Issuu on Google+

Shalat Jumat Di Mana? Lihat hal. C4 Dan C8 Masjid Omar ‘Ali Saiduddien, Brunei Darussalam

WASPADA Demi Kebenaran Dan Keadilan

Berita dan foto UN lihat di halaman A4

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Pon, 19 April 2013/8 Jumadil Akhir 1434 H

Terbit 28 Halaman (A1-12, B1-8, C1-8)

No: 24197 Tahun Ke-67

Harga Eceran: Rp2.500,-


Waspada/Rudi Arman

KASAT Lantas Polresta Medan Kompol Risya Mustario menasehati seorang pelajar SMA agar temannya tidak berdiri di bak mobil terbuka agar tidak terjadi lakalantas saat razia di Jln. Bukit Barisan Medan, Kamis (18/4).

PARA pelajar SMA menyumbangkan baju seragam sekolah mereka usai melaksanakan UN hari terakhir di SMA Negeri 5 Medan, Sumut, Kamis (18/4). Sumbangan seragam tersebut sebagai bentuk kepedulian mereka kepada sesama pelajar yang mampu sekaligus mengingatkan pada pelajar lainnya agar tidak melakukan corat coret baju usai ujian nasional.

Waspada/Rudi Arman

PETUGAS Sat Lantas Polresta Medan menilang pelajar SMA yang berbonceng tiga saat razia di Jln. Bukit Barisan Medan, Kamis (18/4).

UN Ending, Siswa Happy

MEDAN (Waspada): Berakhirnya (ending) Ujian Nasional (UN), Kamis (18/4) siang, diwarnai dengan beragam aksi para siswa kelas XII SMA di Medan. Mereka happy-happy (bergembira) dengan cara mencoret seragam sekolah dengan spidol atau cat semprot. Namun tidak sedikit yang berinisiatif menyumbangkan seragamnya kepada siswa dari kalangan keluarga kurang mampu. Pantauan Waspada di sejumlah sekolah, begitu lonceng berbunyi pertanda usainya mata ujian di hari terakhir UN, ratusan siswa langsung keluar dari halaman sekolah. Mereka berkumpuldipinggiranjalandepansekolahnya. Sorak sorai dan gelak tawa mereka terdengar begitu nyaring. Satu per satu siswa SMA itu mengambil spidol dan cat semprot. Mereka bergantian membutuhkan tanda tangan di seragam temannya.

Berbagai Cara Cegah Aksi Coret Seragam

Usai melakukan aksi coret seragam di depan sekolah, sebagian siswa melakukan konvoi keliling kota menggunakan kendaraan bermotor. Ada yang duduk di atas kap mobil, ada juga yang mengendarai sepedamotor tanpa helm dan berboncengan tiga. Aksi para siswa yang melanggar peraturan lalulintas ini, langsung mendapat tindakan tegas petugas Sat Lantas Polresta Medan. Polresta Medan memberikan tindakan langsung (tilang) sedikitnya 50 pelajar SMA yang tidak memakai helm saat merayakan akhir Ujian Nasional (UN) dengan berkonvoi di sejumlah lokasi, Kamis (18/4). Bahkan petugas Polsek Pancurbatu

Lanjut ke hal A2 kol. 7

Waspada/Arianda Tanjung

BANYAK cara yang dilakukan pihak sekolah agar siswanya seusai Ujian Nasional (UN) tidak beraksi coret seragam. Salah satunya menyumbangkan seragam sekolah itu kepada para guru, selanjutnya diberikan kepada yang memerlukan. Kemudian menyediakan kain kanvas di sekolah agar siswa meluapkan kegembiraannya dengan mencoret kanvas tersebut sebagai ganti mencoret seragam. Hal lainnya dengan menjadikan seragam sebagai barter dengan surat undangan pengumuman UN dan acara Pentas Seni sekaligus kegiatan perpisahan. Inilah yang berlangsung

di SMAN 13 Medan, Kamis (18/4). Usai dibariskan di lapangan dan mendapatkan pengarahan dari Kepala Sekolah, Ilyas Halim MPd, seluruh siswa mengikuti pelaksanaan aksi coret dan tandatangan di kanvas yang sudah disiapkan pihak sekolah. Setelah itu seluruh siswa masuk kelas kembali dan bertemu wali kelasnya. Mereka memberikan seragam sekolahnya dan menukarnya dengan dua lembar undangan. Undangan pertama untuk kegiatan Pentas

Lanjut ke hal A2 kol. 7

MAUDITA Guswanda ditemani seorang pengawas harus melaksanakan UN di dalam mobil ambulans dengan kondisi patah tulang kaki kanan di halaman Yayasan Pendidikan Miftahulssalam Jl Darussalam, Kamis (18/4).

Tetap Semangat, Meski Di Ambulans SAAT ratusan siswa dengan tenang dan fokus melaksanakan Ujian Nasional (UN), suasana berbeda tampak di halaman Yayasan Pendidikan Miftahulssalam. Seorang siswa Maudita Guswanda harus melaksanakan UN di dalam mobil ambulans dengan kondisi patah tulang kaki kanan. Meski demikian, semangat dan harapan untuk lulus tampak jelas terlihat dari raut wajahnya. “Kakiku patah tapi semangatku nggak bang,”ujar siswa SMK TI Darusalam ini.

Lanjut ke hal A2 kol. 6


PETUGAS pemadam kebakaran melakukan pencarian dan penyelamatan dari kompleks apartemen yang hancur akibat ledakan di sebuah pabrik pupuk di Barat, Texas, Kamis, (18/4).

karena para awak penyelamat belum dapat jalan menuju kawasan yang paling rusak di pabrik pupukWest Fertilizer dan sekitarnya. “Banyak rumah yang rata dengan tanah. Banyak pula gedung-gedung bisnis yang runtuh dan rata dengan tanah,” kata PolisiWaco Sersan Patrick Swanton dalam satu briefing persnya Kamis pagi. “Kerusakan berat terjadi di kawasan bisnis kota West.”

BOSTON, Massachussets (Waspada): Pihak penyelidik Amerika Serikat kini memburu dua orang yang dianggap sebagai tersangka potensial pengebom Boston. FBI pun menyebar foto dari kedua tersangka, khusus hanya untuk para penyelidik. “FBI tidak menyebar foto dari tersangka kepada publik,” ujar seorang petugas berwenang AS seperti dikutip Fox News, Kamis (18/4). Fox menambahkan, seorang reporter mereka berhasil melihat foto itu dan menyebut mereka dengan jelas. Menurut reporter Fox News itu, satu tersangka memiliki tas ransel yang cocok dengan tas digunakan dalam serangan. Sementara tersangka kedua juga memiliki tas ransel tersebut. Pihak petugas berwenang AS itu juga meminta Fox untuk tidak memuat gambar pelaku ke muka publik. Dirinya khawatir bila foto tersangka disebar, maka akan merusak upaya penyelidikan. Di tempat terpisah, seorang politisi Boston menyatakan pihak penyelidik saat ini mencari seorang pria yang terlihat di sebuah pusat perbelanjaan. Pria itu tampak meletakan sebuah kantung di lokasi ledakan yang letaknya tidak jauh dari garis finish lomba lari maraton Boston. Namun pihak berwenang AS masih belum mengetahui para tersangka ini. Tidak diketahui pula apakah tersangka-tersangka

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 3

Ledakan Besar Seperti Bom Di Texas, 15 Orang Tewas WACO, Texas (Waspada): Satu ledakan keras terjadi di pabrik pupuk di Texas Tengah Rabu (17/4) malam yang menurutWalikotaWest Tommy Muska yang dikutip CNN Kamis (18/4) bahwa kekuatannya setara dengan ledakan bom nuklir. “Ini seperti ledakan bom nuklir,” ujar Walikota Tommy Muska. Ledakan itu mengakibatkan 5 sampai 15 orang diperkirakan tewas dan lebih dari 160 lainnya cedera, demikian menurut sejumlah pejabat, termasuk

para anggota pemadam kebakaran yang berjuang untuk memadamkan api yang memicu ledakan. Gambar bola api raksasa yang menghancurkan kota kecil West, 25 km sebelah utaraWaco, sangat menggelegar, yang terjadi hanya dua hari setelah pengeboman yang menewaskan tiga orang dan 183 lainnya di garis finish Boston Marathon. Pihak berwajib menegaskan bahwa perkiraan berapa banyak korban yang tewas dalam ledakan itu masih terlalu pagi,

FBI Buru Dua Pengebom Boston

Konsul AS Kunjungi Waspada

Anak Sumut Boleh Belajar Di MIS MEDAN (Waspada): Medan International School atau MIS yang selama ini diperuntukkan bagi siswa warga negara asing dan anak diplomat, kini terbuka untuk anak-anak Indonesia khususnya yang berdomisili di wilayah Sumatera Utara. “Dengan kebijakan baru ini, kalangan orangtua tidak lagi mesti jauh-jauh menyekolahkan putra-putri mereka ke Singapura, Malaysia atau negara-negara lain dengan biaya mahal, tetapi sudah cukup di

Medan karena sudah tersedia lembaga pendidikan sejenis dengan standar dan kualitas yang benar-benar internasional atau dunia,” kata Konsul Amerika Serikat di Medan Madam Kathryn T.Crockart pada pertemuan ramah tamah dengan Pemimpin Umum Harian Waspada dr.Hj.Rayati Syafrin di Gedung Bumi Warta Harian Waspada Jl.Letjen Suprapto No.1 Medan, Kamis (18/4). Turut mendampingi Konsul AS itu adalah Kepala Sekolah

(Principal) Medan International School Mr.Matthew Gaetano dan Pembina Mrs.Victoria James serta Djasamen Saragih. Sementara mendampingi Rayati Syafrin adalah Wakil Penanggungjawab H.Sofyan Harahap, Kepala Humas H. Erwan Effendi, Redaktur Opini Dedi Sahputra, Redaktur Luar Negeri H Muhammad Joni dan Humas Hubungan Luar Negeri Aidi Yursal.

Lanjut ke hal A2 kol. 3

Ada-ada Saja

Al Bayan

Mu’az Bin Afra’

Ditangkap Karena Terlalu Tampan

Oleh Tgk. H. Ameer Hamzah MU’AZ BIN AFRA’ adalah salah seorang sahabat Rasulullah yang ikut dalam perang Badar dan perang-perang setelah itu. Ialah yang turut melibas leher Abu Jahal. Dua anak lelakinya juga syahid dalam perang yang menentukan kenenangan Islam itu. Mu’az sebenarnya orang kaya, tetapi setelah dia mendalami ayat-ayat Alquran tentang besarnya fahala beramal shaleh dan berinfak, ia menghabiskan hartanya di jalan Allah SWT. Imam Ibnu Jauzi dalam kitabnya Shifatush Shafwah menulis; Mu’az termasuk salah seorang shahabat yang paling pemurah. Ia tidak menyisakan rezekinya untuk hari esok. Tiap hari dia bekerja mencari rezeki, tiap hari juga bersedekah untuk orang-orang miskin. Dia tidak bisa tidur tanpa membantu kaum dzuafa. Istrinya bercerita kepada saudara laki-lakinya. “ Wahai saudaraku Abdullah! Suamiku sangat boros membelanjakan harta, tidak pernah menyisakan rezeki untuk hari esok,”. Abdullah berjanji akan menyarankan adik iparnya supaya hidup hemat. Lanjut ke hal A2 kol. 2

Waspada/Surya Efendi

PRINCIPAL Medan International School, Matthew Gaetano didampingi Konjen AS di Medan Kathryn T Crockart (kiri) menerima cinderamata dari Pemimpin Umum Harian Waspada dr Hj Rayati Syafrin di Bumi Warta Harian Waspada Medan, Kamis (18/4).

GARA-gara memiliki wajah yang dinilai terlalu tampan, tiga pria ini ditangkap polisi dan dideportasi ke negara mereka. Insiden unik ini terjadi saat berlangsungnya acara festival kebudayaan Timur Tengah yang digelar di kota

Lanjut ke hal A2 kol. 2 Waspada/ist

MENTERI LH Balthasar Kambuaya foto bersama dengan Praktisi Lingkungan Sumut Dewi Budiati TJ. Said (dua dari kiri), Prof. Dr. Hidayati (kiri) dan DR. Dra. Ivan Elizabeth Purba, MKes (kanan) di Jakarta.

Menteri LH Dukung Deklarasi APPEL Sumut JAKARTA (Waspada): Menteri Lingkungan Hidup (LH) Balthasar Kambuaya mendukung dan memberi perhatian atas kebulatan tekad kaum perempuan Sumut yang akan menggelar acara deklarasi Aku

Perempuan Peduli Lingkungan (APPEL). Demikian disampaikan Menteri LH saat menerima Praktisi Lingkungan Sumut Dewi Budiati TJ. Said dan beberapa tokoh Lanjut ke hal A2 kol. 3

Serampang - Bolehla setahun sekali happy...! - He...he...he...

Siapa Khatib Shalat Jumat Anda ? Lihat Hal. C4-C8

WASPADA Demi Kebenaran Dan Keadilan

JUMAT, Pon, 19 April 2013/8 Jumadil Akhir 1434 H z zNo: 24197 * Tahun Ke-67

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Pengumuman UN Di Aceh 25 Mei BANDA ACEH (Waspada): Pengumuman hasil Ujian Nasional (UN) tahun 2013 dan kelulusan jenjang pendidikan SMA, MA, SMK, SMALB, Paket C dan Paket C Kejuruan akan diumumkan serentak di sekolah masing-masing pada 25 Mei 2013 mendatang. “UN untuk jenjang pendidikan SMA, MA, SMK, SMALB dan Paket C sudah selesai dan kelulusannya diumumkan 25 Mei mendatang,” ujar Laisani, Ketua Panitia UN Aceh 2013 menjawab Waspada, Kamis (18/4) di Banda Aceh. Lanjut ke hal A2 kol 3

Tak Habis Akal Mencegah Aksi Coret Seragam Waspada/Dede Juliadi

SISWA SMKN 2 Langsa di hari terakhir UN melakukan aksi coret baju sebagai ungkapan kegembiraan telah melewati ujian di sekolahnya. Mereka melakukan konvoi di kawasan Lapangan Merdeka Langsa, Kamis (18/4).

BANYAK cara yang dilakukan pihak sekolah agar siswanya seusai Ujian Nasional (UN) tidak beraksi coret seragam. Salah satunya menyumbangkan seragam sekolah itu kepada para guru, selanjutnya diberikan kepada yang memerlukan. Kemudian menyediakan kain kanvas di sekolah agar siswa meluapkan kegembiraannya dengan mencoret kanvas tersebut sebagai ganti mencoret seragam. Lanjut ke hal A2 kol 6

Waspada/Rudi Arman

KASAT Lantas Polresta Medan Kompol Risya Mustario menasehati seorang pelajar SMA agar temannya tidak berdiri di bak mobil terbuka agar tidak terjadi lakalantas saat razia di Jln. Bukit Barisan Medan, Kamis (18/4).

Pesta UN, Pelajar Ditilang

FBI Buru Dua Pengebom Boston BOSTON, Massachussets (Waspada): Pihak penyelidik Amerika Serikat kini memburu dua orang yang dianggap sebagai tersangka potensial pengebom Boston. FBI pun menyebar foto dari kedua tersangka, khusus hanya untuk para penyelidik. “FBI tidak menyebar foto dari tersangka kepada publik,” ujar seorang petugas berwenang AS seperti dikutip Fox News, Kamis (18/4). Fox menambahkan, seorang reporter

mereka berhasil melihat foto itu dan menyebut mereka dengan jelas. Menurut reporter Fox News itu, satu tersangka memiliki tas ransel yang cocok dengan tas digunakan dalam serangan. Sementara tersangka kedua juga memiliki tas ransel tersebut. Pihak petugas berwenang AS itu juga meminta Fox untuk tidak memuat gambar pelaku ke muka publik. Dirinya khawatir bila foto tersangka disebar, maka akan merusak

upaya penyelidikan. Di tempat terpisah, seorang politisi Boston menyatakan pihak penyelidik saat ini mencari seorang pria yang terlihat di sebuah pusat perbelanjaan. Pria itu tampak meletakan sebuah kantung di lokasi ledakan yang letaknya tidak jauh dari garis finish lomba lari maraton Boston. Namun pihak berwenang AS masih belum mengetahui

MEDAN (Waspada): Polresta Medan menindak langsung (tilang) sedikitnya 50 pelajar SMA yang tidak memakai helm saat merayakan akhir Ujian Nasional (UN) dengan berkonvoi di sejumlah lokasi, Kamis (18/4). Bahkan petugas Polsek Pancurbatu mengamankan 12 sepeda motor tanpa dilengkapi surat-surat dan menahan seorang siswa saat berkonvoi ke Sibolangit. Begitu juga Polsek Delitua menilang 17 sepeda motor. Untuk pelajar yang sempat ditahan di Polsek Pancurbatu berinisial S,18, warga Jalan Mabar berikut seorang sopir angkutan umum berinisial E,34, warga Jln Yos Sudarso ke Mapolsek Pancurbatu. Informasi diterima wartawan, pelajar dan sopir tersebut diamankan setelah petugas menemukan benda yang dicurigai Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 7

UN Kacau, Mendikbud Salahkan Percetakan JAKARTA (Waspada): Menteri pendidikan dan Kebudayaan Mohammad Nuh menyebut penyebab karut marut pelaksanaan Ujian Nasional adalah percetakan pemenang tender naskah soal, yang tak lain adalah PT Ghalia Printing. Nuh, Kamis (18/4), membantah minimnya perencanaan dan persiapan Kemendikbud menjadi akar persoalan kekacauan UN. “Saya juga heran karena apa, sebenarnya kalau dicari

akarnya yaitu adalah di percetakan itu. Bukan (Kemendikbud), karena wong yang lima (percetakan) itu oke kok. Dari enam itu, satu yang tidak bisa penuhi janjinya,” kata M Nuh saat ditemui di acara bertajuk “Indonesian Young Leader Forum II 2013” yang diselenggarakan Himpunan Pengusaha Muda Indonesia (Hipmi) di Jakarta. Mengenai kemungkinan kelalaian yang dilakukan pejabat Kemendikbud, menurut

Nuh, saat ini investigasi tengah dilakukan oleh tim yang dipimpin oleh Irjen Kemendikbud. Targetnya, investigasi ini selesai dalam waktu satu minggu lagi. “Setelah ujian SMP ini selesai, semuanya akan terang. Mulai dari sisi proses pengadaan, pelelangan atau tendernya, dari sisi pelaksanaan dan di percetakan,” ujar dia. Dalam investigasi tersebut, Lanjut ke hal A2 kol 1

MUI Medan Soal Rohingya:

Putuskan Hubungan Diplomatik Dengan Myanmar MEDAN (Waspada): Penganiayaan dan pembunuhan Muslim Rohingya oleh penguasa Myanmar mengundang reaksi dari berbagai elemen umat Islam. Majelis Ulama Indonesia (MUI) Kota Medan mendesak pemerintah Indonesia berperan melancarkan diplomasi, atau bertindak melakukan pemutusan hubungan diplomatik dengan Myamnar. “Kita tidak ingin penderitaan Muslim Rohingya ini menjadi persoalan dunia yaitu konflik antar umat beragama. Kita minta pemerintah untuk memberi peringatan keras kepada Myanmar, kalau perlu putuskan hubungan diplomatik,” tegas Ketua MUI Kota Medan Prof Mohd.Hatta, Kamis (18/4). Lanjut ke hal A2 kol 6

Waspada/Surya Efendi


PABRIK pupuk yang meledak dekat Waco, Texas, mengakibatkan banyak korban tewas dan cedera Rabu (17/4) malam.

KONJEN AS di Medan Kathryn T Crockart disambut Pemimpin Umum Harian Waspada dr Hj Rayati Syafrin ketika mengunjungi Bumi Warta Harian Waspada Medan, Kamis (18/4).

Ledakan Besar Di Pabrik Pupuk Di Texas, 15 Tewas

Konsul AS Kunjungi Waspada

WACO, Texas (Waspada): Satu ledakan keras terjadi di pabrik pupuk di Texas Tengah Rabu (17/4) malam yang mengakibatkan 15 orang diperkirakan tewas dan lebih dari 160 lainnya cedera, demikian menurut sejumlah pejabat, termasuk para anggota pemadam kebakaran yang berjuang untuk memadamkan api yang memicu ledakan. Gambar bola api raksasa yang menghancurkan kota kecil West, 25 km sebelah utara

Waco, sangat menggelegar, yang terjadi hanya dua hari setelah pengeboman yang menewaskan tiga orang dan 183 lainnya di garis finish Boston Marathon. Pihak berwajib menegaskan bahwa perkiraan berapa banyak korban yang tewas dalam ledakan itu masih terlalu pagi, karena para awak penyelamat belum dapat jalan menuju kawasan yang paling rusak di pabrik pupuk West Fertilizer dan sekitarnya.

Al Bayan

Mu’az bin Afra’ Oleh: H. Ameer Hamzah MU’AZ BIN AFRA’ adalah salah seorang shahabat Rasulullah yang ikut dalam perang Badar dan perangperang setelah itu. Ialah yang turut melibas leher Abu Jahal. Dua anak lelakinya juga syahid dalam perang yang menentukan kenenangan Islam itu. Mu’az sebenarnya orang kaya, tetapi setelah dia mendalami ayat-ayat Alquran tentang besarnya fahala beramal shaleh dan berinfak, ia menghabiskan hartanya di jalan Allah SWT. Imam Ibnu Jauzi dalam kitabnya Shifatush Shafwah menulis; Mu’az termasuk salah seorang shahabat yang paling pemurah. Ia tidak menyisakan rezekinya untuk hari esok. Tiap hari dia bekerja mencari rezeki, tiap hari juga bersedekah untuk orang-orang miskin. Dia tidak bisa tidur tanpa membantu kaum dzuafa. Istrinya bercerita kepada saudara laki-lakinya. “ Wahai saudaraku Abdullah! Suamiku sangat boros membelanjakan harta, Lanjut ke hal A2 kol 2

“Banyak rumah yang rata dengan tanah. Banyak pula gedung-gedung bisnis yang runtuh dan rata dengan tanah,” kata Polisi Waco Sersan Patrick Swanton dalam satu briefing persnya Kamis (18/4) pagi. “Kerusakan berat terjadi di kawasan bisnis kota West.” Terasa hingga 14 km Para petugas medis dan pemadam kebakaran masih menyisir lokasi ledakan pabrik Lanjut ke hal A2 kol 1

Anak Sumut Boleh Belajar Di MIS Antara

VONIS SUAP HAKIM. Hakim ad hoc nonaktif Pengadilan Tipikor Semarang, Kartini Julianna Magdalena Marpaung (tengah), yang didakwa terlibat dalam kasus suap hakim pengadilan Tipikor Semarang bersama penasehat hukumnya berjalan meninggalkan ruang sidang, seusai mengikuti sidang dengan agenda pembacaan vonis, di Pengadilan Tipikor Semarang, Jateng, Kamis (18/4). Majelis hakim memvonis Kartini Julianna Magdalena Marpaung dengan hukuman delapan tahun penjara dan denda Rp500 juta subsider lima bulan penjara karena dinilai terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana korupsi secara bersama-sama.

