing dimana kepemimpinan Tuhan pro kepada keimanan dan anti kepada kekafiran. Adapun misi dari kepemimpinan thaghut ialah pro kepada kekafiran dan anti kepada keimanan. Perbedaan berikutnya dapat pula ditandai dari status pengikut masing-masing. Orang-orang yang mengikuti kepemimpinan Tuhan disebut dengan orang-orang yang beriman. Adapun orang-orang yang mengikuti kepemimpinan thaghut disebut dengan orang-orang kafir. Kedua kelompok yang mengikuti pola kepemimpinan yang berbeda ini akan mengaplikasikannya di dalam setiap kepemimpinan mereka. Adapun dari segi konsekwensi, ayat di atas menjelaskan bahwa orang-orang yang mengikuti pola kepemimpinan thaghut akan menjadi penghuni neraka dan kekal di dalamnya. Sebaliknya, orang-orang yang mengikuti pola kepemimpinan Tuhan akan masuk surga meskipun ayat di atas tidak menyebutkannya secara literal namun dapat dipahami bahwa lawan dari masuk neraka adalah masuk surga. Thaghut menurut al-Ashfahani di dalam kitabnya al-Mufradat fi Gharib Alquran ialah orang-orang yang melampaui batas dalam melakukan perbuatan maksiat (maksiat yang mereka lakukan sudah terlalu berlebihan). Sedangkan menurut alBaghawi dalam tafsirnya Ma’alim al-Tanzil ialah semua pemimpin yang sesat disebut dengan thaghut. Di dalam Alquran disebutkan bahwa orang-orang yang berbuat maksiat adalah orang-orang yang melampaui batas sehingga

Allah membenci mereka. Jika Allah membenci orang-orang yang berbuat maksiat karena menganggap mereka telah melampaui batas maka otomatis kebencian Tuhan kepada pemimpin yang thaghut jauh lebih besar lagi

pemimpin yang thaghut. Kecenderungan ini muncul karena mereka tidak terbiasa menggunakan akal rasional secara baik dan karenanya mereka lebih tertarik kepada mistik daripada wahyu. Implikasi mistik ini menye-

Pemimpin yang thaghut tidak mau mengambil pelajaran dari cobaan Tuhan. Mereka hanya mencari “kambing hitam” guna dijadikan sasaran tuduhan. karena mereka berlebihan dalam berbuat maksiat. Ciri-ciri Pemimpin yang Thaghut Di dalam Alquran disebutkan bahwa Fir’aun adalah sosok pemimpin yang thaghut. Ciri-cirinya dapat dilihat pada ayat-ayat yang secara khusus membicarakan tentang Fir’aun. Kemudian, ciri-ciri ini dapat dijadikan sebagai indikator apakah seorang pemimpin layak dikatakan sebagai thaghut atau tidak. Salah satu ciri pemimpin yang thaghut ialah suka melampaui batas. Maksudnya, melakukan sesuatu berdasarkan hawa nafsu bukan berdasarkan aturanaturan yang ada. Oleh karena itu, setiap keputusan yang ditetapkannya selalu mengacu pada kepentingan pribadi dan golongan. Ciri lain dari pemimpin yang thaghut ialah memberangus siapa saja yang dapat mengancam kekuasaannya. Sikap ini menunjukkan bahwa pemimpin yang thaghut tidak pernah berbuat banyak untuk kepentingan rakyat karena terus-menerus dihantui oleh rasa takut sehingga selalu mengalami krisis kepercayaan diri. Krisis kepercayaan diri ini menyebabkan pemimpin yang thaghut mendustakan dan mengingkari ayat-ayat Tuhan. Hal ini disebabkan bahwa pesan ayat-ayat Tuhan selalu bertentangan dengan keinginan mereka. Oleh karena itu, pemimpin yang thaghut lebih suka membicarakan hal-hal yang bersifat mistik daripada wahyu. Kecenderungan kepada halhal yang bersifat mistik -sebagaimana disebutkan di dalam Alqur’an- adalah ciri lain dari