Mahfud MD: Banyak Pejabat Ditawari Seks JAKARTA ( Waspada): Mantan Ketua Mahkamah Konstitusi (MK) Mahfud MD (foto) mengatakan, kasus gratifikasi seksual yang diterima Wakil Ketua Pengadilan Negeri Bandung Setyabudi Tedjocahyono tidak hanya terjadi di kalangan hakim. Pejabat negara lain juga banyak ditawari gratifikasi seks. Maksud gratifikasi seks ini tentu saja untuk menyukseskan kepentingan pemberi gratifikasi yang mem-butuhkan jabatan para pejabat tersebut. “Banyak pejabat yang ditawari gratifikasi seksual. Bahkan, ada pejabat yang takut menindak suatu hal ketika ia ditelepon perempuan nakal yang berelasi dengan dirinya. Semacam teror,” kata Mahfud se-

usai menjadi pembicara pada acara Indonesia Broadcastin Expo di Balai Kartini, Jakarta, Kamis (18/4). Mahfud menambahkan, menurut hukum, setiap orang yang terima gratifikasi, asal melapor dan tidak berpengaruh dengan jabatan dan pekerjaan, tidak ada masalah. “Akan sulit menjadikan seks sebagai tindak pidana suap dan gratifikasi. Di hukum pidana, ini masuk delik ringan,” kata Mahfud. Pada Jumat (22/3) lalu, KPK menangkap tangan Setyabudi. KPK juga menemukan uang sebesar Rp 500 juta di mobil yang digunakan Asep Triana, orang dekat Toto Lanjut ke hal A2 kol 2

MEDAN (Waspada): Medan International School atau MIS yang selama ini diperuntukkan bagi siswa warga negara asing, kini terbuka untuk anak-anak Indonesia khususnya yang berdomisili di wilayah Sumatera Utara. “Dengan kebijakan baru ini, kalangan orangtua tidak lagi mesti jauh-jauh menyekolahkan putra-putri mereka ke Singapura, Malaysia atau negara-negara lain dengan biaya mahal, tetapi sudah cukup di

Medan karena sudah tersedia lembaga pendidikan sejenis kualitas internasional,” kata Konsul Amerika Serikat di Me d a n Ma d a m K a t h r y n T. C r o c k a r t p a d a s u a t u pertemuan ramah tamah dengan Pemimpin Umum Harian Waspada dr.Hj. Rayati Syafrin di Gedung Bumi Warta Harian Waspada Jl.Letjen Suprapto No.1 Medan, Kamis (18/4). Tu r u t m e n d a m p i n g i Konsul AS itu adalah Kepala

Sekolah (Principal) Medan International School Mr.Matthew Gaetano dan Pembina Mrs.Victoria James serta Djasamen Saragih. Sementara mendampingi Rayati Syafrin adalah Wakil Penanggungjawab H.Sofyan Harahap, Kepala Humas H.Erwan Effendi, Redaktur Opini Dedi Sahputra, Redaktur Internasional H. Muhmmad Jhoni dan Humas Hubungan Lanjut ke hal A2 kol 2

Ada-ada Saja

Ditangkap Polisi Karena Terlalu Tampan

GARA-gara memiliki wajah yang dinilai terlalu tampan, tiga pria ini ditangkap polisi dan dideportasi ke negara mereka. Insiden unik ini terjadi saat berlangsungnya acara festival kebudayaan Timur Tengah yang digelar di kota

Lanjut ke hal A2 kol 5

Serampang - Corat...coret corat...coret hobi anak sekarang - He.... he....he....

Berita Utama

A2 Pesta UN ....

sering digunakan untuk mengonsumsi narkoba yakni satu buah pipet dan satu benda karet di dalam angkot tersebut. Namun setelah diproses petugas, pelajar dan sopir itu dipulangkan karena tidak terbukti menyimpan narkoba dan tidak terindikasi sebagai penggunanya. “Razia ini perintah Kapolresta Medan,” kata Kasat Lantas Kompol Risya Mustario di Jln. Bukit Barisan Medan, kemarin. Beberapa titik razia itu sengaja digelar oleh Polantas sebagai lintasan konvoi para pelajar dan mengganggu lalu lintas di antaranya di Jln. Ayahanda, Jln. Gatot Subroto depan PRSU, Jln. Ringroad Sunggal, Jln. Jamin Ginting, Jln. Bukit Barisan dan simpang Titikuning. Risya didampingi Kanit Laka AKP Eko Hartanto menjelaskan, selain jajaran Sat Lantas Polresta Medan, Unit Lantas masingmasing Polsek juga melakukan razia yang sama. “Untuk satu hari ini saja data yang masuk atau hasil tilang sudah 50 pengendara/pelajar SMA yang ditilang. Dari jumlah tersebut 10 unit sepedamotor yang tidak ada kelengkapan suratsurat kita boyong ke Sat Lantas Polresta Medan,” jelasnya. Menurut Risya, razia khusus pelajar SMA usai UN ini digelar agar para pelajar yang mengendarai sepedamotor maupun mobil tidak ugal-ugalan di jalan sehingga bisa membahayakan pengendara lainnya. Bahkan Kasat Lantas Kompol Risya Mustario juga sempat menghentikan mobil bak terbuka dinaiki para pelajar yang berdiri di belakang. Setelah diberhentikan, Risya memberikan nasihat agar yang berdiri itu duduk saja sehingga tidak mengundang bahaya. Sedangkan Kanit Laka AKP Edo Hartanto yang sebelumnya memimpin razia di kawasan Ringroad Sunggal juga mengimbau kepada para pelajar yang menaiki mobil bak terbuka supaya tidak berdiri. Hal ini dilakukan karena para pelajar yang berdiri di mobil bak terbuka cukup membahayakan karena bisa saja terjatuh saat pengendaranya ugal-ugalan. Pantauan Waspada di lokasi razia Jln. Bukit Barisan Medan, sejumlah konvoi kendaraan sepedamotor yang dinaiki para pelajar SMA yang bajunya sudah dicoret-coret, terlihat mengalihkan jalan ke Jln. Balai Kota tidak jadi masuk ke Jln. Bukit Barisan setelah melihat ada petugas Sat Lantas Polresta Medan melakukan razia. Bahkan petugas Sat Lantas Polresta Medan terpaksa meminta pengendara mobil yang kebanyakan dinaiki para pelajar SMA agar tidak parkir di seputaran Lapangan Merdeka Medan supaya tidak terjadi kemacatan. Kapolsek Pancurbatu Kompol Darwin Sitepu PB didampingi Kanit Lantas Pancurbatu AKP Edward mengatakan,12 sepeda motor yang ditahan masih diproses. Sementara Kapolse Delitua Kompol B Marpaung melalui Kanit Lantas Delitua AKP M Syafii mengatakan dua dari 17 sepeda motor milik pelajar yang ditilang di Jln Brigjen Zein Hamid simpang Titi Kuning Medan terpaksa ditahan. (m36/m36/m40)

UN Kacau ....

lumnya, maka PT Ghalia hanya dipercaya mencetak untuk 1 provinsi saja, yakni di Bali. Keputusan ini diambil Kemendikbud tiga hari lalu. Pemenang tender lainnya, yaitu PT Pura di Kudus, PT Temprina di Surabaya, PT Jaswindo di Sidoarjo, ditunjuk untuk mencetak soal UN SMP. “Alhamdulillah progressnya sudah bagus, sudah selesai, sekarang mulai dikirim. PT Ghalia hanya mengambil yang paling mudah yaitu untuk Bali saja yang jumlahnya 59 ribu,” kata Nuh. (vn)

Ledakan Besar ....

capai 60-70 orang. Ini masih hitungan kasar, kami belum dapat jumlah pasti,” kata Smith. Kamis dini hari waktu setempat, pemadam masih menyisir rumah-rumah yang runtuh, mencari korban. Hingga saat ini belum diketahui pasti penyebab ledakan tersebut. (wp/cnn/vn/m10)

kata Nuh, juga didalami beberapa masalah terkait kinerja PT Ghalia yang mencetak naskah soal UN dengan kertas yang tidak berkualitas. Apabila terbukti tidak sesuai dengan perjanjian kontrak tender, maka perusahaan percetakan itu akan dijatuhi sanksi. “Sanksinya tergantung dari tingkat atau derajat kelalaian atau kesalahannya,” tuturnya. PT Ghalia Printing juga mendapatkan tender mencetak naskah soal UN tingkat SMP. Namun, Nuh mengatakan karena kesalahan sebe-

pupuk di kota West itu. CNN memperkirakan korban tewas mencapai hingga 70 orang. Diberitakan CNN, ledakan Rabu malam tersebut terasa hingga jarak lebih dari 14 km dari lokasi kejadian. Penghitungan pasti korban tewas dan luka akan dilakukan pada Kamis pagi, saat hari mulai terang. Sejauh ini korban diidentifikasi baru dua orang. Puluhan rumah runtuh, termasuk sebuah panti jompo. Sebanyak 2.800 orang mengungsi. Menurut USGS, getaran ledakan setara dengan gempa berkekuatan 2,1 skala Richter. Direktur medis di kota tersebut, George Smith, mengatakan bahwa korban tewas diduga mencapai puluhan. “Petugas pemadam kebakaran menduga korban tewas men-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Gf4. (Jika 1. ...., GxGf4. 2. g7 promosi tak terbendung). 1. ......, Gf8. 2. Ge5, Re7. 3. GxKe6, RxG. 4. g7, Gxg7. 5. GxG. Putih menang. Jawaban TTS: TTS Topik

Mimbar Jumat

Anak Sumut ....

Luar Negeri Aidi Yursal. Menurut Kathryn, MIS yang didirikan sekitar tahun 1969 oleh pihak Konsulat AS dan Inggris di Medan hanya diperuntukkan sebagai lembaga pendidikan untuk mendidik anak-anak para diplomat dan pengusaha dari kedua negara itu, namun kemudian berkembang untuk mendidik anak-anak diplomat dari berbagai negara Eropa, Amerika dan Australia. Tenaga pengajar pun, kata Kathryn yang juga duduk sebagai ketua pembina di sekolah international itu, umumnya didatangkan dari Amerika dan Eropa yang khusus bekerja sebagai guru. Dan dia mengakui sekolah ini dulunya tidak diperuntukkan bagi anak-anak Indonesia, termasuk anakanak Medan karena ada peraturan yang membatasi. Namun, lanjut Kathryn, sekarang sudah ada kebijakan baru dari

Mahfud MD ....

Hutagalung (tersangka kasus korupsi dana bantuan sosial tahun 2009 dan 2010). Setyabudi adalah ketua majelis hakim kasus tersebut. Pengacara Toto, Johnson Siregar, mengakui bahwa Setyabudi kerap minta diberikan perempuan. Biasanya, Setyabudi memintanya pada Kamis atau Jumat. (kcm/m09)

Albayan ....

Jawaban Sudoku:

6 9 3 7 4 5 2 8 1

7 5 2 1 3 8 6 4 9

1 4 8 6 2 9 7 5 3

9 1 4 8 7 3 5 6 2

3 2 6 5 1 4 8 9 7

8 7 5 9 6 2 1 3 4

5 8 7 4 9 1 3 2 6

4 3 1 2 8 6 9 7 5

2 6 9 3 5 7 4 1 8

tidak pernah menyisakan rezeki untuk hari esok,”. Abdullah berjanji akan menyarankan adik iparnya supaya hidup hemat. Usai shalat jamaah di Masjid Nabawi, Abdullah menemui Mua’az bin Afra’. “Wahai adik iparku. Istrimu mengaduk padaku, bahwa kalian hidup dalam keadaan miskin. Semua itu karena kamu sangat boros. Wahai Mu’az, hidup hematlah kamu demi masa depan keluargamu dan anak-anakmu,” ujar Abdullah abang isteri Mu’az. Mua’z menjawab, “Aku tidak merasa miskin Allah selalu memberiku rezeki dan kesehatan. Aku belum bisa tidur nyenyak sebelum memberi

WASPADA Jumat 19 April 2013

Menteri LH Dukung Deklarasi Appel Sumut JAKARTA (Waspada): Menteri Lingkungan Hidup (LH) Balthasar Kambuaya mendukung penuh dan akan memberi perhatian atas kebulatan tekad kaum perempuan Sumut yang akan menggelar acara deklarasi Aku Perempuan Peduli Lingkungan (Appel). Demikian disampaikan Menteri saat menerima Praktisi Lingkungan Dewi Budiati Tj.Said dan beberapa tokoh perempuan Sumut di antaranya Prof Dr Hidayati, Dra Dr Ivan Elizabeth Purba, Khiozzy di ruang kerjanya di Jalan Di Panjaitan Jakarta, kemarin. Balthasar mengatakan, perempuan adalah komunitas yang tepat untuk dibekali pembekalan terkait lingkungan, apabila seorang perempuan atau ibu faham soal lingkungan maka dapat memberikan pendidikan lingkungan kepada setiap anggota rumah sekaligus memberikan pendidikan lingkungan sejak usia dini pada anak. Untuk alasan itu, saya sangat senang dan mendukung penuh kebulatan tekat perempuan-perempuan Sumut ini pada deklarasi Appel Sumut. “Kalau bisa, jangan sekadar deklarasi tapi selanjutnya dapat membentuk struktur kepengurusan sehingga kelak appel ini menjadi sebuah Wa-

dah Perempuan Peduli Lingkungan yang ikut memberikan kontribusi pemikiran dan bakti perempuan terhadap lingkungan,” ujar Kambuaya yang didampingi dua orang deputy kementerian lingkungan hidup. Seperti diberitakan sebelumnya bahwa Waspada Green Club akan menggelar acara Dekarasi Aku Perempuan Peduli Lingkungan untuk memperingati hari Kartini 21 April dan sekaligus memperingati hari Bumi 22 April di lapangan Ahmad Yani Medan. Acara ini digagas Dewi Budiati Teruna Jasa Said yang dikenal sebagai sosok perempuan peduli lingkungan yang juga ketua bidang pemberdayaan sumber manusia Waspada Green Club dan Ketua Ikatan Keluarga Wartawan Indonesia (IKWI) Sumut. Dalam keterangannya Dewi mengatakan, saat ini permasalahan lingkungan semakin kompleks, sehingga diperlukan banyak tangan dan banyak komunitas yang digugah untuk membangun kesadaran sekaligus melakukan upaya memperpanjang umur bumi, semua orang dapat melakukan tindakan pencegahan apa lagi ibu-ibu rumah tangga. Seorang ibu adalah orang yang paling penting diberi pe-

nyuluhan pembekalan terkait lingkungan karena umumnya ibu mampu membuat peraturan yang dipatuhi anggota keluarga, misalnya menganjurkan setiap anggota rumah menghemat listrik, hemat air serta tak membuang sampah ke sungai. Hal-hal kecil terkait rutinitas/aktivitas kebanyakan perempuan sangat berkaitan dengan lingkungan. Apa lagi kalau setiap perempuan dapat menghijaukan tiap jengkal tanah di lahan hunian dengan aneka jenis tanaman, dapat dibayangkan hijaunya Indonesia, ujar Dewi bersemangat. Seperti di ketahui, Dewi Budiati sebelumnya mendirikan Komunitas Pemuda Peduli Lingkungan yang dikenal dengan KOPPLING kota Medan dimana pembinaannya saat ini diserahkan Dewi pada Pemko Medan. Saat ditanya apabila kelak Appel ini menjadi sebuah lembaga (ormas wanita) apakah anda yang akan jadi ketuanya..?. Dewi dengan tegas mengatakan tidak. “Saya tidak pernah punya minat jadi ketua ini itu,saya lebih nyaman menjadi relawan seperti apa yang saya lakukan selama ini, mengenai struktur organisasi tentunya saya akan urung rembuk dengan banyak tokoh wanita lain,” ujarnya. (rel)

Sedangkan UN susulan bagi peserta SMA, MA, SMALB dan SMK yang tidak bisa ikut pada tahap pertama dengan alasan tertentu, akan dilaksanakan pada 22 - 25 April 2013. “Khusus untuk Paket C, UN tahap dua dilaksanakan pada 1-4 Juli 2013.” Sementara itu, distribusi naskah UN 2013 untuk jenjang pendidikan SMP, MTs, SMPLB sudah tiba dikabupaten/kota seluruh Aceh. UN untuk jenjang ini akan dilaksanakan pada 22 - 25 April 2013. “Naskah soalnya sudak kita distribusi sejak kemarin,” tuturnya. Laisani mencontohkan Kabupaten Aceh Jaya melaporkan adanya kekurangan naskah UN 2013 untuk SMP, MTs dan SMPLB di daerah itu. “Kemarin kita terima laporan dan kita cek, ternyata bungkusan Aceh Jaya ada yang terselip ke dalam kantong Aceh Timur,” ungkapnya. Jadi, katanya, bungkusan A c e h Ja y a i t u l a n g s u n g dikembalikan dari Aceh Timur dan digudangkan di Banda Aceh sebelum diteruskan ke

Pengumuman UN ....

Aceh Jaya. “Kita juga antisipasi banjir yang bisa menghambat distribusi naskah UN terutama ke pantai barat-selatan Aceh,” tandasnya Kepsek Tak Berani Jamin Kelulusan Siswa Berbeda dengan tahun sebelumnya setiap sekolah memiliki target untuk kelulusan siswa yang mengikuti Ujian Nasional (UN), pada tahun ini Kepala Sekolah tidak berani memberikan jaminan. Nazwir Kepala SMAN 1 Singkil yang ditemui Waspada, Kamis (18/4) di Singkil mengaku kecut bahkan tidak berani menjamin kelulusan. Menurutnya lulus tidaknya para siswa yang mengikuti UN lebih ditentukan oleh para siswa itu sendiri. Hal ini karena sistem soal ujian yang diberikan kepada siswa jauh berbeda dengan soal ujian tahun sebelumnya. Kalau dulu soal yang diberikan semua sama sehingga para siswa sangat mudah untuk memahami , bahkan kita mampu memberikan target kelulusan. Di Subulussalam Lancar Empat hari pelaksanaan

pihak Amerika Serikat yang memperbolehkan anak-anak Indonesia termasuk di Medan belajar di sekolah ini. Menurut Kathryn, saat ini siswanya hanya sekitar 50 orang namun fasilitas sekolah terlengkap dibandingkan sekolah-sekolah negeri dan swasta di Indonesia. Konsul AS itu juga mengaku bentuk bangunan sekolah tidak bertingkat tapi asri sehingga membuat tenang dan nyaman para siswa belajar di dalamnya. Demikian pula mutunya, jelas sudah berstandar dan berkualitas dunia sehingga para lulusan tingkat SMA umpamanya tidak sulit lagi, melanjutkan ke berbagai perguruan tinggi di Amerika, Australia dan Eropa karena standar kualitas pendidikan yang sudah diakui dengan bukti bukti langsung. “Guru dalam setiap kelas terdiri dua orang, satu orang asing dan satu lagi orang Indonesia. Khusus guru dari negara asing rata-rata sudah mengantongi predikat S-2,” katanya dengan membandingkan mana ada di Indonesia khususnya kota Medan guru TK atau setingkat SD diajar oleh rata-rata guru bersertifikat S2. Dia juga mengaku biaya uang sekolah jauh lebih tinggi dibanding uang sekolah negeri atau sekolah swasta di Medan. Namun dibandingkan dengan

Jakarta, Surabaya, Ujung Pandang dan Bali, apalagi dengan Singapura dan Malaysia, Medan tercatat paling murah. Makanya untuk mensosialisasikan berbagai fasilitas yang dimiliki Medan Internasional School beralamat di Jl.Jamin Ginting Km 10/Jl.Tali Air 5 lewat simpang Perumahan Simalingkar, pihaknya akan menggelar pameran pendidikan di sana pada Minggu, 21 Apr il 2013, mulai pukul 11:00 sampai 15:00 Wib yang terbuka untuk umum. Bagi para orangtua yang mendaftarkan putra-putrinya pada berbagai tingkatan pada hari itu, pihak sekolah akan memberikan diskon 50 persen uang sekolah bagi siswa tertentu dan juga bebas uang pendaftaran. Pihak Sekolah menurut Kathryn juga akan menyediakan beasiswa bagi anak-anak berprestasi, serta nanti juga banyak tersedia bermacam-macam hadiah dalam bentuk lucky draw. Setelah lebih satu jam pengurus MIS berbincang dengan pihak Waspada, kunjungan itu diakhiri dengan saling tukar menukar cenderamata antara Konsul AS Madan Kathryn T.Crockart dengan Pemimpin Umum Waspada dr Hj Rayati Syafrin. (m22)

Ujian Nasional (UN) 2013 bagi 1.224 siswa gabungan 14 SMA/ MA dan dua SMK di lingkungan Dinas Pendidikan Kebudayaan Pemuda dan Olahraga (Disdikbudpora) Subulussalam, berlangsung aman, lancar dan terkendali. Kadis Dikbudpora, Salmaza melalui ponselnya, Kamis (18/4) mengatakan, selain lancar dan terkendali, kehadiran peserta ujian hampir mencapai 100 persen. Dia pun berharap, kelulusan 100 persen bisa dicapai di sana. Seperti disampaikan Darusni, Sekretaris Dinas Dikbudpora, Rabu melalui ponselnya, dari seluruh peserta UN 2013 hanya seorang siswa yang tidak mengikuti UN, yakni Sahlan. Sahlan, siswa SMAN Sultan Daulat dilaporkan masuk Lembaga Pemasyarakatan (LP) dalam kasus lakalantas, Oktober 2012, sehingga yang bersangkutan dijadwalkan diberi kesempatan mengikuti ujian susulan. Dari 1.224 peserta UN di sana, 855 siswa SMA/MA terdiri dari 512 jurusan IPA dan 343 jurusan IPS. Lalu 556 siswa SMK, terdiri dari 187 siswa SMKN Penanggalan dan 369 siswa SMK Simpang Kiri. (b06/cdin/b28)

makan fakir miskin. Aku takut, hartaku akan memperbudak diriku,” jawab Mu’az. Shahabat Rasulullah yang satu ini, hidup sangat sederhana, pakaian yang dipakainya sudah lesuh dan bertampal. Khalifah Umar bin Khattab membeli kepada dia pakaian baru tenunan Yaman. Umar mengirim Aflah untuk mengantarkannya. Pakaian itu tidak pernah dipakai oleh Mu’az, tetapi telah dijual untuk menebus beberapa budak untuk dimerdekakan. Beberapa bulan kemudian Umar bertanya. “Wahai Mu’az, mengapa kamu tidak pernah menggunakan pakaian yang aku kirim kepadamu?”, “Maafkan aku wahai Amirul Mukminin, aku telah menjual

pakaian yang engkau berikan. Harga pakaian itu aku telah menebus lima budak dan kemudian aku merdekakan”. Kali yang lain, Umar mengirim lagi pakaian tebal untuknya, pakaian itu berharga 100 dirham. Anehnya Mu’az bin Afra’ datang menjumpai Umar dan mengembalikan pakaian tersebut. Umar bin Khattab sangat terkejut dan bertanya; “Mengapa engkau menolak pemberianku?” Mu’az menjawab; Masih ada yang berhak memakainya, kalau aku masih punya beberapa pakaian wahai Amirul Mukminin. Kemudian Umar berdoa: Ya Allah! Semoga Mu’az memakai pakaian sutra dan sendusen dalam surgamu kelak.

Ada-ada Saja ....

Riyadh, Arab Saudi pada Minggu (14/04). Ketiga pria itu merupakan perwakilan negara Uni Emirat Arab (UEA) yang menghadiri acara festival. Polisi Syariah Arab Saudi khawatir ketampanan mereka bisa membuat para perempuan yang datang ke festival bergunjing dan menyukai mereka. “Karena mereka terlalu tampan, maka Komisi Penganjur Kebaikan dan Pencegahan Kejahatan khawatir pengunjung perempuan akan terpikat kepada mereka,” situs berita Arab Saudi, Elaph melaporkan. Ketiganya ditangkap dan dibawa keluar dari lokasi festival saat acara sedang berlangsung, dan setelah itu mereka dipulangkan ke negeranya. Selain itu, seorang penyanyi wanita terkenal asal UEA bernama Aryam juga turut diamankan pihak berwenang

Waspada/Rasudin Sihotang

LIMA rumah terbakar di Jl DI Panjaitan, Gg. Aman, Kel. Sejahtera, Kec. Tanjungbalai Utara, Kota Tanjungbalai.

Lima Rumah Terbakar TANJUNGBALAI (Waspada): Lima rumah di Jl. DI Panjaitan, Gg. Aman, Lingk. V, Kel. Sejahtera, Kec. Tanjungbalai Utara, Kota Tanjungbalai, ludes terbakar, Kamis (18/4) sekira pukul 16.30. Kelima rumah itu dihuni enam kepala keluarga (KK) antara lain Syafaruddin Simangunsong, 52, M Amin, 46, Rustam, 65, Somah, 80, Adhar Simanjuntak, 45, serta Yusariah, 45. Belum diketahui asal api dan kerugian mencapai

ratusan juta rupiah. Sebanyak tujuh mobil pemadam kebakaran dari Badan Penanggulangan Bencana Daerah (BPBD) Kota Tanjungbalai dikerahkan untuk memadamkan api. Hanya beberapa menit api berhasil dikuasai. Kepala BPBD Kota Tanjungbalai Mahdin Siregar melalui Kasi Rehabilitasi dan Rekonstruksi Sofyan ST didampingi Kasubbid Kesiapsiagaan membenarkan lima rumah di-

huni enam KK terbakar. Sekira 11 anak korban kebakaran berstatus pelajar, dua diantaranya masih mengikuti Ujian Nasional (UN) diharapkan menjadi perhatian Pemko Tanjungbalai. Kapolres Tanjungbalai AKBP ML Hutagaol melalui Kasubbag Humas AKP Y Sinulingga mengatakan tidak ada korban jiwa dan pihaknya masih menyelidiki penyebab kebakaran. Sementara barang bukti yang diambil berupa potongan kayu terbakar dan kabel listrik. (a32)

Putuskan ....

bangsa yang sangat tidak memerhatikan hak-hak azasi manusia. Dia mengatakan, penguasa Myanmar merasa seolah mereka berada di dunia ini sendiri saja. Mereka seolah tidak menyadari bahwa umat Islam ada di mana-mana, tidak hanya ada di Myanmar saja, sebagaimana umat Budha yang merupakan mayoritas di Myanmar juga ada di manamana. “Oleh karena itu kita tidak ingin peristiwa Myanmar ini menjadi pemicu konflik antar-agama dan etnis di bagian dunia yang lain,” katanya. Selain mengunjungi Muslim Rohingya di penampungan, MUI Medan juga telah membuat surat edaran ke MUI kecamatan untuk disampaikan kepada jamaah umat Islam di masjid dan

mushalla untuk mendirikan shalat ghaib. “Shalat ini untuk mendoakan umat Muslim Rohingya. Semoga bagi yang telah wafat diberikan ampunan oleh Allah SWT, dan bagi yang masih berjuang diberikan kekuatan dan ketabahan menghadapi kejahatan kemanusiaan yang terjadi di abad modern ini,” ujarnya. Dalam kesempatan itu Prof Hatta juga mengajak umat Islam khususnya, untuk meningkatkan kepedulian kepada nasib Muslim Rohingya, baik yang kini sedang berada di penampungan maupun yang masih berada di tanah airnya. Dikatakan, pihaknya berencana untuk menggalang bantuan dengan membuka Dompet Peduli Rohingya yang bekerjasama dengan Harian Waspada. (m07)

Tak Habis Akal ....

wali kelasnya. Mereka memberikan seragam sekolahnya dan menukarnya dengan dua lembar undangan. Undangan per tama untuk kegiatan Pentas Seni undangan kedua ditujukan kepada orang tuanya agar mengambil surat tanda kelulusan pada hari Jumat 24 Mei mendatang. “Kalau siswa tidak menyerahkan seragamnya, mereka tidak akan dapat undangan. Jika tidak ada undangan, maka tidak bisa mengambil surat kelulusan yang diambil orang tua mereka 24 Mei mendatang,”kata Kepala SMAN 13, Ilyas Halim MPd, kemarin. Seorang siswa bernama Wan Chairliza siswa di jurusan IPS mengakui jika kegiatan

barter ini memberikan pembelajaran khusus terhadap dirinya. “Ya, ini sebuah pembelajaran bagi kami, bahwa seragam yang bakal kita tanggalkan ini sangat berarti bagi mereka yang memerlukan,” ujar Liza. Saat ditanya apakah tidak ada perasaan kecewa karena tidak punya kesempatan melakukan aksi coret dengan teman sebaya yang ramairamai berpesta aksi coret seragam usia UN. Terkait hal ini Liza menyatakan sangat tidak kecewa. Bahkan dia bersyukur punya kesempatan menyumbangkan seragamnya, meksi banyak yang mengajaknya pergi bersama untuk aksi coret baju sekolah. (m37)

FBI Buru ....

Kamis waktu setempat. Dia menghadiri upacara berkabung bagi para korban, di tengah upaya FBI memburu pelaku pengeboman. Menurut laporan, Obama akan menyampaikan pidatonya dalam upacara berkabung antarkeyakinan itu. Dalam insiden tersebut, tiga orang tewas dan lebih dari 183 orang terluka. Keberangkatan Obama ke Boston juga dibayangbayangi insiden amplop beracun yang dialamatkan ke Capitol Hill dan Gedung Putih. Seorang pria dari Mississippi ditahan terkait pengiriman surat isi racun ricin ini. “Kamera dari Lord & Taylor adalah sumber terbaik yang kami punya sejauh ini,” kata walikota Boston Thomas M Menino. (bbc/vn/m10)

Prof Hatta menegaskan apa yang dilakukan penguasa Myanmar terhadap Muslim Rohingya yang merupakan salah satu etnis yang ada di negara tersebut adalah kejahatan kemanusiaan yang dapat memincu pertentangan dunia. “Apa yang terjadi di Myanmar bisa memicu pertentangan dunia yang tidak akan dapat dibayar dengan harga murah,” ujar Prof Hatta yang sebelumnya, atas nama MUI Kota Medan telah mengunjungi dan memberikan bantuan kepada pengungsi Rohingya di penampungan di Kecamatan Tuntungan. Atas tindakan penguasa di Myanmar, Prof Hatta menekankan pihaknya mengecam dan beranggapan bahwa Myanmar adalah salah satu Hal lainnya dengan menjadikan seragam sebagai barter dengan surat undangan pengumuman UN dan acara Pentas Seni sekaligus kegiatan perpisahan. Inilah berlangsung di SMAN 13 Medan, Kamis (18/4). Usai dibariskan di lapangan dan mendapatkan pengarahan dari Kepala Sekolah, Ilyas Halim MPd, seluruh siswa mengikuti pelaksanaan aksi coret dan tandatangan di kanvas yang sudah disiapkan pihak sekolah. Setelah itu seluruh siswa masuk kelas kembali dan bertemu dengan alasan yang hampir sama. Aryam mengatakan dirinya dia memang berada di tempat itu tapi ia tidak berniat untuk bernyanyi. “Saya memang mengunjungi paviliun UEA sebagai anggota delegasi. Saya berada di sekitar 20 detik dan tidak berniat bernyanyi,” ujar Aryam. Aryam, yang kelahiran Mesir, mengaku diundang oleh Kementerian Budaya dan Pariwisata Abu Dhabi saat insiden terjadi. Polisi Syariah langsung mendatangi paviliun UEA saat Aryam menyapa penggemarnya dan sedikit melantunkan lagu untuk mereka. Namun perwakilan UEA dalam festival itu mengatakan kunjungan Aryam sama sekali tidak direncanakan. Menanggapi kasus ini, Gubernur Riyadh memerintahkan untuk dilakukan penyelidikan. (emr/rzl)

para tersangka ini. Tidak diketahui pula apakah tersangka-tersangka ini memiliki kaitan antara satu dengan lainnya. Sebelumnya, BBC melaporkan bahwa para pejabat yang menyelidiki pengeboman Boston Marathon mengatakan mereka telah menemukan gambar tersangka potensial pelaku dari tayangan kamera pengintai. Presiden Dewan Kota Boston Stephen Murphy mengatakan Rabu seorang pria terlihat menjatuhkan satu tas di lokasi ledakan bom Senin. Sebelumnya, FBI membantah laporan bahwa seorang tersangka telah ditangkap. Obama ke Boston Sementara itu, Presiden Obama mengunjungi Boston

Berita Utama


WASPADA Jumat 19 April 2013

MUI Medan Soal Rohingya:

Pemerintah Bisa Putuskan Hubungan Diplomatik Dengan Myanmar

Waspada/Rasudin Sihotang

LIMA rumah terbakar di Jl DI Panjaitan, Gg. Aman, Kel. Sejahtera, Kec. Tanjungbalai Utara, Kota Tanjungbalai.

Lima Rumah Terbakar TANJUNGBALAI (Waspada) : Lima rumah di Jl. DI Panjaitan, Gg. Aman, Lingk.V, Kel. Sejahtera, Kec. Tanjungbalai Utara, Kota Tanjungbalai, ludes terbakar, Kamis (18/4) sekira pukul 16.30. Kelima rumah itu dihuni enam kepala keluarga (KK) antara lain Syafaruddin Simangunsong, 52, M Amin, 46, Rustam, 65, Somah, 80, Adhar Simanjuntak, 45, sertaYusariah, 45. Belum diketahui asal api dan kerugian mencapai ratusan juta rupiah. Sebanyak tujuh mobil pemadam kebakaran dari Badan Penanggulangan Bencana Daerah (BPBD) Kota Tanjungbalai dikerahkan untuk memadamkan api. Hanya beberapa menit api berhasil dikuasai.

Kepala BPBD Kota Tanjungbalai Mahdin Siregar melalui Kasi Rehabilitasi dan Rekonstruksi Sofyan ST didampingi Kasubbid Kesiapsiagaan membenarkan lima rumah dihuni enam KK terbakar. Sekira 11 anak korban kebakaran berstatus pelajar, dua diantaranya masih mengikuti Ujian Nasional (UN) diharapkan menjadi perhatian Pemko Tanjungbalai. KapolresTanjungbalai AKBP ML Hutagaol melalui Kasubbag Humas AKP Y Sinulingga mengatakan tidak ada korban jiwa dan pihaknya masih menyelidiki penyebab kebakaran. Sementara barang bukti yang diambil berupa potongan kayu terbakar dan kabel listrik. (a32)

Djoko Susilo Minta KPK Usut Kapolri JAKARTA (Waspada): Mantan Gubernur Akpol dan Dirlantas Polri Irjen Djoko Susilo meminta, Komisi Pemberantasan Korupsi (KPK) mengusut dugaan keterlibatan Kapolri Jenderal Pol Timur Pradopo lebih dalam terkait pengadaan Simulator SIM. Hal tersebut dikatakan kuasa hukum Djoko Susilo, Juniver Girsang, dimana Kapolri pada saat itu termasuk sebagai pengguna anggaran. “Kami tidak mau mendahului proses persidangan. Seharusnya KPK yang bisa menyampaikan di persidangan dan nanti kami akan lihat apakah tuduhan itu benar atau tidak,“ kata Juniver di Kantor KPK, Jakarta, Kamis (18/4). Tetapi Juniver mengaku pesimis, lembaga di bawah Abraham Samad tersebut bisa mengungkap dugaan keterlibatan Kapolri dalam kasus itu. Hal itu dikarenakan, sepanjang ini pihaknya belum pernah melihat nama Kapolri dalam setiap berkas yang mereka terima. “Sampai saat ini, kami melihat Kapolri sesuai dengan berkas belum ada relevansinya. Tetapi nanti kita lihat lebih lanjut lagi proses persidangan,“ ujarnya. Menurut Juniver, pihaknya juga tidak akan memaksakan Kapolri Timur Pradopo untuk

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Gf4. (Jika 1. ...., GxGf4. 2. g7 promosi tak terbendung). 1. ......, Gf8. 2. Ge5, Re7. 3. GxKe6, RxG. 4. g7, Gxg7. 5. GxG. Putih menang. Jawaban TTS: TTS Topik

Mimbar Jumat

bisa memberikan keterangan sebagai saksi terhadap bawahannya Djoko Susilo. Dia beralasan, dirinya hanya berpegang kepada nama-nama yang memang tercantum dalam setiap berkas yang mereka terima. “Siapapun saksi nanti di persidangan, sesuai berkas kita dengar sendiri dulu, sepanjang tidak ada di dalam berkas tentu kami tidak berhak untuk mengajukan, saya tidak mau menyatakan nama itu yang perlu ditanyakan kepada KPK yang kompeten jawab itu,“ kata Juniver. Dugaan keterlibatan Kapolri sendiri dalam kasus itu sempat mencuat di permukaan. Sejumlah media memberitakan isi surat Keputusan Kepala Kepolisian Negara Republik Indonesia Nomor: Kep/193/IV/ 2011. Berdasarkansalinansurattersebut, Kepala Kepolisian RI (Kapolri) menyetujui penetapan PT Citra Mandiri Metalindo Abadi (PT CMMA) sebagai pemenang lelang pengadaan driving simulator pengemudi R4 (roda empat) tahunanggaran2011dengannilai kontrak Rp142 miliar. Surat tersebut diteken Kapolri selaku pengguna anggaran 8 April 2011. (j02)

Ada-ada Saja ... Riyadh, Arab Saudi pada Minggu (14/04). Ketiga pria itu merupakan perwakilan negara Uni Emirat Arab (UEA) yang menghadiri acara festival. Polisi Syariah Arab Saudi khawatir ketampanan mereka bisa membuat para perempuan yang datang ke festival bergunjing dan menyukai mereka. “Karena mereka terlalu tampan, maka Komisi Penganjur KebaikandanPencegahanKejahatan khawatir pengunjung perempuan akan terpikat kepada mereka,” situs berita Arab Saudi, Elaph melaporkan.Ketiganyaditangkap dan dibawa keluar dari lokasi festival saat acara sedang berlangsung, dan setelah itu mereka dipulangkan ke negeranya. Selain itu, seorang penyanyi wanita terkenal asal UEA bernama Aryam juga turut diamankan pihak berwenang dengan alasan yang hampir sama. Aryam mengatakan dirinya dia memang berada di tempat itu tapi ia tidak berniat untuk bernyanyi. “Saya memang mengunjungi paviliun UEA sebagai anggota delegasi. Saya berada di sekitar 20 detik dan tidak berniat bernyanyi,” ujar Aryam. Aryam, yang kelahiran Mesir, mengaku diundang oleh Kementerian Budaya dan Pariwisata Abu Dhabi saat insiden terjadi. Polisi Syariahlangsungmendatangipaviliun UEA saat Aryam menyapa penggemarnya dan sedikit melantunkan lagu untuk mereka. Namun perwakilan UEA dalam festivalitumengatakankunjungan Aryam sama sekali tidak direncanakan.Menanggapi kasus ini, Gubernur Riyadh memerintahkan untuk dilakukan penyelidikan. (emr/rzl)

MEDAN (Waspada): Penganiayaan dan pembunuhan Muslim Rohingya oleh penguasa Myanmar mengundang reaksi dari berbagai elemen umat Islam. Majelis Ulama Indonesia (MUI) Kota Medan mendesak pemerintah Indonesia berperan melancarkan diplomasi, atau bertindak melakukan pemutusan hubungan diplomatik dengan Myamnar. “Kita tidak ingin penderitaan Muslim Rohingya ini menjadi persoalan dunia yaitu konflik antar umat beragama. Kita minta pemerintah untuk memberi peringatan keras kepada Myanmar, kalau perlu putuskan hubungan diplomatik,” tegas Ketua MUI Kota Medan Prof Mohd. Hatta, Kamis (18/4).

6 9 3 7 4 5 2 8 1

7 5 2 1 3 8 6 4 9

1 4 8 6 2 9 7 5 3

9 1 4 8 7 3 5 6 2

3 2 6 5 1 4 8 9 7

8 7 5 9 6 2 1 3 4

5 8 7 4 9 1 3 2 6

4 3 1 2 8 6 9 7 5

2 6 9 3 5 7 4 1 8

hak azasi manusia. Dia mengatakan, penguasa Myanmar merasa seolah mereka berada di dunia ini sendiri saja. Mereka seolah tidak me-nyadari bahwa umat Islam ada di manamana, tidak hanya ada di Myanmar saja, sebagaimana umat Budha yang merupakan mayoritasdiMyanmarjugaadadimanamana. “Oleh karena itu kita tidak ingin peristiwa Myanmar ini menjadi pemicu konflik antaragama dan etnis di bagian dunia yang lain,” katanya. Selain mengunjungi Muslim Rohingya di penampungan, MUI Medan juga telah membuat surat edaran ke MUI kecamatan untuk disampaikan kepada jamaah umat Islam di masjid dan mushalla untuk mendirikan

Pelunasan BPIH Reguler Hanya Sekali JAKARTA (Antara): Direktur Pelayanan Haji, Sri Ilham Lubis mengingatkan kepada calon jamaah haji reguler yang masuk dalam kuota untuk berangkat pada 2013, hanya diberikan kesempatan sekali untuk melunasi Biaya Penyelenggaraan Ibadah Haji (BPIH) pada tahap pertama saja. Pihak Kementerian Agama (Kemenag) hanya membuka kesempatan sekali pelunasan. Tak ada tahap dua atau berikutnya, kata Sri Ilham melalui telepon di Jakarta, Kamis (18/4). Dan kesempatan sekali itu harus

diindahkan para calon jamaah haji reguler. Karena itu, calon jamaah haji diimbau tetap mengikuti perkembangan informasi yang disampaikan pihak kementerian tersebut. Sebelumnya Sri Ilham Lubis bersama Dirjen PHU Anggito Abimanyu, Sekretaris Ditjen PHU Cepi Supriyatna, dan Direktur Pembinaan Haji Ahmad Kartono, di Jakarta, Rabu (17/4), sudah menjelaskan hal ini. Tapi penjelasan tersebut dirasakan masih kurang. “Saya tegaskan, calon jama-

ah masuk kuota berangkat, hanya boleh melakukan pelunasan pada tahap pertama. Setelah itu tak ada lagi tahap berikutnya,” kata Sri menegaskan. “Jamaah harus mengetahui bahwa mereka harus segera melunasipadatahappertama,karena tidak diberikan toleransi untuk melakukan pelunasan pada tahap kedua. Nanti akan diterbitkan PMA tentang pengisian sisa kuota atau pengisian untuk kuota nasional yang nanti akan kita sampaikan informasinya,”kata Sri menegaskan.

FBI Buru Dua ...

lihat menjatuhkan satu tas di lokasi ledakan bom Senin. Sebelumnya, FBI membantah laporan bahwa seorang tersangka telah ditangkap. Obama ke Boston Sementara itu, Presiden Obama mengunjungi Boston Kamis waktu setempat. Dia menghadiri upacara berkabung bagi para korban, di tengah upaya FBI memburu pelaku pengeboman. Menurut laporan, Obama

akan menyampaikan pidatonya dalam upacara berkabung antarkeyakinan itu. Dalam insiden tersebut, tiga orang tewas dan lebih dari 183 orang terluka. Keberangkatan Obama ke Boston juga dibayang-bayangi insiden amplop beracun yang dialamatkan ke Capitol Hill dan Gedung Putih. Seorang pria dari Mississippi ditahan terkait pengiriman surat isi racun ricin ini. (bbc/vn/m10)

sekolah negeri dan swasta di Indonesia. Konsul AS itu juga mengaku bentuk bangunan sekolah tidak bertingkat tapi asri sehingga membuat tenang dan nyaman para siswa belajar di dalamnya. Demikian pula mutunya, jelas sudah berstandar dan berkualitas dunia sehingga para lulusan tingkat SMA umpamanya tidak sulit lagi melanjutkan ke berbagai perguruan tinggi di Amerika, Australia dan Eropa karena standar kualitas pendidikan yang sudah diakui dengan bukti-bukti langsung. “Guru dalam setiap kelas terdiri dua orang, satu orang asing dan satu lagi orang Indonesia. Khusus guru dari negara asing rata-rata sudah mengantongi predikat S-2,” katanya dengan membandingkan mana ada di Indonesia khususnya kota Medan guru TK atau setingkat SD diajar oleh rata-rata guru bersertifikat S-2. Dia juga mengaku biaya uang sekolah jauh lebih tinggi dibanding uang sekolah negeri atau sekolah swasta di Medan. Namun dibandingkan dengan Jakarta, Surabaya, Ujung Pandang dan Bali, apalagi dengan Singapura

dan Malaysia, Medan tercatat paling murah. Makanya untuk mensosialisasikan berbagai fasilitas yang dimiliki Medan Internasional School beralamat di Jl.Jamin Ginting Km 10/Jl.Tali Air 5 lewat simpang Perumahan Simalingkar, pihaknya akan menggelar pameran pendidikan di sana pada Minggu, 21 April 2013, mulai pukul 11:00 sampai 15:00Wib yang terbuka untuk umum. Bagi para orangtua yang mendaftarkan putra-putrinya pada berbagai tingkatan pada hari itu, pihak sekolah akan memberikan diskon 50 persen uang sekolah bagi siswa tertentu dan juga bebas uang pendaftaran. Pihak Sekolah, menurut Kathryn, juga akan menyediakan beasiswa bagi anak-anak berprestasi, serta nanti juga banyak tersedia bermacam-macam hadiah dalam bentuk lucky draw. Setelah lebih satu jam pengurus MIS berbincang dengan pihak Waspada, kunjungan itu diakhiri dengan saling tukar menukar cenderamata antara Konsul AS Madam Kathryn T.Crockart dengan Pemimpin Umum Waspada dr Hj Rayati Syafrin. (m22)

Hidup. Seperti diberitakan sebelumnya, Waspada Green Club akan menggelar deklarasi Aku Perempuan Peduli Lingkungan (APPEL) di Taman Ahmad Yani, Jln. Sudirman Medan, guna memperingati Hari Kartini 21 April dan Hari Bumi 22 April. Acara ini digagas Dewi Budiati TJ. Said yang dikenal sebagai sosok perempuan peduli lingkungan. Dewi juga menjabat sebagai Ketua Bidang Pemberdayaan SDM Waspada Green Club dan Ketua Ikatan Keluarga Wartawan Indonesia (IKWI) Sumut. Dewi mengatakan, saat ini permasalahan lingkungan semakin kompleks sehingga diperlukan banyak tangan dan komunitas untuk membangun kesadaran sekaligus melakukan upaya memperpanjang umur bumi. Menurut Dewi, seorang ibu perlu diberi penyuluhan pembekalan terkait penyelamatan lingkungan. Umumnya, kaum ibu mampu membuat aturan yang ditaati seluruh anggota keluarga. Misalnya, menganjurkan

setiap anggota keluarga menghemat listrik, hemat air serta tidak membuang sampah sembarangan. “Hal-hal kecil terkait rutinitas/aktivitas kebanyakan perempuan sangat berkaitan dengan lingkungan. Apalagi kalau setiap perempuan dapat menghijaukan setiap jengkal tanah di lahan hunian dengan aneka jenis tanaman, maka dapat dibayangkan Indonesia semakin hijau,” ujar Dewi. Sebelumnya Dewi telah mendirikan Komunitas Pemuda Peduli Lingkungan (KOPPLING) Kota Medan. Saat ini, pembinaan organisasi tersebut diserahkan kepada Pemko Medan.(m25)

ini memiliki kaitan antara satu dengan lainnya. Sebelumnya, BBC melaporkan bahwa para pejabat yang menyelidiki pengeboman Boston Marathon mengatakan mereka telah menemukan gambar tersangka potensial pelaku dari tayangan kamera pengintai. Presiden Dewan Kota Boston Stephen Murphy mengatakan Rabu seorang pria ter-

Anak Sumut Boleh ... Menurut Kathryn, MIS yang didirikan sekitar tahun 1969 oleh pihak Konsulat AS dan Inggris di Medan hanya diperuntukkan sebagai lembaga pendidikan untuk mendidik anak-anak para diplomat dan pengusaha dari kedua negara itu, namun kemudian berkembang untuk mendidik anak-anak diplomat dari berbagai negara Eropa, Amerika dan Australia. Tenaga pengajar pun, kata Kathryn yang juga duduk sebagai ketua pembina di sekolah international itu, umumnya didatangkan dari Amerika dan Eropa yang khusus bekerja sebagai guru. Dan dia mengakui sekolah ini dulunya tidak diperuntukkan bagi anak-anak Indonesia, termasuk anak-anak Medan karena ada peraturan yang membatasi. Namun, lanjut Kathryn, sekarang sudah ada kebijakan baru dari pihak Amerika Serikat yang memperbolehkan anak-anak Indonesia termasuk di Medan belajar di sekolah ini. Menurut Kathryn, saat ini siswanya hanya sekitar 50 orang namun fasilitas sekolah terlengkap dibandingkan sekolah-

Menteri LH Dukung ... perempuan asal Sumut di antaranya Prof Dr. Hidayati, DR. Dra. Ivan Elizabeth Purba, MKes, Khiozzy di ruang kerjanya di Jln. DI Panjaitan Jakarta, kemarin. Balthasar mengatakan, perempuan adalah komunitas yang tepat untuk diberi pembekalan terkait lingkungan. Jika seorang perempuan atau kaum ibu mengerti tentang lingkungan, maka dapat memberi pemahaman kepada setiap anggota keluarga sekaligus mendidik anak sejak dini agar peduli terhadap lingkungan. “Saya sangat senang dan mendukung penuh kebulatan tekad perempuan-perempuan Sumut yang mendeklarasikan APPEL,” kata Menteri LH. Kalau bisa, lanjut Menteri LH, jangan sekadar deklarasi tapi dapat membentuk struktur kepengurusan. Dengan demikian, APPEL akan menjadiWadah Perempuan Peduli Lingkungan yang memberikan kontribusi pemikiran dan bakti perempuan terhadap lingkungan,” ujar Kambuaya didampingi dua Deputy Kementerian Lingkungan

Al Bayan ...