babkan pemimpin yang thaghut tidak mau mengambil pelajaran dari cobaan Tuhan. Mereka hanya mencari “kambing hitam” guna dijadikan sasaran tuduhan. Sebagai contoh, mereka menuduh masyarakat sebagai penyebab banjir karena membuang sampah sembarangan sedangkan pelaku illegal logging tidak pernah diseret ke meja hijau. Ketidakpedulian mereka terhadap cobaan Tuhan maka Alquran mengklaim mereka sebagai sosok yang zalim. Kezaliman ini semakin jelas ketika mereka suka membela orang yang salah karena takut bahwa kesalahannya akan terbongkar pula. Justeru itu, yang selalu dikorbankan adalah orang-orang yang lemah meskipun benar. Karena pemimpin thaghut adalah sosok yang zalim dan tidak pernah tersentuh oleh hukum maka mereka menjadi sombong. Alquran menegaskan bahwa sombong adalah sifat yang sudah mengkristal di hati pemimpin yang thaghut sehingga mereka sewenang-wenang menggunakan fasilitas negara di hadapan rakyat yang melarat. Alquran menjelaskan bahwa ciri lain dari pemimpin yang thaghut adalah berbuat sewenangwenang. Mereka melakukan apa saja meskipun menimbulkan malapetaka bagi orang lain. Kadangkadang pemimpin yang thaghut tidak segan-segan menguras harta dan asset negara demi memenuhi kebutuhan syahwat mereka. Implikasi dari sifat kesewenangan di atas maka pemimpin yang thaghut selalu melakukan penindasan terhadap rakyat. Mereka tidak memberikan hak-hak rakyat yang seharusnya dipe-

roleh. Bahkan yang terjadi adalah sebaliknya yaitu menuntut agar rakyat tetap patuh di dalam menjalankan kewajiban-kewajiban mereka. Selanjutnya Alquran menjelaskan bahwa perintah pemimpin yang thaghut adalah perintah yang tidak benar sebagai implikasi dari sifat kesewenangan. Menurut al-Khazin bahwa dimaksud dengan “perintah yang tidak benar” ialah perintah yang tidak membawa kepada kebaikan bahkan selalu menimbulkan kesulitan bagi rakyat. Untuk mewujudkan “perintah yang tidak benar” ini maka pemimpin thaghut selalu melakukan penipuan. Mereka mengelabui perbuatan jahatnya untuk mengambil simpati rakyat. Sebagai contoh, mereka tidak segan-segan mengeluarkan air mata untuk memancing simpati rakyat dan kadang-kadang tampil seperti orang suci. Dalam rangka mengeksiskan kekuasaan maka pemimpin yang thaghut suka memecah belah rakyatnya. Kelompok yang mendukungnya akan mendapat perhatian khusus sedangkan yang tidak mendukungnya akan diperlakukan dengan tidak hormat. Oleh karena itu, sulit sekali dijumpai kemakmuran yang merata bagi rakyat di suatu negara jika pemimpinnya adalah thaghut. Ciri lain dari pemimpin yang thaghut adalah berbuat kerusakan. Setiap kebijakan yang mereka lakukan selalu membawa implikasi negatif bagi kehidupan rakyat. Dengan kata lain, kepentingan rakyat tidak pernah menjadi landasan dari setiap kebijakan yang mereka perbuat. Pemimpin yang thaghut akan selalu memandang baik perbuatan yang buruk. Pandangan ini muncul karena mereka adalah bagian dari keburukan itu sendiri. Bagi mereka yang dikatakan kebenaran adalah keuntungan. Sebenar apapun sesuatu tetap saja mereka pandang buruk jika tidak menguntungkan mereka. Pemimpin yang thaghut adalah pemimpin yang sama sekali tidak memiliki sense of responsibility kepada rakyat. Tipe pemimpin yang seperti ini tidak dapat diharapkan untuk memajukan suatu bangsa karena konsep kebijakannya masih bersifat kepentingan pribadi.


Waspada, Jumat 27 Januari 2012