Jawaban Sudoku:

Prof Hatta menegaskan apa yang dilakukan penguasa Myanmar terhadap Muslim Rohingya yang merupakan salah satu etnis yangadadinegaratersebutadalah kejahatan kemanusiaan yang dapatmemincupertentangandunia. “ApayangterjadidiMyanmarbisa memicupertentanganduniayang tidak akan dapat dibayar dengan harga murah,” ujar Prof Hatta yangsebelumnya,atasnamaMUI Kota Medan telah mengunjungi dan memberikan bantuan kepada pengungsi Rohingya di penampungan di Kec. Tuntungan. Atas tindakan penguasa di Myanmar, Prof Hatta menekankan pihaknya mengecam dan beranggapan bahwa Myanmar adalah salah satu bangsa yang sangat tidak memerhatikan hak-

Usai shalat jamaah di Masjid Nabawi, Abdullah menemui Mua’az bin Afra’. “Wahai adik iparku. Istrimu mengadu padaku, bahwa kalian hidup dalam keadaan miskin. Semua itu karena kamu sangat boros. Wahai Mu’az, hidup hematlah kamu demi masa depan keluargamu dan anak-anakmu,” ujar Abdullah abang isteri Mu’az. Mua’z menjawab, “Aku tidak merasa miskin Allah selalu memberiku rezeki dan kesehatan. Aku belum bisa tidur nyenyak sebelum memberi makan fakir miskin. Aku takut, hartaku akan memperbudak diriku,” jawab Mu’az. Shahabat Rasulullah yang satu ini, hidup sangat sederhana, pakaian yang dipakainya sudah lesuh dan bertampal. Khalifah Umar bin Khattab membeli kepada dia pakaian baru tenunanYaman. Umar mengirim Aflah untuk mengantarkannya. Pakaian itu tidak pernah dipakai

oleh Mu’az, tetapi telah dijual untuk menebus beberapa budak untuk dimerdekakan. Beberapa bulan kemudian Umar bertanya. “Wahai Mu’az, mengapa kamu tidak pernah menggunakan pakaian yang aku kirim kepadamu?”, “Maafkan aku wahai Amirul Mukminin, aku telah menjual pakaian yang engkau berikan. Harga pakaian itu aku telah menebus lima budak dan kemudian aku merdekakan”. Kali yang lain, Umar mengirim lagi pakaian tebal untuknya, pakaian itu berharga 100 dirham. Anehnya Mu’az bin Afra’ datang menjumpai Umar dan mengembalikan pakaian tersebut. Umar bin Khattab sangat terkejut dan bertanya; “Mengapa engkau menolak pemberianku?” Mu’az menjawab; Masih ada yang berhak memakainya, kalau aku masih punya beberapa pakaian wahai Amirul Mukminin. Kemudian Umar berdoa: Ya Allah! Semoga Mu’az memakai pakaian sutra dan sendusen dalam surgamu kelak.

shalat ghaib. “Shalat ini untuk mendoakan umat Muslim Rohingya. Semoga bagi yang telah wafat diberikan ampunan oleh Allah SWT, dan bagi yang masih berjuang diberikan kekuatan dan ketabahan menghadapi kejahatan kemanusiaan yang terjadi di abad modern ini,” ujarnya. Dalam kesempatan itu Prof Hatta juga mengajak umat Islam khususnya, untuk meningkatkan kepedulian kepada nasib Muslim Rohingya, baik yang kini sedang berada di penampungan maupun yang masih berada di tanah airnya. Dikatakan, pihaknya berencana untuk menggalang bantuan dengan membuka Dompet Peduli Rohingya yang bekerjasama dengan Harian Waspada. (m07)

Ledakan Besar ... Terasa hingga 14 km Para petugas medis dan pemadam kebakaran masih menyisir lokasi ledakan pabrik pupuk di kotaWest itu. CNN memperkirakan korban tewas mencapai hingga 70 orang. Diberitakan CNN, ledakan Rabu malam tersebut terasa hingga jarak lebih dari 14 km dari lokasi kejadian. Penghitungan pasti korban tewas dan luka akan dilakukan pada Kamis pagi, saat hari mulai terang. Ledakan yang muncul di pabrik pupuk Texas, Amerika Serikat (AS) dikabarkan menewaskan banyak orang. Wali Kota West mengatakan, ledakan itu serupa dengan ledakan bom nuklir. Menurut Badan Survei Geologi AS, getaran yang dihasilkan ledakan itu tercatat sebesar 2,1 skala Richter usai ledakan maut itu berlangsung. Ledakan itu sangat kuat hingga merubuhkan bangunan yang ada di dekat pabrik pupuk tersebut. Dengan munculnya getaran yang kuat, ledakan pupuk itupun dipandang sama dengan ledakan uji coba bom nuklir. Jumlah korban yang tewas dalam insiden ini juga simpang siur. Pada awalnya, media memberitakanada70orangyangtewas dalam ledakan di pabrik itu. Namun Polisi hanya mengatakan bahwa jumlah korban yang tewas kurang lebih 15 orang, sementara itu 160 orang terluka. Negeri Paman Sam kini benar-benar menghadapi masalah besar. Pada Senin lalu, bom meledak di perlombaan maraton Boston, lalu muncul pula isu pengiriman surat beracun ke Presiden Barack Obama dan seorang senator. Meski demikian, muncul pula dugaan-dugaan seputar ledakan di Texas. Ledakan besar itu muncul menjelang peringatan 20 tahun konfrontasi Biro Penyelidik Federal (FBI) di Waco, Texas, dengan militan bersenjata Branch Davidians (Ranting Daud). Sejauh ini korban diidentifikasi baru dua orang. Puluhan rumah runtuh, termasuk sebuah panti jompo. Sebanyak 2.800 orang mengungsi. Direktur medis di kota tersebut, George Smith, mengatakan bahwa korban tewas diduga mencapai puluhan. “Petugas pemadam kebakaran menduga korban tewas mencapai 60-70 orang. Ini masih hitungan kasar, kami belum dapat jumlah pasti,” kata Smith. (wp/cnn/vn/m10)


UJIAN TERAKHIR UN: Seorang siswa memeluk rekannya usai mengikuti Ujian Nasional hari terakhir di SMA Negeri 5 Medan, Kamis (18/4). Walaupun pada hari terakhir pelaksanaan Ujian Nasional tingkat SMA/sederajat di Sumut berjalan lancar, namun masih banyak sekolah yang menunda pelaksanaan UN akibat adanya keterlambatan soal naskah dari pemerintah pusat.

UN Ending, ... mengamankan 12 sepeda motor tanpa dilengkapi surat-surat dan menahan seorang siswa saat berkonvoi ke Sibolangit. Begitu juga Polsek Delitua menilang 17 sepeda motor. Untuk pelajar yang sempat ditahan di Polsek Pancurbatu berinisial S,18, warga Jalan Mabar berikut seorang sopir angkutan umum berinisial E,34, warga Jln Yos Sudarso ke Mapolsek Pancurbatu. Informasi diterima wartawan, pelajar dan sopir tersebut diamankan setelah petugas menemukan benda yang dicurigai sering digunakan untuk mengonsumsi narkoba yakni satu buah pipet dan satu benda karet di dalam angkot tersebut. Namun setelah diproses petugas, pelajar dan sopir itu dipulangkan karena tidak terbukti menyimpan narkoba dan tidak terindikasi sebagai penggunanya. “Razia ini perintah Kapolresta Medan,” kata Kasat Lantas Kompol Risya Mustario di Jln. Bukit Barisan Medan, kemarin. Beberapa titik razia itu sengaja digelar oleh Polantas sebagai lintasan konvoi para pelajar dan mengganggu lalu lintas di antaranya di Jln. Ayahanda, Jln. Gatot Subroto depan PRSU, Jln. Ringroad Sunggal, Jln. Jamin Ginting, Jln. Bukit Barisan dan simpang Titikuning. Risya didampingi Kanit Laka AKP Eko Hartanto menjelaskan, selain jajaran Sat Lantas Polresta Medan, Unit Lantas masing-masing Polsek juga melakukan razia yang sama. “Untuk satu hari ini saja data yang masuk atau hasil tilang sudah 50 pengendara/ pelajar SMA yang ditilang. Dari jumlah tersebut 10 unit sepedamotor yang tidak ada kelengkapan surat-surat kita boyong ke Sat Lantas Polresta Medan,” jelasnya. Menurut Risya, razia khusus pelajar SMA usai UN ini di-

gelar agar para pelajar yang mengendarai sepedamotor maupun mobil tidak ugal-ugalan di jalan sehingga bisa membahayakan pengendara lainnya. Bahkan Kasat Lantas Kompol Risya Mustario juga sempat menghentikan mobil bak terbuka dinaiki para pelajar yang berdiri di belakang. Setelah diberhentikan, Risya memberikan nasihat agar yang berdiri itu duduk saja sehingga tidak mengundang bahaya. Sedangkan Kanit Laka AKP Edo Hartanto yang sebelumnya memimpin razia di kawasan Ringroad Sunggal juga mengimbau kepada para pelajar yang menaiki mobil bak terbuka supaya tidak berdiri. Hal ini dilakukan karena para pelajar yang berdiri di mobil bak terbuka cukup membahayakan karena bisa saja terjatuh saat pengendaranya ugal-ugalan. Pantauan Waspada di lokasi razia Jln. Bukit Barisan Medan, sejumlah konvoi kendaraan sepedamotor yang dinaiki para pelajar SMA yang bajunya sudah dicoret-coret, terlihat mengalihkan jalan ke Jln. Balai Kota tidak jadi masuk ke Jln. Bukit Barisan setelah melihat ada petugas Sat Lantas Polresta Medan melakukan razia. Bahkan petugas Sat Lantas Polresta Medan terpaksa meminta pengendara mobil yang kebanyakan dinaiki para pelajar SMA agar tidak parkir di seputaran Lapangan Merdeka Medan supaya tidak terjadi kemacatan. Kapolsek Pancurbatu Kompol Darwin Sitepu PB didampingi Kanit Lantas Pancurbatu AKP Edward mengatakan,12 sepeda motor yang ditahan masih diproses. Sementara Kapolsek Delitua Kompol B Marpaung melalui Kanit Lantas Delitua AKP M Syafii mengatakan dua dari 17 sepeda motor milik pelajar yang ditilang di Jln Brigjen Zein Hamid simpang Titi Kuning Medan terpaksa ditahan.(m36/m36/m40)

Berbagai Cara Cegah ... Seni undangan kedua ditujukan kepada orang tuanya agar mengambil surat tanda kelulusan pada hari Jumat 24 Mei mendatang. “Kalau siswa tidak menyerahkan seragamnya, mereka tidak akan dapat undangan. Jika tidak ada undangan, maka tidak bisa mengambil surat kelulusan yang diambil orang tua mereka 24 Mei mendatang,”kata Kepala SMAN 13, Ilyas Halim MPd, kemarin. Seorang siswa bernama Wan Chairliza siswa di jurusan IPS mengakui jika kegiatan barter ini memberikan pembelajaran khusus terhadap dirinya. “Ya, ini sebuah pembelajaran bagi kami, bahwa seragam yang bakal kita tanggalkan ini sangat berarti bagi mereka yang memerlukan,”ujar Liza. Saat ditanya apakah tidak ada perasaan kecewa karena tidak punya kesempatan melakukan aksi coret dengan teman sebaya yang ramai-ramai berpesta aksi coret seragam usia UN. Terkait hal ini Liza menyatakan sangat tidak kecewa. Bahkan dia bersyukur punya kesempatan menyumbangkan seragamnya, meksi banyak yang mengajaknya pergi bersama untuk aksi coret baju sekolah. (m37)

Tetap Semangat, ... Kepada Waspada, putra bungsu dari Adinata dan Farida Hanum ini mengatakan sempat pesimis dan tidak mau mengikuti UN tahun ini karena berpikir dengan kondisinya itu akan mengganggu aktivitasnya mengikuti UN. “Awalnya aku sempat nggak mau ikut ujian bang, tapi karena ada dorongan dari orang tua, guru, dan kawan-kawan semangatku untuk UN semakin bertambah,” ujarnya, Kamis (18/4). Semua orang, kata Wanda ingin mengikuti UN dengan kondisi yang prima tanpa ada masalah tapi kalau memang sudah takdir mau gimana lagi. Semua ini terjadi akibat kecelaka-

an yang dialaminya pada, Sabtu (13/4). “Kejadiannya saat pulang dari sekolah bang, aku boncengan sama kawan, pas lewat Jl Sei Batanghari tiba-tiba dari belakang datang mobil lumayan kencang meyerempet kami,” tuturnya kesal. Orangtua siswa Farida Hanum mengatakan terkejut ketika mendapat kabar anak bungsunya itu diserempet mobil dan akhirnya harus mengalami patah kaki di bagian kanan. Sementara itu, Kepala SMK TI Darussa-lam Eva Mughdiyana Alfirah mengatakan turut prihatin dengan kondisi siswanya dan dukungan dari pihak sekolah sendiri berupaya agar Wanda bisa melaksanakan UN tahun ini meskipun di dalam mobil ambulans. (cat)

Medan Metropolitan

WASPADA Jumat 19 April 2013


Jika Lembaran Soal Belum lengkap

Gubsu Minta UN SMP Ditunda MEDAN (Waspada): Gubernur Sumatera Utara H. Gatot Pujo Nugroho, ST meminta Kementerian Pendidikan dan Kebudayaan menunda pelaksanaan Ujian Nasional (UN) tingkat Sekolah Menengah Pertama (SMP) di Provinsi Sumatera Utara jika lembaran soal belum lengkap. Pasalnya, persiapan UN SMP berdekatan dengan UN SMA. Penegasan Gubsu ini disampaikan kepada wartawan, Kamis (18/4), terkait carut marut UN SMA dan persiapan UN SMP pada 22 April 2013 men-

datang. Gatot menjelaskan, hari ini Dewan Pendidikan akan menggelar rapat guna membahas persiapan UN SMP. “Idealnya, kalau soal tidak lengkap, maka kita ingin UN ditunda. Nanti kita minta Dinas Pendidikan berkonsultasi dan bermusyawarah. Jika naskah belum selesai lebih bagus ditunda semuanya supaya tidak terulang kejadian seperti UN SMA,” ujar Gubsu. Keterlambatan naskah soal dari Jakarta, menurut Gatot, merupakan masalah utama yang menyebabkan banyak siswa gagal mengikuti UN secara

Kernet Truk Dianiaya Preman MEDAN (Waspada): Kernet truk pengangkut batu bata bernama Epi, 30, warga Desa Sidourip, Kec. Beringin, Deliserdang, dianiaya dua preman karena tak memberi uang di Jln. Letda Sudjono dekat Titi Sewa Tembung, Kamis (18/4) pagi. Selanjutnya, korban melaporkan peristiwa penganiayaan tersebut ke Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, ketika itu truk korban membawa batu bata dari Lubuk Pakam. Namun, saat melintas di Titi Sewa Tembung, tiba-tiba dua pelaku yang diduga merupakan preman setempat memberhentikan laju truk dengan alasan meminta uang SPSI sebesar Rp10 ribu. Lalu korban mencoba meminta kwitansi pembayaran, namun kedua pelaku tak memberikannya. Korban akhirnya tak jadi memberikan uang SPSI yang diminta kedua pelaku. Kemudian terjadi pertengkaran antara korban dengan kedua pelaku karena tetap memaksa agar uang diberikan. Selanjutnya, kedua pelaku langsung menjambak rambut korban dan menjedutkan kepalanya ke bak truk hingga mengalami luka memar dan lembam. Usai menganiaya korban, kedua pelaku pergi meninggalkan lokasi dan korban melanjutkan mengantarkan pesanan batu bata ke tempat tujuan pembangunan ruko di lokasi. Usai menghantarkan pesanan batu batanya, ketika hendak kembali, truk korban kembali lagi dihentikan oleh kedua pelaku yang menuduh truk menabrak pohon pinang yang berada dipinggir jalan hingga melintang di jalan dan meminta ganti rugi. “Jadi habis kami ngantar batu bata kami mau gerak pulang, rupanya truk kami distop lagi, katanya kami nabrak pohon pinang sampe tumbang dan melintang di jalan. Kami kan gak tau, kok tiba-tiba dituduh, disitu marah-marah lagi orang itu sambil ngancam dan meminta ganti rugi, tapi gak kami kasih,” ujar Epi. Tak senang dianiaya dan diancam, korban kemudian melaporkan kejadian ini ke Polsek Percut Seituan dengan kondisi wajah yang lembam karena dijedutkan ke bak truk. “Aku melapor karena takut besok-besok bakal kejadian lagi, soalnya kami masih terus ngantar pesanan batu bata ke lokasi,” sebutnya. Kanit Reskrim Percut Seituan AKP Faidir Chan saat dikonfirmasi mengatakan, korban telah membuat pengaduan. ”Korban sudah membuat pengaduan dan masih dimintai keterangannya,” ujarnya. (h04)

Mobil Boks Terbalik Di Jalan Tol MEDAN (Waspada): Gara-gara ban belakang pecah, mobil boks Daihatsu Espass BK 8947 BN bermuatan roti kering dan makanan ringan terbalik di Jalan Tol Bandar Selamat-H Anif, Kamis (18/4) sekira pukul 18:00. Petugas Jasa Marga Tol Belmera menyebutkan, di dalam mobil ada dua orang yakni sopir Iis, 22, warga Jalan Pasar XI Tembung, Kec. Percut Seituan, dan kernetnya Budi, 25, warga Pasar VIII Tembung. Rencananya mobil bermuatan produk home industri itu akan mengantar barang-barang ke sejumlah grosir ataupun toko-toko di kawasan Jalan H Anif. Namun tiba-tiba, menjelang pintu gerbang tol ban belakang sebelah kiri mobil pecah yang membuat mobil oleng ke sebelah kiri dan kemudian terbalik dan menghantam pembatas tengah jalan tol. Tidak ada korban jiwa dalam kecelakaan tersebut, namun kaca depan mobil mengalami pecah dan boks bagian sebelah kiri penyok. Tak lama petugas Jasa Marga dengan truk dereknya turun ke lokasi untuk mengevakuasi mobil yang terbalik. “Karena pecah ban belakang, dan mobilnya akan kita bawa ke Jasa Marga terlebih dahulu karena dereknya milik mereka, setelah itu baru serah terima ke Unit Sat Lantas,” sebut seorang petugas PJR Jalan Tol. (h04)

Safri Ramadhan Kini Jadi Anak Asuh Pemuda Pancasila MEDAN (Waspada): Srikandi Pemuda Pancasila Sumatera Utara (PP Sumut) mengunjungi bayi kurang gizi di RS Bandung Jln. Gatot Subroto, Medan, Rabu (17/4). Mereka mengangkat bayi itu menjadi anak asuh Pemuda Pancasila. Safri, bocah laki-laki lumpuh layu yang berusia 2 tahun itu merupakan anak dari M. Darwin dan Mariana asal Palawi Utara Babalan Langkat. Kini, Safri terbaring di rumah sakit untuk mendapatkan perawatan medis. Srikandi PP Sumut menyerahkan bingkisan berupa susu, minyak kayu putih dan makanan bayi lainnya serta memberikan sejumlah uang. Menurut ayah Safri, mereka sudah mengurus surat miskin 3 bulan lalu, namun hingga kini belum juga dikeluarkan lurah setempat tanpa alasan yang jelas. Berkat bantuan seseorang, bocah kurang gizi itu dibawa ke RS Bandung beberapa hari lalu. Bocah kurang gizi bernama lengkap Safri Ramadhan ini menderita lumpuh layu sejak lahir dengan berat 1,7 kilogram. Saat ini, berat badannya hanya 2 kilogram. Artinya Safri masuk dalam kategori gizi kurang. Ketua MPO Srikandi PP Sumut Ny. Any Aweng mengatakan, akan mengangkat Safri menjadi anak asuh Pemuda Pancasila dan akan membantu perobatannya hingga sembuh. “Program anak asuh Pemuda Pancasila ini bertujuan membantu anak-anak kurang gizi untuk mendapatkan biaya perobatan hingga sembuh,” ucap Ny. Any Aweng didampingi Ketua Srikandi PP Sumut Jamilah, Koordinator Pokja Humas PP Sumut H. Idrus Djunaidi dan Ketua Bidang peranan Wanita PP Sumut, Rosda serta unsur pengurus Pemuda Pancasila Sumut. Ny. Any menambahkan, bayi kurang gizi ini bisa disembuhkan menjadi anak-anak normal lainnya. ”Masih bisa sembuh asal terus diusahakan,” tambahnya. Sementara itu, Koordinator Pokja Humas MPW PP Sumut, H. Idrus Djunaidi menyesalkan lambannya penanganan dalam memberikan bantuan pengobatan kepada Safri. Seharusnya instansi terkait di Kabupaten Langkat tanggap memberikan bantuan karena orangtua Safri sudah berulang kali memohon surat miskin.(m08)


SRIKANDI PP Sumut saat mengunjungi bayi kurang gizi di RS Bandung Jln. Gatot Subroto Medan, Rabu (17/4).

serentak tahun ini. Potensi keterlambatan naskah soal UN SMP diprediksi Gatot masih bisa terjadi. Kondisi ini bakal makin buruk jika naskah soal tiba pada hari yang berdekataan dengan pelaksanaan UN. Sebab, koordinator pelaksana harus mendistribusikan soal-soal ke seluruh SMP di Sumatera Utara yang secara geografis sangat luas. “Luas Provinsi Sumut dengan letak geografis kabupatan/ kota yang berjauhan membutuhkan waktu tempuh cukup lama. Sementara jadwal tiba

naskah dan lembar jawaban komputer (LJK) yang tidak tepat waktu, sehingga berpotensi menimbulkan permasalahan di Sumut,” kata Gubsu. Diperkirakan naskah soal UN SMP akan tiba pada Jumat (19/4) sore dan mulai didistribusikan Sabtu (20/4). Naskah harus sudah tiba di tiap kota/ kabupaten pada Minggu (21/ 4) agar dapat langsung digunakan pada Senin (22/4) pagi. Gubsu menambahkan, Pemerintah Provinsi Sumut melalui Unimed juga tidak boleh melakukan sortir naskah soal

yang datang. Mereka hanya bertugas mendistribusikan kepada sekolah di seluruh kabupaten/kota. “Kita tidak dibolehkan sortir naskah ujian sehingga kita tidak tahu kekurangan naskah soal yang terjadi,” ujar Gubsu. Terkait keterlambatan naskah UN SMA, Gubsu sudah mencurigai hal itu bakal terjadi. Karena sejak awal, perusahaan percetakan sudah memperlihatkan ketidakprofesionalannya. “Saat uji petik, boks yang akan dikirim ke Sumut ada kekurangan. Kita sudah ingatkan

tetapi pihak perusahaan tidak mengindahkan temuan uji petik pada boks itu. Jadi, sejak awal kita telah mengkhawatirkan akan terjadi hal ini,” ujarnya. Sampai saat ini, Pemrovsu tetap berkoordinasi dengan Unimed sebagai pengawas, penerima naskah UN, pendistribusi naskah serta pengawas. Juga berkoordinasi dengan pihak percetakan untuk pelaksanaan UN SMP dan UN susulan SMA/ SMK, tetapi hingga saat ini belum ada informasi kedatangan naskah soal ujian susulan. Dengan kondisi seperti ini

Tewas Tabrakkan Diri Ke KA MEDAN (Waspada): Peristiwa mengejutkan terjadi di rel kereta api (KA) Jln. Mahkamah, Kec. Medan Maimun, Kamis (18/4) siang. Seorang pria paruh baya diperkirakan berusia 54 menabrakkan dirinya ke kereta api yang melintas. Akibatnya, korban belum diketahui identitasnya itu langsung tewas di tempat dengan kepala remuk dan kedua tangan putus. Saksi mata di lokasi kejadian mengatakan, sebelum pria itu menabrakkan diri ke kereta api sempat singgah di warung kopi tidak jauh dari rel. Dia memesan kopi dan memakan roti yang dibawanya. “Kami tidak mengenalnya, tapi saat itu dia diam saja seperti ada persoalan,” kata Husni, pemilik warung. Tidak berapa lama di warung, saat terdengar suara kereta

api, pria itu bangkit dari duduknya berjalan ke arah rel. Husni menyebutkan, pria itu membayar minumnya dengan uang Rp10 ribu, saat uang kembalian Rp7 ribu diberikan kepadanya, dia menolak. “Ambil saja,” kata Husni menirukan ucapan korban,kemudianpergidariwarung. Ketika pria itu bergerak menuju pintu perlintasan kereta api, Husni sempat mengingatkan agar berhati-hati karena kereta api akan melintas. Saat itu korban sempat menyeberangi pintu perlintasan, tetapi kemudian terlihat berbalik arah. “Dua kali dia berbalik melintasi pintu perlintasan, kemudian tampak terjatuh di tengah perlintasan disaat KA meluncur,” kata Hj Azizah, pemilik toko onderdil bekas di dekat pintu perlintasan kereta api. Akibatnya, tubuh korban

dihantam kereta api, sehingga warga yang melihat menjerit histeris. Kereta api penumpang yang bergerak dari stasiun besar Kereta Api Medan itu kemudian menyeret tubuh korban hingga sekira 50 meter, dan terhenti di lintasan dekat Fakultas Kedokteran UISU. Bagian tubuhnya berserakan di sepanjang lintasan. Oleh warga kemudian melaporkan peristiwa tersebut ke Polsek Medan Kota, dan menutup bagian tubuh korban yang sebagian sudah terpisah. Mayat pria itu selanjutnya di evakuasi ke RSU dr Pirngadi Medan. Kapolsek Medan Kota Kompol Paulus Hotman Sinaga mengatakan, masih mencari identitas korban. “Tidak ditemukan identitas korban, sedangkan wajahnya tidak dikenali lagi,” kata Sinaga mengatakan, selain

mencari identitas korban pihaknya menyelidiki motif bunuh diri tersebut. Ciri-ciri korban, memakai baju kemeja kotak dan celana panjang lee. Tingginya sekira 160 dan berkulit putih seperti warga Tionghoa. “Dari keterangan saksi, pria tersebut mencoba menghentikan laju kereta api yang hendak melintas,” sebutnya. Petugas Unit Laka Sat Lantas Polresta Medan Brigadir K Pandiangan yang turun ke TKP menyebutkan, saat mayat ditemukan, tubuh korban terlihat berserakan namun tidak ditemui identitas korban. “Korban tidak memiliki identitas,” sebut Brigadir K pandiangan seraya menyebutkan Kereta Api Sri Bilah Utama jurusan MedanRantauprapat tersebut dimasinisi oleh Wismuliadi. (m27/ h02/h04)

Gubsu mengharapkan peserta ujian tetap tenang dan tidak kuatir, karena permasalahan ini

tidak hanya terjadi di Provinsi Sumut tetapi sudah menjadi permasalahan nasional. (m28)


Medan Metropolitan

WASPADA Jumat 19 April 2013

Aksi Coret Seragam Tidak Terbendung

CORET DINDING: Sejumlah siswa mencoret dinding gedung depan SMAN 1 Medan usai mengikuti UN hari terakhir, Kamis (18/4).

CORET SERAGAM: Sejumlah siswa saling mencoret seragam sekolah usai mengikuti UN hari terakhir di SMAN 1 Medan, Kamis (18/4).

Waspada/Surya Efendi

KONVOI NAIK MOBIL: Sejumlah siswa SMAN 1 Medan melakukan konvoi mengendarai mobil di Jln. KH Zainul Arifin usai mengikuti UN hari terakhir, Kamis (18/4).

Waspada/Surya Efendi

MEDAN (Waspada): Ujian Nasional (UN) telah berakhir, Kamis (18/4). Sejumlah siswa yang duduk di bangku kelas XII SMA sederajat di Medan, meluapkan kegembiraannya dengan aksi coret seragam sekolah. Aksi coret seragam sekolah itu memang tidak terbendung. Padahal Kadis Pendidikan Kota Medan Parluhutan Hasibuan sudah mengingatkan siswa agar tidak mencoret seragam dan lebih baik menyumbangkannya kepada siswa kurang mampu. Pantauan Waspada di lapangan, para pelajar SMA melakukan aksi coret seragam di Jln. STM, Jln. Tritura, Jln. Sudirman, Jln. Balai Kota, Jln. Gagak Hitam (Ringroad), Jln. Setia Budi, Komplek Tasbi dan Jln. Krakatau Medan. Di Jln. Balai Kota rombongan siswa SMAN 1 Medan terlihat melakukan aksi coret seragam. Meski Kepala SMAN 1 Ahmad Siregar sudah mengimbau agar tidak melakukan aksi coret seragam. “Usai UN semua siswa diajak berdoa dan menyumbangkan seragamnya untuk siswa kurang mampu. Jika setelah kegiatan ini ada aksi coret seragam, tentu tidak bisa diawasi lagi. Sebab, mereka sudah berada di luar lingkungan sekolah,” kata Ahmad Siregar. Sementara itu, siswa SMAN 5 Medan menggelar syukuran setelah selesai mengikuti UN. Bahkan beberapa siswa melakukan aksi sujud syukur. Setelah itu, mereka menyumbangkan seragamnya untuk orang yang membutuhkan. Kepala SMAN 5 Medan Sutrisno mengatakan, kegiatan ini merupakan murni inisiatif para siswa. “Semuanya siswa yang atur. Saya hanya memfasilitasi dan mendukung kegiatan positif ini,” katanya seraya menjelaskan, seluruh sumbangan siswa akan disalurkan kepada panti asuhan dan siswa kelas X dan XI yang kurang mampu. Poppy Ramadhani dan Siti siswi kelas XII IPS 2 menyambut baik kegiatan sosial tersebut. Mereka masing-masing menyumbangkan sepasang seragamnya untuk orang yang membutuhkan. “Dari pada bajunya dicoret-coret, lebih bagus disumbangkan untuk teman-teman yang kurang beruntung. Ini akan lebih bermanfaat,” kata Poppy. Di atas kanvas Pantauan Waspada di SMKN 1 Medan, para siswa yang sudah menyelesaikan UN melakukan aksi coret di atas kanvas. Kepala SMKN 1 Medan Asli Sembiring mengatakan, kegiatan ini wujud perhatian pihak sekolah kepada siswa yang ingin meluapkan kegembiraannya setelah mengikuti UN. “Mereka ingin meluapkan kegembiraan, kita fasilitasi. Daripada mereka mencoret seragam sekolah, lebih baik di kanvas ini,” kata Asli. Saat ditanya tentang siswa yang tetap melakukan aksi coret seragam, Asli Sembiring sangat menyesalkannya. Sebab, pihak sekolah sudah melakukan sosialisasi agar tidak melakukan aksi coret seragam. Di SMAN 13 Medan, aksi coret kanvas sepanjang 3 x 6 meter dihadiri Kadisdik Medan Parluhutan Hasibuan, Kepala Kementerian Agama Kota Medan Iwan Zulhami dan Kepala SMAN 13 Medan Ilyas Halim. Selain coret kanvas, siswa juga menyumbangkan seragamnya kepada yang membutuhkan. “Pihak sekolah sengaja memberikan tempat kepada siswa agar bisa bereuforia secara positif. Di kanvas ini mereka bisa mencurahkan isi hati atau sekadar menulis nama dan kelas. Kami akan simpan kanvas ini sebagai kenang-kenangan,” kata Ilyas.(m37)

Waspada/Surya Efendi

Waspada/Rudi Arman

PERIKSA SURAT: Kanit Laka Sat Lantas Polresta Medan AKP Eko Hartanto memeriksa surat-surat kendaraan milik siswa SMA yang mengemudikan mobil saat melintas di Jln. Bukit Barisan Medan, Kamis (18/4).

Medan Metropolitan

WASPADA Jumat 19 April 2013


Dishub Tindak Truk Masuk Kota MEDAN (Waspada): Petugas Dinas Perhubungan Kota Medan menertibkan truk Fuso Intercooler BL 8698 PB bermuatan buku masuk inti kota Jln. Raden Saleh dekat kantor Wali Kota Medan, Kamis (18/4) sore. Pantauan Waspada di lapangan, petugas Dishub melakukan penertiban truk atas perintah Wali Kota Medan H. Rahudman Harahap karena beliau melihat truk itu masuk kota melintas di Jln. Raden Saleh Medan. Petugas Dishub kemudian menanyakan kelengkapan suratsurat kendaraan itu kepada sopir truk yang mengangkut buku atau sejumlah potongan kertas warna kuning segi empat bertulisan sejumlah Polres yakni Polresta Aceh Tamiang, Aceh Jaya, Aceh Tengah, Bener Meriah, Aceh Timur, Aceh Utara. Karena truk dilarang masuk kota pada pagi, siang dan sore, petugas Dishub langsung melakukan penilangan dan truk digiring ke kantor pos. Kepala Dinas Perhubungan Kota Medan Renward Parapat mengatakan, penertiban truk masuk kota terus dilakukan. “Truk nomor polisi BL 8698 PB ditertibkan karenaWali Kota Medan melihat truk itu masuk kota,” sebutnya. Sementara itu, sopir mengatakan, truk mengangkut barang dari Jakarta untuk dibawa ke kantor Pos Medan. “Saya disuruh melanjutkan perjalanan masuk kota atas suruhan oknum polisi marga Saragih. (m36)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

Tiba Dari


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

05.20 08.45 10.30 11.55 13.55 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 13.10 17.55

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

11.45 17.55

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

11.05 17.15

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096


Jadwal Perjalanan Kereta Api No KA

Nama KA





U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10


13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

PETUGAS Dinas Perhubungan Kota Medan menindak truk Fuso Intercooler BL 8690 PB masuk kota di Jln. Raden Saleh dekat kantor Wali Kota Medan, Kamis (18/4).

Waspada/Ismanto Ismail

Penipu Ditangkap Keluarga Korban MEDAN (Waspada): Seorang wanita yang menjadi tersangka penipuan tenaga kerja kontrak (outsourcing) ditangkap keluarga korban di Jakarta. Tersangka Wil, 48, penduduk Jln. Ismail Harun, Percut Seituan, dibawa ke Medan dengan penerbangan Lion Air JT-202, Kamis (17/4) sekira pukul 16:55. Kapolpos Bandara Polonia Medan Aiptu Saud Sihombing saat dikonfirmasi Waspada mengatakan, tersangka ditangkap keluarga korban di Perumahan Pondok Bambu II Jakarta Timur, Rabu (16/4) malam pukul 24:00. Setibanya di Bandara Polo-

nia Medan, tersangka Wil langsung diserahkan ke Pos Polisi setempat. Beberapa menit kemudian, puluhan keluarga korban berdatangan Pos Polisi guna melihat tersangka. Salah seorang korban Hitarid br Sihombing mengaku telah menyerahkan uang Rp36 juta agar dua anaknya Tantri, 25, dan Danu, 21, dijadikan pekerja kontrak di Dinas Pendapatan Kota Medan. “Tapi sejak tahun 2012 hingga saat ini, belum ada kejelasan tentang penempatan anak saya. Sebab, tersangka sudah menghilang dari Medan sejak 19 September 2012,” kata Sihombing. “Saya perkirakan ada puluhan orang yang menjadi korban

Gubsu Nilai Budaya Masih Kuat Mengakar Di Masyarakat Sumut MEDAN (Waspada): Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST mengatakan, di,tengah kemajuan zaman saat ini, nilai budaya masih kuat mengakar di masyarakat Sumut. Hal ini dapat disaksikan dalam tanyangan film Mursala dari hasil karya anak bangsa mengedepankan kekayaan budaya dan alam Indonesia yakni di Tapanuli Tengah, Sumut. “Ini sebuah nilai unik Sumut itu sendiri. Di mana sebuah budaya sampai hari ini di tengah kemajuan zaman ini tetapi nilai budaya itu masih kuat mengakar di masyarakat Sumut. Tentu ini akan menjadi nilai tambah dan diharapkan keunikan ini akan menjadi daya jual kepariwisataan Sumut termasuk di dalamnya keindahan alam Kabupaten Tapanuli Tengah,” kata Gubsu H Gatot Pujo Nugroho ST, di sela-sela jamuan makan siang bersama pemeran utama film Mursala yakni Titi Sjuman dan Rio Dewanto di rumah Dinas Gubsu Jln. Sudirman Medan, Kamis (18/4). Hadir juga Bupati Tapteng Raja Bonaran Situmeang SH, MHum, Wakil Bupati Tapteng H Sukran Jamilan Tanjung SE, sutradara dan beberapa pemain film Mursala lainya. Gubsu mengajak masyarakat perantauan Sumut yang tersebar di Indonesia dan khususnya masyarakat Sumut untuk menonton film yang tak sekadar mengkisahkan percintaan. Karena selain itu film ini juga mengedepankan adat dan budaya serta keindahan dan keka-

yaan bumi Indonesia yakni Kabupaten Tapteng. “Khususnya masyarakat di rantau ini sebuah film berbasis kearifan lokal Tapanuli maka dari itu pastikan anda menontonnya,” ujarnya. Film ini, lanjut Gubsu, bahwa di Sumut tepatnya di Tapanuli ada Parna yakni sekumpulan marga Tapanuli yang pada adat tidak boleh saling menikah. “Di era modren sekarang ini budaya Parna masih lestari di Sumut. Justru ini letak nilai yang menjadi ciri dan kekompakan Sumut. Keberagaman di Sumut menjadi daya rekat justru adalah budaya,” tuturnya. Sementara itu, Bupati Tapteng Raja Bonaran Situmeang menjelaskan, cerita di film Mursala sangat bagus dan luar biasa serta ada unsur pendidikan bagi anak muda khususnya di adat Batak. Disutradarai Viva Westy ini diperankan Rio Dewanto dan Titi Sjuman bersama pemeran pendukung lain bercerita tentang kisah seorang pemuda Batak yang tinggal di Jakarta dan berprofesi sebagai seorang pengacara, harus berjuang untuk bisa memenangkan cintanya karena dia terjebak dalam sebuah adat Batak yang tidak bisa menikah dengan pasangan yang berbeda marga dan kemudian memaksadirinyauntukmenikahi wanita pilihan orangtua. Film diperoduksi Rajs Production membuat film berjudul Mursala yang diambil dari sebuah nama air terjun yang terletak di kawasan Tapanuli Tengah, Sumatera Utara.(m28)

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho foto bersama Bupati Tapteng Raja Bonaran Situmeang dan para artis film Mursala usai jamuan makan siang di Gubernuran Medan, Kamis (18/4).

penipuan ini. Saat menerima uang berkisar Rp5 juta hingga Rp25 juta per orang, tersangka menulisnya diatas kuitansi sebagai pinjaman sementara,” kata penduduk Jln. AR Hakim Medan ini. Ny Ch. Lubis, penduduk Jln. Pahlawan Medan mengatakan,

salah seorang saudaranya yang hendak menjadi tenaga outsourcing, juga menjadi korban penipuan Wil. “Tersangka Wil menyatakan sanggup mempekerjakan anak-anak kami di kantor BKKBN Medan, Dispenda dan Disperindag Medan,” tambahnya.

Sementara itu, tersangka Wil saat dikonfirmasi Waspada mengaku hanya dijadikan tumbal. “Sebab, uang berkisar Rp500 juta sudah diserahkan kepada Putra untuk mengurus penempatan tenaga kerja di masing-masing instansi. Ternyata Putra melarikan diri dibu-

ron Polisi hingga saat ini,” ujarnya. Di tempat terpisah, Kasat Reskrim Polresta Medan Kompol Yoris Marzuki yang dikonfirmasi Waspada mengatakan, tersangkasudahdiserahkanke Sat Reskrim Polresta Medan. “Tersangka sekarang masih menjalani pemeriksaan,” jelasnya. (m32)

Medan Metropolitan Tujuh Sindikat Pengedar Narkoba Terancam Hukuman Mati A6

MEDAN (Waspada): Tujuh orang sindikat pengedar narkoba internasional jenis sabu dari Malaysia terancam hukuman mati. Hal itu terungkap dalam sidang yang digelar di Ruang Cakra 4 Pengadilan Negeri (PN) Medan, Kamis (18/4). Pengedar narkoba internasional jenis sabu dari Malaysia yang akan diedarkan di Indonesia, khususnya Medan melalui Pelabuhan Tanjung Balai diperiksa terpisah menjadi empat bagian. Pada awalnya majelis hakim Lelywati SH, Marlianis SH, dan ET Pasaribu SH, mendudukkan Andika, Syaeful, Budi Winarno, dan Yusuf di kursi pesakitan. Setelah itu diteruskan dengan terdakwa Hartono alias Ati, Budianto dan Masudi yang masing-masing diperiksa terpisah. Dalam surat dakwaan yang dibacakan Jaksa Penuntut Umum (JPU) Saut Halomoan SH mengatakan, terungkapnya sindikat ini berawal dari informasi yang diterima Tim Dirtipi Narkoba Bareskrim Mabes Polri bahwa ada peredaran narkoba jenis sabu dari Malaysia yang dikendalikan Dedi Jonaidi alias Ahay dan Hartono alias Ati. Lalu pada tanggal 14 Oktober 2012 pukul 14:30 wib, petugas me-

nangkap Ati di Bandara Polonia. Setelah diinterogasi petugas, selanjutnya Ati ditelepon Ahay untuk menerima penyerahan sabu dari Yusuf dan Andika (orang suruhan Ahay) di Komplek Perumahan Cemara Hijau. Setelah itu petugas melakukan penangkapan dan menyita sabu-sabu seberat 2.945 gram atau hampir 3 Kg dalam tas ransel. Kepada petugas Yusuf dan Andika mengaku bahwa mereka disuruh Ahay untuk menyerahkan sabu itu pada Ati dan dijanjikan uang Rp500 ribu. Keduanya juga mengaku telah menyerahkan sabu dan kotak susu kepada Budi Winarno di ujung Jln. Gang Jaya Tanjung Balai. Selanjutnya petugas bergerak ke Tanjung Balai untuk mempersiapkan penangkapan Ahay di rumahnya Jln. Jendral Sudirman Datuk Bandar Kota Tanjung Balai, pada tanggal 15 Oktober 2012. Ahay yang berhasil ditangkap, mengaku kepada petugas bahwa pada tanggal 11 Oktober 2012 ada seseorang bernama Cicago (DPO) memesan sabu sebanyak 3 kg. Tapi sebelumnya Cicago meminta 150 gram sebagai contoh. Kemudian Ahay menelepon Aseng di Malaysia untuk disediakan pesanan Cicago. Dia meminta Aseng menyerahkan narkoba seberat 3 kg pada Masudi, sedangkan sabu

100 gram kepada Muhammad Saeful. Barang tersebut diterima kedua orang itu (Masudi dan Saeful) pada tanggal 12 Oktober 2012 melalui orang suruhan Aseng di Port Klang Malaysia. Selanjutnya, tanggal 13 Oktober 2013 Masudi mengambil barang tersebut yang diletak-

kan orang suruhan Aseng di salah satu kapal. Masudi kemudian membawa sabu itu dari Malaysia dan menyerahkannya kepada Budianto di salah satu gudang Jln. Baru Tanjung Balai. Budianto menyerahkan uang Rp20 juta pada Masudi sebagai upah, sementara Budia-

nto mengantarkan sabu itu ke rumah Ahay. Sabu 3 kg itu disisihkan Ahay seberat 150 gram, kemudian dimasukkan ke dalam kotak susu Dancow dan menyuruh Yusuf dan Andika menyerahkan kepada Budi Winarno (suruhan Ati) di Medan. Rencananya, Ati akan menye-

Mahasiswa Tolak Komersialisasi Pendidikan MEDAN (Waspada): Belasan mahasiswa mengatasnamakan Front Mahasiswa Sumatera Utara (Fromsu) menyerukan penolakan terhadap komersialisasi dunia pendidikan, dalam unjukrasa di beberapa tempat, yakni Taman Makam Pahlawan (TMP) Jln. Sisingamangaraja dan bundara Taman Stadion Teladan, tidak jauh dari Mapolsek Medan Kota, Kamis (18/4). Membawa sejumlah spanduk penolakan terhadap komersialisasi dunia pendidikan, mahasiawa melakukan long march dari Jln. Gedung Arca, mengitari taman Stadion Teladan hingga Taman Makam Pahlawan menyuarakan pencabutan UU Perguruan Tinggi,

dan menolak sistem ujian nasional (UN) sebagai standarisasi pendidikan. Mereka juga mendesak pemerintah merealisasikan UUD 1945 pasal 31 ayat 1 dan 2, menghapuskan premanisme dan pungutan liar di dunia pendidikan,wujudkandemokratisasidan transparansi dalam dunia pendidikan dan menolak elit-elit politik dalam dunia pendidikan. “Kondisi pendidikan saat ini sangat bertolak belakang dengan acuan tentang pendidikan nasional dalam UUD 1945 pasal 31, dikarenakan realitas yang ada saat ini adalah pendidikan yang bersifat komersil,” sebut pimpinan aksi, Bibi. Menurut dia, banyak ketimpangan dan diskriminasi ten-

tang pemerataan mutu pendidikan akibat munculnya beberapa kebijakan pemerintah lewat UU Sisdiknas dan banyak produk perundang-undangan lainnya yang mengatur pendidikan nasional. Disebutnya, peserta didik hanya dididik layaknya sebagai robot-robot bernafas, yang dikunci dengan sistem pendidikan bermotif kapitalisme. “Nyatanya, pendidikan kini telah lari dari hakikatnya, yakni seharusnya memanusiakan dalam hal intelektual, moralitas dan mentalitas,” ujarnya. Setelah menyampaikan aspirasi secara berkeliling selama sekira dua jam, mahasiswa kemudian membubarkan diri secara tertib.(m27)

Hj Masnah Terpilih Wakil Ketua IPHI Medan Marelan MEDAN (Waspada): Hj Masnah terpilih menjadi Wakil Ketua Ikatan Persaudaraan Haji Indonesia (IPHI) Kecamatan Medan Marelan Periode 2013-2018. Terpilihnya Hj Masnah sebagai Wakil Ketua IPHI menyusul hasil Musyawarah Cabang (Muscab) IPHI Kecamatan Medan Marelan pada 16 Maret 2013. Selain itu, diperkuat Surat Keputusan nomor: 3.099/Skep/PH-KM/II/2013 ditandatangani Ketua IPHI Kota Medan Drs H Farid Wajedi MSi, dan Sekretaris HT Djamilul Basyar BA. “Ini merupakan amanah dan kepercayaan yang harus dijalankan dengan penuh tanggungjawab,” kata Hj Masnah dalam siaran pers yang dikirim ke Waspada, Selasa (16/4). Dia menyebutkan, diperlukan saling koordinasi dan kerjasama yang baik antar sesama pengurus dan anggota lainnya, segala visi dan misi IPHI bisa dilaksanakan sesuai dengan aturan yang ada. Menurut dia, terpilih dirinya sebagai wakil ketua merupakan kepercayaan harus diemban dengan tangan terbuka, artinya amanah yang dipercayakan sebagai bentuk kepercayaan para pengurus lainnya untuk secara bersama-sama membesarkan IPHI Kecamatan Medan Marelan. “Tidak hanya bagi pengurus dan anggota, namun juga bagi kemaslahatan umat Islam, khususnya di Medan Marelan,” tuturnya. Masnah yang juga Ketua Majelis Zikir Al-Falah Medan Marelan, akhir pekan lalu melakukan wisata ibadah ke daerah Tanjung Balai.(m32/rel)

Gubsu: Perkuat Kapasitas Masyarakat Terhadap Bencana MEDAN (Waspada): Semakin tinggi tingkat pemahaman dan kesadaran masyarakat terhadap bencana, maka akan berkurang risikonya. Karena itu, Badan Penanggulangan Bencana Daerah (BPBD) Sumut diminta meningkatkan program-program yang terkait langsung dengan keterampilan dan pemahaman masyarakat dalam menghadapi bencana. “Ke depan, BPBD Sumut diharapkan membuat program yang dapat memperkuat kapasitas masyarakat terhadap bencana,” kata Gubsu Gatot Pujo Nugroho melalui Kepala Pelaksana BPBD Sumatera Utara DR. H. Asren Nasution, MA pada pelatihan Tim Reaksi Cepat (TRC) BPBD Sumut di Berastagi, Selasa (16/4). Menurutnya, masyarakat adalah pilar penting dalam setiap pembangunan, tanpa kecuali pembangunan daya tahan masyarakat terhadap bencana. “Karena itu, kegiatan pelatihan bimbingan teknis TRC dan relawan bencana ini dimaksudkan untuk memberi pengetahuan dan keterampilan dalam kaji cepat dan dampak bencana pada saat tanggap darurat,” jelasnya. Tujuannya, lanjut Asren, dengan pengetahuan dan keterampilan dasar yang dimiliki TRC atau relawan, maka dapat dilakukan kaji cepat serta merespon bencana dengan tepat. “Melaksanakan misi penyelamatan secara profesional dan bertanggungjawab, sehingga korban jiwa dan kerugian harta benda dapat diminimalisir,” ujarnya. Asren menambahkan, pelatihan TRC dapat dilakukan pada semua stakeholders penyelenggara penanggulangan bencana, baik pemerintah, masyarakat dan pihak swasta. “TRC bertugas melakukan kaji cepat terhadap dampak bencana. TRC juga dapat melakukan pendampingan kepada BPBD dalam kegiatan pertolongan, pencarian dan evakuasi,” ujar Asren seraya menambahkan, bimbingan teknis di Berastagi ini diikuti 80 peserta. (h02)


KEPALA Pelaksana BPBD Sumatera Utara DR. H. Asren Nasution, MA menyematkan tanda peserta pada pelatihan Tim Reaksi Cepat (TRC) BPBD Sumut, Selasa (16/4).

rahkan kepada Cicago. Pada tanggal 13 Oktober 2012 Ahay menyuruh Muhammad Saeful menerima sabu 100 gram dari orang suruhan Aseng di Port Klang Malaysia untuk dibawa ke Medan. Setelah Muhammad Saeful kembali, lalu sabu itu diserahkan kepada Ahay di rumahnya. Lalu Ahay menyuruh Ati untuk menerima sabu-sabu untuk diserahkan kepada Cicago. Tapi sebelum penyerahan itu, mereka keburu ditangkap.

Petugas mengamankan 8 orang tersangka yang terlibat langsung dengan sindikat ini. Namun Ahay yang merupakan otak pengedar sabu ini tewas tertembak petugas saat berusaha melawan dan hendak melarikan diri. “Terdakwanya 1 meninggal dunia dan kami hanya menyidangkan 7 orang terdakwa yang kami jerat dengan Pasal 112, Pasal 113, Pasal 114 dan Pasal 132 Undang Undang nomor 35 tahun 2009,” kata JPU Saut.

WASPADA Jumat 19 April 2013

Terpisah, hakim ketua yang menggelar perkara itu, Marlianis SH, MH, yang ditanya wartawan mengenai ancaman maksimal dari pasal-pasal yang dikenakan JPU terhadap para terdakwa mengatakan, bahwa hukumannya bisa mencapai hukuman mati. “Kalau kita lihat dari Pasal 113, ancaman hukumannya bisa mencapai hukuman mati ataupenjaraseumurhidup,”tutur Marlianis. Sidang ditunda dua pekan mendatang untuk menghadirkan saksi-saksi. (m38)

Pemprovsu Diminta Tuntaskan Sisa Dana Bagi Hasil Pajak Provinsi MEDAN (Waspada): Komisi III DPRD Kabupaten Tapanuli Selatan (Tapsel) mengharapkan Pemerintah Provinsi Sumatera Utara (Pemprovsu) menuntaskan sisa Dana Bagi Hasil Pajak Provinsi sejak 2009 hingga 2013 sebesar Rp18 miliar. Hal itu disampaikan Ketua Komisi III DPRD Tapsel H Mahmud Lubis Sag, didampingi sejumlah anggota komisi kepada wartawan di Hotel Madani Medan, Kamis (18/4). Menurut Mahmud yang didampingi anggota Komisi III, seperti Drs H Asgul Idihan Dalimunthe MSi, Borkat S.Sos, HarisYani Tambunan, M Faisal Siregar ST, dan Drs Mora Siregar, sebelumnya pada hari yang sama, pihaknya sudah menemui Bagian Keuangan Pemprovsu namun berlanjut pertemuan dengan Sekdaprovsu H Nurdin Lubis didampingi Ka Biro Keuangan Pemprovsu. “Kami mendesak agar hak-hak Tapsel tersebut segera dituntaskan, agar sejumlah program yang sudah diparipurnakan DPRD Tapsel dan sempat tertunda karena ketiadaan anggaran, bisa segera dilanjutkan,” kata Mahmud. Disebutkannya, dana bagi hasil tersebut pada 2012 Rp20 miliar, akan tetapi masih belum tuntas Rp5 miliar lagi dan ditotal dari sejak 2009 berjumlah Rp18 miliar. “Kami sangat berharap supaya dana tersebut di tahun ini juga diselesai-

kan pelunasannya. Selain itu, kedepan hendaknya tidak ada lagi ‘anak tiri, anak kandung’,” ujar Mahmud. Menjawab pertanyaan, apa yang melatarbelakangi sehingga DPRD Tapsel, khususnya Komisi III yang membidangi keuangan dan pembangunan, langsung ke Pemprovsu, Mahmud mengatakan, berawal dari pertanyaan dewan kepada Bupati Tapsel. “Ketika itu Bupati Tapsel menyatakan sudah menyurati Pemprovsu, dan saat itu juga kami mengetahui jumlah dana bagi hasil yang belum tuntas sisanya,” tuturnya. Sedangkan anggota Komisi III DPRD Tapsel lainnya, Borkat mengemukakan, dalam pertemuan dengan Sekdaprovsu, dijanjikan sisa dana bagi hasil tersebut dituntaskan di 2014 masuk dalam APBD. Di sisi lain, lanjut Borkat, DPRD Tapsel meminta, khususnya dana Bantuan Daerah Bawahan (BDB) harus ada tolok-ukur atau kriteria khusus. “DPRD Tapsel, terutama Komisi III berharap masa mendatang tidak ada lagi terjadi dana bagi hasil yang tertunda penuntasannya. Tidak kalah pentingnya, tidak lagi dana atau anggaran yang dikait-kaitkan dengan politik-politikan, sebab semuanya demi kepentingan rakyat,” ujar Borkat.(m34)

Soal Status Bacaleg, KPUD Harus Sharing Terkait UU

RIJAL Sirait menyerahkan berkas dan dokumen saat mendaftar di KPU Provsu.


Kader Al Washliyah, Mantan Komisioner KPU Daftar Balon DPD RI MEDAN (Waspada): Kader Al Washliyah/anggota DPRD Sumut Drs H Rijal Sirait mendaftarkan diri sebagai bakal calon anggota Dewan Perwakilan Daerah (DPD) RI di Komisi Pemilihan Umum (KPU) Provinsi Sumatera Utara, Kamis (18/4). Diusung Al Washliyah, Rijal Sirait menyerahkan berkas syarat pencalonan 6.605 dukungan masyarakat yang dibuktikan dengan fotokopi KTP. Penyerahan itu diterima Kabag Teknis, Hukum, dan Hubmas KPU Provsu Maruli Pasaribu SH, di gedung KPU Jln. Perintis Kemerdekaan Medan. Rijal Sirait kepada wartawan mengatakan tentang kesiapan dirinya mencalonkan diri sebagai bakal calon anggota DPDRI. Menurutnya, pencalonan dirinya ke DPD atas kehendak organisasi PW Al Washliyah Sumut. “Ini bukan kehendak pribadi, namun saya siap secara lahir dan batin. Penggalangan dukungan pencalonan saya melalui jalur Al Washliyah,” sebutnya. Kata dia, pencalon dirinya mengusung visi misi di antara-

nya ingin mewujudkan masyarakat Sumut yang memiliki kemampuan ekonomi kerakyatan berbasis syariah. “Selain itu ingin mewujudkan masyarakat yang cerdas dan berperadaban, memiliki daya saing, serta memperjuangkan perundangundangan dan peraturan perekonomian yang memihak kepentingan masyarakat Sumut,” ujarnya. Kemudian, memperjuangkan perimbangan keuangan pusat dan daerah, yang berasal dari pajak dan Sumber Daya Alam (SDA) Sumut. Termasuk memperjuangkan pendidikan masyarakat berbasis peningkatan kecerdasan akhlakul kharimah. Wakil Ketua PW Al Washliyah Sumut Drs H Dariansyah Emde didampingi Wakil Sekretaris Drs H Makmur Ritonga menambahkan, dukungan Al Washliyah terhadap Rijal Sirait ini sudah disosialisasikan ke seluruh Pengurus Daerah (PD) Al Washliyah. Termasuk ke sekolah-sekolah, perguruanperguruan, jamaah-jamaah dan majelis taklim yang dipimpin

ustadz-ustadz Al Washliyah. Turunan Gulo Pada hari yang sama, mantan Komisioner KPU Provsu Turunan B Gulo SH, juga mendaftarkan diri sebagai bakal calon anggota DPD RI di KPU Provsu. Dia dalam pendaftaran tersebut menyerahkan 17.747 dukungan masyarakat yang tersebar di 27 kabupaten/kota se Sumut. Seusai pendaftaran Gulo menjelaskan kepada wartawan, dirinya sudah 10 tahun sebagai komisioner KPU Provsu. “Pasca putusan MK, maka DPD semakin berperan,” katanya. Menurut dia, di Sumut cukup banyak masalah, makanya jika nanti terpilih sebagai anggota DPD RI, ingin turut serta membenahi permasalahan yang ada. Gulo juga menyatakan dukungannya terhadap adanya keinginan untuk pemekaran Nias menjadi Provinsi Kepulauan Nias. Kata dia, jika provinsi itu terwujud, memang awalnya ada kesulitan, namun dengan potensi yang terkandung cukup banyak, maka hal itu akan bisa diatasi.(m34)

MEDAN (Waspada): Pengamat hukum dan tata negara Dr Budiman NPD Sinaga SH, MHum menyarankan, agar KPUD Sumut berikut KPUD kabupaten/kota di Sumatera Utara, lebih banyak melakukan sharing terkait keberadaan berbagai produk hukum dan undang-undang yang berhubungan dengan pemilu, khususnya menyangkut syarat-syarat bacaleg. Hal itu disampaikannya kepada wartawan di Medan, Kamis (18/4), menanggapi adanya kesimpangsiuran di masyarakat soal status bacaleg yang pernah tersangkut masalah hukum “Saya kira,makin banyak sharing, maka akan makin banyak masukan, sehingga KPUD terhindar dari tindakan yang justeru melanggar hukum dan undang-undang. Salah satu yang harus dipahami semua pihak, bahwa sebuah pasal dalam undang-undang tidak dapat berdiri sendiri, apalagi sampai bertentangan dengan undang-undang atau peraturan sejajar atau yang di atasnya,” kata Budiman Sinaga. Dia mencontohkan Putusan MK (Mahkamah Konstitusi) yang kedudukannya lebih tinggi dari undang-undang. “Sehingga siapa pun yang ingin melaksanakan sebuah undang-undang, harus lebih dahulu memahami, apakah undang-undang itu bertentangan secara langsung atau tidak langsung dengan sebuah Putusan MK,” sebutnya. “Kita ambil contoh UU No 8/2012 tentang Pemilu DPR RI, DPRD, dan DPD RI. Pasal 1 angka 1 menyebut, Pemilu adalah sarana pelaksanaan kedaulatan rakyat yang dilaksanakan secara langsung, umum, bebas, rahasia, jujur, dan adil dalam NKRI berdasarkan Pancasila dan UUD 1945. Lalu ada pasal 51 ayat (1) huruf g yang menyebut caleg tidak pernah dijatuhi pidana penjara berdasarkan putusan pengadilan yang telah mempunyai kekuatan hukum tetap karena melakukan tindak pidana yang diancam dengan pidana penjara lima tahun atau lebih,” ujarnya. Menurut dia, di situ ada tambahan penjelasan, persyaratan tidak berlaku bagi seseorang yang telah selesai menjalankan pidananya, terhitung lima tahun sebelum yang bersangkutan ditetapkan sebagai bakal calon serta bukan sebagai pelaku kejahatan berulang–ulang, termasuk yang dipidana penjara karena alasan politik,” tutur Guru Besar FH Universitas HKBP Nommensen ini.

Ditambahkannya, konsideran dan dasar hukum UU No 8/2012 adalah UU No 10/2008 tentang Pemilu DPR RI, DPD RI dan DPRD. “MK telah membuat putusan No 4/PUU-VII/2009 yang mengadili bahwa Pasal 12 huruf g dan Pasal 50 ayat (1) huruf g UU No 10/2008 serta Pasal 58 huruf f UU No 12/2008, bertentangan dengan UUD 1945 secara bersyarat (conditionally unconstitutional),” kata Budiman. “Artinya, karena konsideran dari UU No 8/ 2012 adalah UU No 10/2008 yang oleh MK diangap bertentangan dengan UUD 1945, maka secara otomastis, UU No 8/2012 ini pun turut bertentangan dengan UUD 1945,” ujarnya seraya menegaskan, materi muatan peraturan perundang–undangan yang berisi syarat sebagaimana disampaikan di atas harus dimaknai sesuai Putusan MK, bahwa ketentuan tersebut bertentangan dengan UUD 1945. “Lalu kita ambil contoh Pasal 146 KUHP yang menyebut, barang siapa dengan kekerasan atau dengan ancaman kekerasan membubarkan suatu sidang badan pembentuk undang–undang, badan pemerintah atau badan perwakilan rakyat yang diadakan oleh atau atas nama pemerintah, atau memaksa badan–badan tersebut menerima atau pun menolak suatu keputusan atau menyingkirkan seorang ketua atau anggota dari sidang semacam itu, dihukum dengan hukuman penjara selama–lamanya sembilan tahun. Dikaitkan dengan pandangan soal politik tadi, maka dapat diketahui dengan jelas bahwa Pasal 146 KUHP adalah berkaitan dengan penyelenggaraan negara dan pemerintahan sehingga dapat dikatakan sebagai kegiatan politik,” papar Budiman. Artinya, lanjut dia, setiap orang yang dipidana karena pasal 146 KUHP, jelas adalah karena alasan politik. Secara tidak langsung membuat syaratsyarat dalam pasal 51 ayat (1) huruf g UU No 8/ 2012 tidak berlaku bagi mereka. Dia lalu membuat sebuah ilustrasi soal ini. “Syarat memilih ada dua, yaitu telah berusia 17 tahun atau sudah menikah. Lalu kalau seorang ternyata sudah menikah, maka masalah umur tidak lagi dipertanyakan. Serupa halnya dengan ini, kalau seseorang sudah jelas dipidana dengan alasan politik, maka persyaratan lain terkait pidana, otomatis gugur,” sebutnya. (m14)

Calon Rektor IAIN SU Audiensi Ke Waspada MEDAN (Waspada): Calon Rektor Institut Agama Islam Ne[geri Sumatera Utara (IAIN SU) Prof Dr Asmuni MAg, beserta rombongan beraudiensi sekaligusmenjalinsilaturahmikekantor Harian Waspada Jln. Letjen Suprapto Medan, Kamis (18/4) Dalam kunjungan itu, Prof Asmuni yang juga Ketua PW Muhammadiyah Sumut didampingi Prof Dr Katimin MAg dari Nahdlatul Ulama, Prof Syahrin Harahap MA dari Al Washliyah, Prof Dr Abdul Mukti MA dari KAHMI, dan Dr M Iqbal MA. Mereka diterima Wakil Penanggung Jawab Harian Waspada H Sofyan Harahap dan Kabag Humas H Erwan Effendi. Prof Asmuni menyampaikan aspirasinya terkait pemilihan Rektor IAIN SU yang barubaru dilaksanakan. Dari beragam pihak yang mendukungnya menjadi Rektor IAIN Sumut menunjukkan keragaman

dukungan. “Jadi tidak benar kalau ada rumor yang mengatakan kalau saya jadi Rektor IAIN akan di”Muhammadiyah-kan”. Kita ini hadir dalam kebersamaan, baik dari latar belakang maupun dari segi etnis. Saya orang Jawa, pak Syahrin orang Mandailing, dan Pak Mukti orang Aceh. Jadi sangat beragam,” katanya. Menurut dia, dukungan berbagai elemen, merupakan modal utama baginya dalam membangun IAIN Sumut. Dia juga merupakan salah satu perancang perubahan IAIN Sumut menjadi UIN Sumut dengan berbagai konsep yang telah dipersiapkan. Dia berencana untuk melanjutkan konsep tersebut dalam rangka percepatan pembangunan IAIN Sumut ke depan, termasuk di antaranya membangun Badan Layanan Umum (BLU) yang merupakan

investasi bagi IAIN Sumut. “Niat kita menjadi rektor periode berikutnya adalah untuk membangun IAIN Sumut yang memiliki akhlak yang Islami serta mutu IAIN yang lebih baik lagi. Saya melihat UIN Malang, saya memimpikan untuk IAIN Sumut bisa seperti itu,” tuturnya. Prof Asmuni mengakui, kunjungannya tersebut selain menjalin silaturahmi, juga merasa memiliki misi yang sama dengan Waspada yakni menegakan kebenaran dan syariat Islam. Sementara itu, Wakil Penanggung Jawab Harian Waspada H Sofyan Harahap berharap, siapa pun yang kelak menjadi pemimpin IAIN Su-mut, agar dapat memimpin per-guruan tinggi tersebut dengan baik, serta memiliki akhlak yang Islami tentunya “Semoga niat baik yang di sampaikan Prof As-muni bisa terwujud dengan baik. Kita sebagai media massa tetap

menampung aspirasi untuk disampaikan kepada masyarakat luas,” ujarnya. Sebelumnya, pemilihan Rektor IAIN Sumut diikuti tiga

calon. Dari hasil pemilihan dua calon yakni Prof Asmuni dan Prof Nur Ahmad Fadhil Lubis mendapatkan suara sama yaitu 20 suara. Setelah dua kali pemi-

lihan dengan hasil yang sama, maka penentuan siapa yang bakal menjadi Rektor IAIN SU diserahkan ke Menteri Agama untuk diputuskan.(cay)

Waspada/Afli Yarman

CALON Rektor IAIN SU Prof Dr Asmuni MAg (tiga kanan) beserta rombongan foto bersama Wakil Penanggung Jawab Waspada H Sofyan Harahap (tiga kiri), disela-sela audiensi ke kantor Harian Waspada, Kamis (18/4).


WASPADA Jumat 19 April 2013


Presiden: Birokrasi Berbelit-belit Ungkap Saja Di Media Sosial JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono (SBY) menyoroti birokrasi yang masih saja menjadi penghambat, baik di pusat maupun di daerah. Karena itu, presiden menyarankan agar birokrasi yang berbelit-belt ungkap saja kepada publik melalui media sosial. Pasalnya, sanksi sosial terkadang lebih efektif dibanding sanksi lainnya.

Pemberlakuan Dua Macam Harga BBM Bertentangan Dengan UUD 45


DUBES Amerika Untuk Indonesia, Scot Marciel menyerahkan penghargaan Champion Award for Exceptional Work in the Fight Against TB kepada Menteri Kesehatan Dr Nafsiah Mboi di Kantor Kementerian Kesehatan, Jakarta, Kamis (18/4). Indonesia dinilai lembaga bantuan Amerika Serikat (USAID) berhasil mengeliminasi penyebaran penyakit Tuberculosis (TB) di Indonesia selama lebih dari satu dekade ini.

TB Masih Sulit Ditaklukan JAKARTA (Waspada): Tuberkulosis (TB) masih menjadi penyakit menular yang sulit ditaklukan. Menteri Kesehatan Nafsiah Mboi menegaskan hingga saat ini tidak ada satupun negara di dunia yang terbebas dari TB. “Tidak ada negara di dunia yang bebas sama sekali dari TB. Jadi kalau ditanya apakah Indonesia bebas TB? Tentu saja jawabnya tidak,” ujar Menkes usai menerima secara langsung Champion Award for Exep-tional Work in The Fight Againts TB dari Duta Besar Amerika Serikat untuk Indonesia, Scot Marciel di Kantor Kementerian Kesehatan, Jakarta, Kamis (18/4). Pada 20 Maret, penghargaan ini sudah diberikan oleh lembaga donor Amerika Serikat (USAID) kepada Duta Besar Indonesia untuk Amerika

Serikat, Dino Patti Djalal. Indonesia meraih penghargaan USAID Global Healt atas prestasi luar biasa dalam penanggulangan TB. Dikatakan Nafsiah, meski sulit ditaklukan, Indonesia telah membuat kemajuan luar biasa dalam pengelolaan program pengendalian TB yang efektif. Sebuah strategi bernama Directly Observes Treatment Short-course (DOT) dilaksanakan lebih dari satu dekade ini dan dianggap berhasil. “Tingkat keberhasilan pengobatan TB lebih dari 90 persen. Sementara deteksi kasus TB baru di atas 70 persen secara konsistewn telah tercapai. Dengan pencapaian itu, Indonesia telah memberikan kontribusi signifikan dalam mencapai target eliminasi TB global,” tambah Nafsiah. Kesulitan terbesar yang

menjadi tantangan penanganan TB adalah penyediaan sarana dan prasarana kesehatan yang lebih baik. Demikian juga pembiayaan pengobatan TB, menjadi satu hal yang sangat krusial. “Kita memang butuh dana. Tapi sebaiknya kita tidak tergantung pada dana donor,” tegas Nafsiah. Scot Marciel mengatakan, Indonesia adalah partner Amerika Serikat dalam bersamasama memberantas berbagai penyakit di dunia, salah satunya TB. Karena jumlah penduduk yang banyak, maka keberhasilan adalah sebuah prestasi besar,” tandas Scot. Dia berharap kerja sama dengan Indonesia lewat pendanaan dan asistensi dapat terus berjalan. “Apa yang sudah dilakukan pemerintah Indonesia sangat berarti bagi dunia,” tandas Scot. (dianw)

JAKARTA ( Waspada): Pakar Hukum Tata Negara dari Universitas Parahyangan Bandung, Jawa Barat, Asep Warlan Yusuf mengingatkan pemerintah untuk membatalkan rencana atau skema untuk memberlakukan dua macam harga berbeda terhadap produk BBM bersubsidi saat ini. Skema tersebut tegasnya bertentangan dengan pasal 33 ayat 3 UUD 1945 dan kalau diberlakukan, maka Mahkamah Konstitusi sudah pasti akan membatalkannya sehingga rencana ini hanya akan membuang energi saja. “Pasal 33 ayat 3 berbunyi bumi, air dan kekayaan alam yang terkandung didalamnya dikuasai oleh negara dan dipergunakan untuk sebesar-besar kemakmuran rakyat.Pasal ini tidak membedakan antara rakyat miskin dan rakyat kaya. Rencana ini jelas membedakan rakyat antara si miskin dan si kaya dalam hal pelayanan negara,” ujar Asep ketika dihubungi wartawan, Kamis (18/4). Seperti diketahui pemerintah hampir dipastikan menerapkan rencana dual price BBM bersubsidi. Dengan skema dual price, maka BBM subsidi, baik jenis premium maupun solar, dijual dengan dua varian harga. Pertama, harga subsidi penuh Rp4.500 per liter untuk angkutan umum dan sepeda motor. Kedua, harga berkisar Rp6.500 – Rp7.000 per liter untuk mobil pribadi lantaran subsidinya dikurangi. Menurut Asep, rakyat yang “kaya” sudah mengeluarkan uang lebih banyak untuk negara ini, dengan membayar pajak yang lebih besar, sehingga sangat inkonstitusional jika mereka pun tidak bisa mendapatkan layanan yang sama dengan rakyat “miskin” dalam hal mendapatkan BBM. Kalaupun mau dinaikan atau subsidi dihilangkan, maka menurutnya, pemerintah harus memiliki program yang jelas dari anggaran subsidi yang dikurangi atau tidak terpakai itu. (aya)


BEBERAPA guru Karate-do Tako Indonesia dipimpin Guru Anthony R. Simanjuntak (Dan VII), bersama sesepuh Karawang yang juga guru spritual menemui mantan Ketua Umum DPP Partai Demokrat Anas Urbaningrum.

Pertama Di Indonesia, RSCM Berhasil Transplantasi Ginjal Pada Anak Guru Karate-do Tako Temui Anas

JAKARTA (Waspada): Cliff Yehezkiel Mambu berusia 12 tahun adalah anak yang sangat beruntung. Dia menjadi anak pertama yang berhasil menjalani operasi transpantasi ginjal pada anak Rumah Sakit Umum Pusat Nasional dr Cipto Mangunkusumo. Cliff beruntung dua kali. Ada pendonor yang baik hati dan cocok serta tim dokter yang hebat. “Cliff menerima ginjal dari donor berusia 21 tahun dan melaksanakan operasi 13 Maret 2013 lalu,” kata Direktur Utama RSCM CH Soejono, pada acara jumpa pers yang didampingi Tim Bedah terdiri dari Departemen Ilmu Kesehatan Anak, Bedah Urologi, Ilmu Penyakit Dalam dan Anestesi di RSCM, Senin (15/4). Operasi ginjal dilakukan tim dokter yang diketuai oleh Prof. Dr. dr. Endang Susalit. Sebelumya, Cliff ditangani dokter anak konsultan ginjal dan hipertensi, Prof. Dr Taralan Tambunan. Dalam dunia medis, operasi transplantasi ginjal pada anak

memiliki kesulitan lebih tinggi dibandingkan pada pasien dewasa. Apa yang terjadi pada Cliff adalah keberhasilan yang pertama di Indonesia. “Operasi transplantasi ginjal pada anak, baru pertama kali ini dilakukan di Indonesia dan berhasil. Untuk pasien dewasa, RSCM telah melakukan transplantasi ginjal sejak tahun 2010,” ujar Soejono. Cliff adalah pasien gagal ginjal kronis stadium 5 yang tidak diketahui penyebabnya. Saat pertama didiagnosis tahun 2010, Cliff berobat ke Malaysia. Ditubuhnya dipasang alat cuci darah (continuous ambulatory peritoneal dialysis/CAPD). Kira-kira setahun lalu, orang tua Cliff James Mambu dan Serli Katili, mendapatkan donor ginjal yang cocok. Dia adalah seorang donor yang memiliki hubungan emosi dengan Cliff, yaitu seorang lelaki berusia 21 tahun. “Kebetulan cocok dan akhirya orang tua Cliff setuju untuk melaksanakan transplantasi ginjal di RSCM,” imbuh Soejono. Pada kesempatan itu Ketua

Tim Transplantasi Ginjal RSCM, Endang Susalit mengatakan, meski merupakan pengalaman baru, transplantasi ginjal pada anak bukan hal mustahil. Hal yang sama dikatakan Dokter konsultan bedah urologi yang terlibat dalam operasi, dr. Arry Rodjani. Dia mengatakan, operasi yang dilakukan tidak beda dengan operasi transplantasi ginjal pada orang dewasa. “Persiapan untuk transplantasi sejak Desember 2012 hingga Januari 2013”, kata Arry. Kini, satu bulan lebih sejak Cliff menjalani operasinya. Kondisinya selama satu bulan pascaoperasi sangat baik. Tidak ditemukan tanda penolakan tubuh terhadap organ barunya. Sekarang fisiknya lebih sehat. Hal ini ditandai dengan kondisi air seni yang bagus atau tidak lagi mengandung darah. Demikian juga tekanan darahnya juga mendekati normal. “Meski demikian, pemantauan tetap dilakukan,” jelasTaralanTambunan, yang selalu memantau perkembangan kesehatan Cliff.(dianw)

JAKARTA ( Waspada): Beberapa guru Karate-do Tako Indonesia dipimpin Guru Anthony R. Simanjuntak (Dan VII), bersama sesepuh Karawang yang juga guru spritual menemui mantan Ketua Umum DPP Partai Demokrat Anas Urbaningrum. “Sesama anak bangsa, kami sangat prihatin, melihat tokoh muda seperti Anas Urbaningrum, menghadapi permasalahan yang cukup berat. Jadi, kami hanya datang untuk memberi dukungan moral,” kata Antony Simanjuntak kepada wartawan, Selasa (16/4) di Jakarta, menjelaskan maksud rombongannya menemui Anas Urbaningrum, di rumahnya kawasan Duren Sawit, Minggu (15/4) Jakarta Timur. Hal senada dikemukakan Abah Karawang yang menyatakan dia ikut menemui Anas agar dia sabar dan selalu senantiasa berdoa untuk segala kelancaran kegiatannya. Anas Urbaningrum menyampaikan terimakasih atas kunjungan para guru Karate-do Tako Indonesia, yang merasa peduli terhadap nasib generasi muda dan masa depan bangsa dan negara Indonesia. “ Kelemahan sebagian besar anak bangsa adalah kurangnya perhatian dan kepedulian terhadap nasib generasi dan prospek bangsa ke depan” ujar Anas Urbaningrum. (aya)

Hal ini disampaikan SBY di hadapan pengusaha muda dalam acara Indonesian Young Leaders Forum 2013 yang digelar Himpunan Pengusaha Muda Indonesia (HIPMI) di Jakarta, Kamis (18/4). “Mari kita bersinergi agar Indonesia benarbenar siap. Kalau kita saling salah menyalahkan enggak ada habisnya,” ajak Presiden. SBY mengakui masih banyak yang perlu diperbaiki di banyak sektor, baik di pemerintah pusat maupun daerah. “Semua pihak harus segera memperbaiki dan jangan saling menyalahkan. Saya melihat masih ada yang saling menyalahkan,”ujarnya. Dalam menghadapi ASEAN Economic Community (AEC) di tahun 2015, Presiden meminta agar semua pihak mulai mempersiapkan diri untuk menghadapi hal tersebut. Dari

sisi pemerintah, Presiden akan membentuk Komite Nasional untuk mempersiapkan hal itu. “Mau tidak mau, suka tidak suka Indonesia harus siap. Mari kita siapkan daya saing agar kita tidak kalah ketika sudah menjadi kawasan ekonomi. Jadi, jangan ada pesimisme. Mari kita betulbetul optimis bahwa kita bisa persiapkan. Kita juga punya potensi besar. Yang penting bukan optimisme kosong,” tuturnya. Presiden juga meminta semua pihak tidak takut dan gamang menghadapi 2015. Ia yakin Indonesia bisa lantaran telah diuji krisis demi krisis sejak merdeka. Terakhir, katanya, Indonesia lulus dari krisis ekonomi tahun 2008. Bahkan, ekonomi Indonesia terus tumbuh. SBY melanjutkan, salah satu masalah yang harus diselesaikan Indonesia adalah me-

ningkatkan kapasitas sumber daya manusia (SDM) agar bisa bersaing. Kemudian adalah terkait Sumber Daya Alam (SDA) yang harus diiringi dengan peningkatan industri yang membuat bahan mentah menjadi bernilai tambah. “Kalau tidak diubah menjadi industri maka kita pastikan akan habis,” papar SBY. Ketiga adalah persoalan logistik nasional yang menyebabkan harga-harga barang menjadi mahal. Selain itu infrastruktur yang masih minim dan perlu ada percepatan pembangunan. “Terakhir adalah iklim investasi dan kemudian eksternalisasi yang harus diperbaiki. Seperti perbankan masih dinilai kalah efisien dibandingkan negara-negara ASEAN. Ini harus menjadi tugas bersama,” ungkap Presiden. (j03)

Anggota DPR Dapil Sumut Dukung Inalum Jadi BUMN Baru JAKARTA (Waspada): Meski proses perundingan dengan pihak Jepang soal Indonesia Asahan Aluminium (Inalum) masih berlangsung, namun anggota DPR RI dari daerah pemilihan Sumut yang juga anggota Komisi XI membidangi keuangan, Ir Nurdin Tampubolon (foto) , memberi dukungan penuh atas langkah yang diambil Kementerian Badan Usaha Milik Negara (BUMN) dan sudah memastikan Inalum jadi Badan Usaha Milik Negara (BUMN) per 1 November 2013. “Pembentukan BUMN baru untuk Inalum, pasca selesainya kontrak dengan perusahan Jepang Nippon Asahan Alumunium Co. Ltd (NAA), merupakan langkah yang baik. Apa lagi nantinya, seluruh jajaran direksi dan komisaris perusahaan dijabat oleh orang Indonesia,” ujar Nurdin Tampubolon menjawab Waspada, Kamis (17/4) di Jakarta, menanggapi Menteri BUMN Dahlan Iskan yang menyebutkan Inalum akan menjadi BUMN yang ke 143. Nurdin yang pernah berkarir di Inalum yakin dengan kepemilikan 100 persen atas Inalum oleh Pemerintah Indonesia, maka BUMN baru yang menangani Inalum itu nanti dapat mengembangkan perusahaan itu sebab aluminium, merupakan industri yang sangat strategis lantaran banyak dibutuhkan bagi industri hilir, seperti industri makanan dan minuman, susu, kabel bertegangan tinggi, bingkai jendela dan badan pesawat terbang, peralatan rumah tangga dan banyak lagi. “Kebutuhan pasar domestik akan aluminium masih tinggi, apalagi selama ini kita masih impor untuk menutup kekurangan,” sambungnya. Selebihnya, Indonesia juga memiliki bahan

dasar (raw material) bagi aluminium, yaitu bauksit, yang banyak terdapat di Kalimantan. Maka, jika Inalum dikelola BUMN baru itu sepenuhnya, otomatis impor bisa dikurangi atau distop. “Kita tidak kekurangan apaapa untuk menguasai industri aluminium. Teknologi, kita kuasai. Sumber daya manusia, ada. Bahan baku tersedia,” tegasnya. Soal masih belum adanya kesepakatan harga antara Indonesia dengan NAA terkait aset perusahaan Inalum, hingga mencapai 140 juta dolar AS, Nurdin yakin masalah itu tidak menjadi alasan untuk tidak mengambilalih Inalum. “ Masalah beda nilai buku BPKP bisa dinegosisai lagi, dan Tim Perundingan Inalum yang diketuai Menteri Perindustrian akan menyusun strategi perundingan,” ujarnya. Meski Indonesia-Jepang memiliki hubungan bilateral yang sangat erat, Nurdin Tampubolon mengingatkan agar pemerintah lebih mempertimbangkan dampak positif dari penguasaan PT Inalum, terutama untuk memenuhi kebutuhan aluminium industri manufaktur nasional serta memanfaatkan semaksimal mungkin

proyek tersebut untuk mendorong pertumbuhan ekonomi di Sumut. Untuk Danau Toba Pada sisi lain, Nurdin Tampubolon menginggatkan bahwa kelangsungan pabrik aluminium sangat tergantung dari keberadaan air Danau Toba. Untuk itu, Nurdin menyarankan, jika nanti sudah menjadi BUMN baru, maka harus diprioritaskan untuk menyisihkan dana menjaga kelestarian hutan dan air Danau Toba. Jika hutan gundul di sekitar kawasan Danau Toba, maka debit air yang mengalir ke sungai Asahan menjadi kecil, padahal air Danau Toba itu menjadi nafas dari proyek raksasa itu. “Penggundulan hutan mengakibatkan tidak stabilnya debit air Danau Toba, bukan hanya mencoreng wajah kepariwisataan Danau Toba, tetapi sudah mengancam kelangsungan seluruh proyek Asahan,” tegas Nurdin. Ketua DPP Partai Hanura ini mengakui penggundulan hutan di kawasan Danau Toba, juga telah mengancam kehidupan masyarakat yang bermukim di pinggiran Danau Toba. Pada musim hujan tiba, sebagian besar daerah yang berada di sekitar kawasan danau terancam bencana alam, seperti banjir bandang dan longsor. Serapan air Danau Toba itu harus diselamatkan, jika tidak maka perairan Danau Toba akan terus menurun dan mengancam kelangsungan beberapa proyek besar di sepanjang sungai Asahan, yang merupakan sungai aliran air Danau Toba. Di samping itu, juga akan merugikan Sumut, sebab Danau Toba merupakan salah satu ikon kunjungan wisata,” jelas Nurdin Tampubolon. (aya)

Rizal Ramli: Bulog Jangan Hanya Mengurusi Beras JAKARTA ( Waspada): Mantan kepala Badan Urusan Logistik (Bulog) Rizal Ramli minta pemerintah segera meningkatkan peran dan fungsi Bulog agar tidak hanya mengurusi beras. Lewat revitalisasi dan reposisi, Bulog bisa menangani produk pangan lain, seperti gula, kedelai, jagung dan daging sapi. Kebijakan ini bisa menanggulangi dominasi kartel yang selama ini sangat merugikan negara dan rakyat Indonesia. “Sebaiknya Bulog juga diberi wewenang mengurusi gula, jagung, kedelai dan daging sapi. Ini bukan monopoli, tapi hanya untuk stabilisasi harga,”ujar Rizal Ramli usai bertemu Kepala Bulog Sutarto Alimoeso di Jakarta, Kamis (18/4). Rizal Ramli menambahkan, reposisi Bulog justru untuk mengurangi dominasi pengusaha-pengusaha yang beroperasi bagai kartel di sejumlah komoditas tertentu. Lagi pula, dengan perluasan peran dan fungsi ini, Bulog akan memperoleh pendapatan lebih baik sehingga bisa mengurangi subsidi pemerintah. Bahkan tidak mustahil Bulog bisa membiayai program raskin tanpa harus membebani APBN. Di sisi lain, Rizal Ramli yang dinobatkan sebagai calon presiden alternatif versi The

President Centre ini mengatakan Bulog pernah punya rekam jejak buruk di masa silam. Di masa Orde Baru, Bulog adalah sarang korupsi, kolusi dan nepotisme (KKN) serta mesin uang untuk kepentingan penguasa. Kendati Kepala Bulog silih berganti, peran seperti itu kembali terus berulang. Akibatnya, hampir semua Kepala Bulog pernah masuk penjara. Boleh dikatakan hanya Jusuf Kalla dan Rizal Ramli yang tidak bermasalah dengan hukum. Ketika krisis moneter 1998, International Monetary Fund (IMF) memaksa pemerintah Indonesia memangkas banyak fungsi Bulog dalam hal stabilisasi harga, dan hanya diberikan wewenang untuk mengurusi beras. Namun dalam perjalanannya, ternyata diamputasinya wewenang Bulog itu telah menimbulkan kartel-kartel baru di komoditas gula, kedelai, jagung, dan daging sapi. Mereka sangat leluasa memainkan harga hingga di atas 100 persen di atas harga internasional yang sangat merugikan rakyat. “Saya pernah menjadi Kabulog periode 2000-2001.Waktu itu Bulog berhasil saya benahi hingga menjadi transparan dan sangat efisien. Setelah masa saya Bulog memang sempat mengalami hal-hal buruk. Tapi

saya yakin, Bulog di bawah pak Sutarto sekarang sudah jauh lebih baik. Dengan menerapkan good corporate governance dan transparansi, Bulog kini bisa diberi kepercayaan untuk juga menangani komoditas selain beras. Gula, jagung, kedelai, dan daging sapi adalah beberapa komoditas yang selama ini dimainkan harganya oleh kelompok Kartel,” papar Rizal Ramli yang juga mantan Menteri Keuangan itu. Rizal Ramli yang juga mantan Menko Perekonomian ini berpendapat, guna merealisasikan gagasan reposisi dan revitalisasi Bulog tersebut, tidak diperlukan UU khusus. Sebab, akan memerlukan proses panjang dan waktu lama jika harus diterbitkan UU baru. “Sehubungan dengan itu saya mendesak segera diterbitkannya Peraturan Pemerintah (PP) yang mengatur reposisi Bulog. Dalam waktu dekat saya juga akan segera menemui Menteri Perdagangan dan Menteri Pertanian terkait reposisi peran Bulog tersebut. Sebab, biar bagaimana pun harus ada koordinasi dengan Kementerian Perdagangan dan Kementerian Pertanian agar rencana ini bisa segera direalisasikan,” ungkap penasehat ahli Perserikatan Bangsa Bangsa ini.(J07)


PESERTA sosialisasi dan diskusi Kode Etik Filantropi Media Massa foto bersama dengan Ketua Tim Perumus Antonius Eddy Sutedja, Anggota Haryanto, Ketua PWI Sumut M Syahrir, dan Komisi Informasi Publik Sumut M Zaki Abdullah.

Filantropi Bagian Dari Kepedulian Media Massa MEDAN (Waspada): Filantropi atau aktivitas media massa dalam menjembatani serta menggalang kedermawanan sosial masyarakat merupakan perwujudan dari kepedulian sosial serta bagian dari fungsi dan peran sosial media massa. Hal itu dikemukakan Ketua Tim Perumus Kode Etik Filantropi Media Massa (KEFM) Antonius Eddy Sutedja pada sosialisasi dan diskusi yang digelar Perhimpunan Filantropi Indonesia (PFI) bekerjasama dengan Persatuan Wartawan Indonesia (PWI) Cabang Sumatera Utara (Sumut) di Hotel Soechi Medan, Kamis (18/4). Hadir saat itu Anggota Tim Perumus KEFM Haryanto, Ketua PWI Sumut Drs Muhammad Syahrir, Ketua Komisi Informasi Publik Sumut M Zaki Abdullah, Ketua Persatuan Radio Siaran Swasta Nasional Indonesia Sumut Fauzi Usman, Wakil Ketua Serikat Perusahaan Pers Sumut H Baharuddin,

Ketua Ikatan Jurnalis Televisi Indonesia Sumut Edi Irawan, unsur Perhimpunan Filantropi Indonesia Sukesi Damayanti, para Pemred dan utusan media massa di Sumut. Lebih lanjut dikatakan Antonius, mengingat filantropi berkaitan dengan kredibilitas media massa di mata masyarakat, maka aktivitas ini harus dilakukan dengan cara-cara yang baik, benar, transparan, akuntabel, serta penuh kesadaran dan tanggung jawab. Dijelaskan, Kode Etik Filantropi Media Massa yang disahkan Ketua Dewan Pers Prof Dr Bagir Manan, SH, MCL pada 11 Januari 2013 itu mengacu pada Kode Etik Jurnalistik (KEJ), PedomanPerilakuPenyiarandan Standar Program Siaran (P3SPS), dan Pedoman Media Siber. Kemudian, Pedoman Akuntabilitas Pengelolaan Bantuan Kemanusiaan di Indonesia dan Undang-Undang serta peraturan lain yang berkaitan

dengan penggalangan, pengelolaan, dan pendayagunaan sumbangan masyarakat. “Kode Etik Filantropi ini berlaku dan harus ditaati oleh semua pengelola sumbangan masyarakat di media massa, baik yang berbentuk yayasan maupun kepanitiaan,” katanya. Adapun fungsi utama kode etik sebagai pedoman umum, rujukan, dan instrumen edukasi bagi pengelola dalam penggalangan atau penerimaan, pengelolaan, serta penyaluran sumbangan masyarakat, terangnya. Selain itu, imbuh Antonius, kode etik juga berfungsi sebagai regulasi internal yang mengikat bagi praktisi media saat menjalankan kegiatan filantropi. Sementara Anggota Tim Perumus Haryanto menjelaskan, pengelola sumbangan masyarakat di media massa harus dilandasi nilai, prinsip dan semangat kesukarelaan, independensi, profesionalisme, tidak diskriminasi, tepat guna dan

tepat sasaran, serta komitmen yang tegas. Dalam hal sosialisasi program, katanya, pengelola tidak diperbolehkan menggunakan gambar atau tayangan yang mengandung hal-hal yang bertentangan dengan perundangundangan dan peraturan tentang isi media massa dan hukum positif yang berlaku. “Jika menggunakan gambar, tayangan, atau suara yang berasal dari korban atau keluarganya yang dengan sengaja diproduksi untuk keperluan sosialisasi dan publikasi kegiatan penggalangan dana, harus dengan izin tertulis dari korban atau keluarganya,” jelas Haryanto. Pengelola sumbangan masyarakat di media massa, katanya, juga harus mempertimbangkan frekuensi atau jumlah penayangan, guna menghindari kesan mengeksploitasi korban. Dalam hal pengelolaan sumbangan, jelas Haryanto, pe-

ngelola filantropi harus mencatat dan mendokumentasikan dengan baik dan cermat data atau informasi mengenai penyumbang seperti nama, alamat, bentuk dan jumlah sumbangan yang diberikan. “Begitu juga dalam pengelolaan keuangan, pengelola sumbangan harus menerapkan sistem dan prosedur sesuai peraturan dan standar akuntansi yang berlaku. Menghormati hak penyumbang yang menolak nama dan indentitasnya dipublikasikan,” terangnya. Sebelumnya Ketua PWI Sumut M Syahrir menjelaskan, sosialisasi dan diskusi digelar untuk menambah wawasan pengelola media massa di Sumut. Mengingat Kode Etik Filantropi tergolong regulasi baru yang dikeluarkan Dewan Pers sehingga perlu disosialisasikan untuk lebih mencerahkan pengelola media massa dalam mengelola sumbangan masyarakat. (m08)


Luar Negeri

WASPADA Jumat 19 April 2013

Mantan Presiden Musharraf Lepas Dari Tangkapan Polisi ISLAMABAD, Pakistan (AP): Mantan Presiden Pakistan Pervez Musharraf dilaporkan melarikan diri dari tangkapan polisi setelah pengadilan memerintahkan penangkapan atas dirinya. Musharraf dikabarkan sudah berada kembali di markasnya yang dilindungi dengan ketat oleh pengawal pribadinya. Stasiun televisi lokal Pakistan merekam adegan dramatis ketika Musharraf melompat masuk ke mobil SUV berwarna hitam. Pemimpin militer itu lari dari Pengadilan Tinggi dengan tim keamanannya yang bergelantungan di sisi kendaraan yang ditumpanginya. Mobilitupun melesat dengan kecepatan tinggi menuju ke sebuah markas besar bak benteng di pinggiran Islamabad, ibukota Pakistan. Markas Musharraf memiliki tembok yang sangat tinggi, terdapat pula kawat-kawatberduriyangmelindungigerbangdepandansisitembok markasitu.Selainitu,terlihatjugasebuahmenarapenjagadisisibangunan itu, demikian menurut The Associated Press, Kamis (18/4). Sebelumnya, Reuters melaporkan, pengadilan Pakistan memerintahkan penangkapan mantan Presiden Pervez Musharraf Kamis terkait tuduhan pertikaiannya dengan pengadilan di tahun 2007ketikadiamasihberkuasa,laportelevisidanseorangpembantunya. Mantan Kepala Angkatan Bersenjata itu kembali ke Pakistan bulan lalu setelah hampir empat tahun tinggal di pengasingan untuk ikut dalam pemilihan umum 11 Mei mendatang, meski ada kemungkinan ditangkap karena berbagai tuduhan dan ancaman kematian dari Taliban Pakistan. Para pejabat pemilihan melarang Musharraf mencalonkan diri untuk jabatan di Majelis Nasional awal minggu ini, sehingga secara efektif menggagalkan upayanya untuk mendapatkan kembali tempat dipolitik.MantanPMNawazSharif,yangdigulingkanMusharrafdalam kudeta tahun 1999, dipandang sebagai calon unggulan. Pengadilan Tinggi Islamabad memerintahkan agar Musharraf ditahan terkait tuduhan bahwa dia melakukan pengkhianatan ketika memecat beberapa hakim senior dan mengumumkan kekuasaan darurat ketika dia memperjuangkan kekuasaan. Polisi tidak segera bertindak untuk melaksanakan perintah penangkapan itu dan Musharraf meninggalkan pengadilan dengan diapit pengawal pribadinya.(m23/m10)

Mubarak Dipindah Ke Penjara Dari Rumahsakit Militer KAIRO, Mesir (Reuters): Mantan Presiden Mesir Hosni Mubarak dipindah dari rumahsakit militer di Kairo ke penjara Torah di kota yang sama Kamis (18/4), kata kantor berita MENA. Perintah pemindahan tersebut dikeluarkan Rabu atas rekomendasi satu tim medis setelah dia terlihat lebih sehat setelah persidangannya dibatalkan Sabtu lalu. Pemindahan Mubarak dari rumahsakit sebelumnya ditangguhkan karena ratusan pendukung memblokir jalan di depan rumahsakit RabumalamsebagaibentukprotesterhadappengembalianMubarak ke penjara, kata MENA, Sidang atas dirinya terkait tuduhan jatuhnya korban tewas di pihak demonstran dalam pergolakan yang akhirnya menggulingkan dirinya dari tampuk kepresidenan akan dimulai 11 Mei mendatang, kata pengadilan banding Kairo Rabu. Sidang tersebut merupakan upaya pertama untuk persidangan kembali yang gagal Sabtu ketika hakim yang memimpin sidang mundur dari kasus tersebut dan menyerahkannya ke pengadilan lain. Mustafa Hasan Abdullah dikecam banyak pihak karena membebaskan petugas-petugas keamanan yang dituduh menyerang para pengunjukrasa dalam insiden di mana massa diserang oleh sejumlah pria penunggang unta. Banyak warga Mesir marah ketika melihat Mubarak (84), yang tahun lalu menderita sakit parah, terlihat dalam kondisi sehat, tersenyum dan melambai pada public di pengadilan Sabtu, sehingga mereka minta agar dia dikembalikan ke penjara. Kantor penuntut umum mengatakan pihaknya memutuskan Mubarak dikembalikan ke penjara Torah di pinggiran kota Kairo. Mubarak diangkut dengna mobil dari RS Militer Maadi menuju penjara dalam penjagaan ketat oleh polisi Kamis, lapor MENA.(m23)

MILF Dan Filipina Ingin Pertahankan Komitmen MANILA, Filipina (Waspada): Pemerintah Filipina dan Front Pembebasan Islam Moro (MILF) ingin mempertahankan komitmen mereka untuk mewujudkan perdamaian dan sehubungan dengan hal itu kedua pihak juga harus meneliti berbagai hal yang dapat mengundang gangguan dalam upaya tersebut. Komitegencatan senjata pemerintahFilipina dan MILF bersamasama menyelidiki dugaan pelanggaran gencatan senjata oleh militer ketika memasuki wilayah pemberontak dalam mengejar tersangka teroris anggota Abu Sayyaf. Militer mengejar tersangka anggota kelompok Abu Sayyaf di provinsi selatan, Basilan, pada awal pekan ini, kata pejabat tinggi pemerintah Rabu (17/4). Kepala perunding pemerintah Miriam Coronel-Ferrer, bagaimanapun, mengatakan bahwa sejauh ini pemerintah yang bersangkutan tidak melakukan pelanggaran gencatan senjata, seperti yang telah terjadi. “Sejauh ini yang kita prihatinkan bukan pelanggaran. Jika mereka (MILF) pikir itu pelanggaran, itu sebabnya mereka menggunakan proses (pengajuan protes),” katanya. Dia mengakui bahwa dalam setiap operasi pasukan pemerintah terhadap kelompok-kelompok kriminal di Filipina selatan, itu disertai dengan risiko. “TetapiAndatidakbisamengatakanpemerintahtidakmelakukan tugasnya ketika datang untuk menangani kelompok-kelompok kriminal itu,” jelas Ferrer. Satu bentrokan antara pasukan pemerintah dan kelompok Abu Sayyaf terjadi di Tipo-Tipo, Basilan Senin lalu. Namun MILF menuduh pasukan Angkatan Darat Filipina yang menyerang pasukannya berdasarkan laporan dari lapangan. Komite Koordinasi tentang Penghentian Permusuhan akan mengajukan keluhan yang diperlukan untuk pelanggaran gencatan senjata itu. Bebaskan empat milisi Sementara itu, kelompok pemberontak sayap kiriTentara Rakyat Baru (NPA) Rabu membebas-kan empat anggota milisi pemerintah, yang mereka tangkap di Provinsi Agusan Selatan, Filipina Selatan, 15 April lalu. Mayor Leo Bongasia, jurubicara Divisi Infanteri keempat AD Filipina, mengatakan bahwa keempat milisi tersebut -Tuloy Libanda, Mario Libanda, Rubio Asalan, dan Rey Joy Franciscodibebaskan pada sekitar pukul 11.40 waktu setempat Rabu. Bongasia mengatakan, NPA membebaskan keempat milisi itusetelahperundingan-perundingan antarakelompokpemberontak sayap kiri dan komite manajemen krisis yang dibentuk oleh pemerintah Filipina. (ts/bs/m10)

Vietnam Negara Kedua ASEAN Dalam Persentase Wanita Di DPR HANOI,Vietnam (Antara/VNA-OANA): Perempuan terhitung 24,4 persen dari jumlah perwakilan di Majelis Nasional Vietnam (NA), satu peringkat setelah Laos di negara-negara Perhimpunan Bangsa Bangsa Asia Tenggara (ASE AN), kata laporan Program Pembangunan PBB (UNDP). Menurut Laporan Pembangunan Manusia UNDP terbaru yang bertemakan: The Rise of the South: Human Progress in a DiverseWolrd, 10 negara dengan persentase tertinggi perempuan duduk di parlemen termasuk Rwanda (51,9 persen), Andorra, Kuba, Swedia, Seychelles, Senegal, Afrika Selatan, Nikaragua dan Islandia. Dalam hal indeks ketidaksetaraan gender, Vietnam berada di peringkat ke-48 secara global, sedangkan Singapura berada di posisi ke-13 dan Malaysia pada ke 48.

Paramiliter Thai Terluka Akibat Serangan Di Wilayah Bergolak

The Associated Press

MANTAN Presiden Pakistan dan penguasa militer Pervez Musharraf meninggalkan Pengadilan Tinggi di Islamabad, Pakistan, Kamis (18/4). Musharraf dan tim pengamanannya bergegas meninggalkan kantor polisi dan berkendaraan dengan cepat melarikan diri dari pengadilan Kamis setelah uang jaminannya dicabut dalam kasus di mana dia dituduh melakukan pengkhianatan.

Fokus Strategi Baru Obama:

Kirim Kapal Perang Ke Asia Tenggara SINGAPURA (Antara/AFP): Kapal perang Amerika Serikat yang dirancang untuk perang di daerah pesisir Kamis (18/4) tiba di Singapura guna penyebaran Asia Tenggara, menggarisbawahi fokus strategi baru Presiden Barack Obama di Asia. Penyebaran USS Freedom terjadi pada saat ketegangan di Semenanjung Korea dan ketika China secara umum melenturkan otot angkatan lautnya di Laut China Selatan, di mana ia telah bersaing klaim teritorial dengan beberapa negara Asia Tenggara. Para pejabat Angkatan Laut AS mengatakan, Freedom, sebuah kapal tempur pesisir, berlayar memasuki Pangkalan AngkatanLautChangipadasekitarpukul 11:00 waktu setempat di Singapura, sekutu lama AS yang membantu logistik dan pelatihan bagi pasukan di Asia Tenggara. Kapal tempur pesisir pertama Angkatan Laut AS yang dirancang untuk perang dekat pantai itu, akan dikerahkan selama delapan bulan ke depan di kawasan ini, di mana akan berpartisipasi dalam pelatihan angkatan laut dan mengunjungi pelabuhanpelabuhan lainnya. Pakar keamanan regional Ian Storey mengatakan, penyebaran USS Freedom adalah pertanda komitmen Washington untuk

menjamin kebebasan perlayaran di kawasan tersebut, yang merupakantuanrumah beberapajalur pelayaran tersibuk di dunia. “Penyebaran ke depan kapal ini adalah bagian dari poros AS, menyeimbangkan kembali dari gerakan angkatan laut Irak dan Afghanistan yang mengarah ke Asia,” kata Storey, seorang dosen tamu senior di Institut Studi Asia Tenggara di Singapura. “Inimenunjukkankepadasekutu AS dan teman-teman yang berkomitmen untuk mempertahankan kehadiran kekuatan di ka-wasan itu untuk menjamin stabilitas. Dalam istilah angkatan laut, juga mendasari komitmen AS untuk menjamin kebebasan perlayaran,” katanya kepadaAFP. Kemudian, Menteri PertahananASLeonPanettamengumumkantahunlalubahwaWashington akan menggeser sebagian besar armadaangkatanlautnyakePasifik pada tahun 2020, sebagai bagian dari fokus strategi baru di Asia, dimana kekuatan China muncul. Chinaterlibatdalamsengketa

maritim dengan empat negara AsiaTenggara - Brunei, Malaysia, Filipina danVietnam - atas klaim teritorial di Laut China Selatan. Beijing mengklaim hampir seluruh laut, termasuk daerah yang lebih dekat ke wilayah pengklaim lainnya. Manila dan Hanoi telah menjadi negara pengklaim yangpalingvokaldalammengritik China atas tuduhan beratnya dalam menegakkan klaim-klaimnya. Meskipun tidak penuntutan, namunWashington mengatakan bahwapihaknyamemilikikepentingan di kawasan itu untuk menjamin kebebasan perlayaran. “Kami berencana untuk menghabiskan sebagian besar waktu kita di sini, di AsiaTenggara. Ini akan menjadi lingkungan USS Freedom untuk delapan bulan ke depan,” kata Komandan Angkatan Laut ASTimothyWilke, komandan kapal tersebut. “Kami sangat ingin bekerja samadenganangkatanlautregional lainnya dan berbagi praktek terbaik selama pelatihan, kunjungan pelabuhan dan operasi keamanan maritim.” Di Asia Tenggara, kapal ini tergabung dalam Armada ke-7 yang radius patrolinya mencapai 124jutakilometerpersegidiPasifik, mencakup 35 negara maritim. PangkalanarmadainidiYokosuka,

Jepang. Sandar di pangkalan angkatan laut Changi di timur Singapura, USS Freedom terlihat seperti raksasa. Padahal, kapal ini adalah salah satu kapal tempur terkecil yang dimiliki AS. USS Freedom dirancang untukbertempurdiperairandangkal dekat pesisir. Kru di dalamnya juga tidak terlalu banyak, kurang dari 100 orang. Selama menjalankan misi, USS Freedom akan berpartisipasi dalam latihan militer gabungan dengan beberapa negara Asia Tenggara. Penambahan armada tempur di Asia adalah salah satu bentuk perubahan kebijakan militer Obama. Tahun 2020, sebanyak 60 persen kekuatan AL AS akan dialihkan dari Timur Tengah ke Asia. Selain untuk menghemat anggaran militer, kebijakan baru AS ini disebut-sebut untuk menandingipengaruhChinadikawasan.Terutama karena China terlibat sengketa perairan dengan beberapa negara sekutu AS di Asia. “AS ingin mempertahankan stabilitasjalurperdaganganterbukayangpentingbagiperdagangan globaldanekonomidalamnegeri. Inilah alasan AS ingin menjaga stabilitas di kawasan Asia,” kata Nicholas Fang, Direktur Eksekutif SingaporeInstituteofInternational Affairs. (ap/vn/m10)

Bom Bunuhdiri Taliban Di Pakistan, 17 Tewas ISLAMABAD, Pakistan (Waspada): Sebuah bom bunuh diri meledak di kota Peshawar, Pakistan. Peristiwa itu terjadi pada saat para pemimpin Partai Nasional Awami (ANP) mengadakan pertemuan di Yakatoot, Peshawar. Kelompok radikal Taliban Pakistan mengaku bertanggung jawab atas peristiwa yang menewaskanbelasanorangitu.Namun hingga berita ini diturunkan, jum-

The Associated Press

SEORANG anggota pemadam kebakaran Prince George’s County, Maryland, (kiri) dikenakan pakaian pelindung sebelum pergi masuk ke fasilitas pemeriksaan surat pemerintah di Hyattsville, Maryland, Rabu (17/4). Polisi memeriksa seluruh kompleks Gedung Capitol AS untuk melacak paket dan amplop mencurigakan yang laporannya ramai akhir-akhir ini setelah uji pendahuluan menunjukkan adanya bahan beracun di dalam dua surat yang dikirimkan kepada Presiden Barack Obama dan seorang senator Mississippi.

lah korban tewas masih simpang siur. Menurut Geo News, Selasa, jumlah korban tewas mencapai 17 orang. Sementara kantor berita CNN, Rabu (17/4), menginformasikan 15 nyawa melayang akibat bom bunuhdiri itu. Selainkorbantewas,GeoNews memberitakan jumlah korban terluka mencapai 60 orang.Wakil Presiden Senior ANP,Ghulam Ahmed Bilour dan sang keponakan, Haroon Bilour, turut menjadi korban luka saat bom meledak. Pihak Kepolisian Ibukota Peshawar, Liaquat Ali, membenarkan bahwa bom yang meledak pada Selasa malam merupakan bom bunuh diri. Hal itu diperkuat dengan potongan organ tubuh pelaku yang ditemukan di lokasi.

Menurut analisa polisi, bom yang meledak seberat enam kilogram dengan kandungan bolabola bearing. Dugaan polisi pelaku sudah merencanakan aksi ini dengan seksama. “Pelaku bom bunuh diri sengaja berdiri di luar dan menunggu kedatangan para pejabat penting. Kemudian ketika mobil Bilourtiba,dialangsungmenujumobil itudanmeledakkandirinyasendiri,” ujarLiaquatkepadapewartaberita. Namun kelompok Taliban yang telah mengaku sebagai dalang pengeboman itu membuat pernyataanmengejutkan.Mereka menyatakan tidak mengincar Ghulam Ahmed. Bom itu sebenarnyaditujukanbagikeponakan Ghulam, Haroon Bilour. “Kamimemintamaafkepada

Ghulam Bilour karena sebelumnyatelahmengumumkansebuah pengampunan bagi dia. Target kami sesungguhnya adalah Haroon Bilour,” ujar juru bicara kelompokTaliban, IhsanullahIhsan, kepadamediamelaluijaringanteleponyangtidakdiketahuilokasinya. Hal ini diperkuat dengan pernyataanpihakkepolisianyangmengatakan sebuah alat peledak sudah dipasang di dalam mobil Haroon dan disiapkan meledak tak lama setelah dia keluar dari mobil. Hingga saat ini pihak kepolisian masih terus melakukan investigasi. Sementara pihak RS Lady Reading, tempat korban terlukadirawat,mengatakanjumlah korban tewas dapat bertambah karenajumlahkorbankritismasih banyak. (cnn/vn/r-m10)

BANGKOK, Thailand (Antara/Xinhua-OANA): Seorang paramiliter menderita luka parah ketika sejumlah pria bersenjata menyerang satu pos pemeriksaan keamanan di provinsi selatan yang bergolak di Kabupaten Si Sakhon, Provinsi Narathiwat, kata Bangkok Post Rabu (17/4). Kol.Pol. Payong Sanukul, kepala kantor polisi Si Sakhon, mengatakan pria bersenjata tersebut melepaskan tembakan di pos pemeriksaan Si Sakhon Selasa malam ketika 12 polisi, penjaga dan relawan pertahanan bertugas. Tim keamanan membalas dan penyerang dengan melemparkan empat granat M19A1 pada mereka sebelum mundur. Tetapi hanya tiga dari granat itu yang meledak. Prajurit Thosaporn Tampeng, 26 tahun, ditembak di kaki kirinya dan dibawa ke rumah sakit Si Sakhon. Kondisinya didiagnosis kritis. Polisi memeriksa tempat kejadian pada Rabu pagi dan menemukan 54 kartrid yang dihabiskan dari M16 dan AK47 di tanah sekitar 80 meter dari pos pemeriksaan.

Korut Ajukan Syarat Jika AS Ingin Dialog SEOUL, Korea Selatan (Antara/Reuters): Korea Utara (Korut) Kamis (18/4) menuntut pencabutan sanksi PBB yang diberlakukan untuk uji nuklir dan peluru kendalinya serta janji Amerika Serikat tidak terlibat dalam ‘praktek perang nuklir’ dengan Korea Selatan (Korsel) jika Washington benar menghendaki dialog. “Jika Amerika Serikat dan boneka Korea Selatan punya sedikit keinginan untuk menghindari hantaman palu godam tentara dan rakyat kami ... dan benar-benar berharap dialog dan berunding, mereka harus membuat keputusan tegas,” kata Komisi Pertahanan Nasional Korut dalam satu pernyataan. “Pertama-tama, sanksi-sanksi resolusi oleh Dewan Keamanan PBB yang dibuat dengan alasan yang tidak adil harus ditarik,” kata badan tertinggi militer Korut itu dalam satu pernyataan yang dimuat oleh kantor berita resmi KCNA. Sebelumnya, Komando tertinggi militer Korut telah mengeluarkan ultimatum kepada Korsel, menuntut permintaan maaf langsung untuk“semua tindakan bermusuhan besar dan kecil”, kata kantor berita negara KCNA Selasa.“Komando tertinggi Tentara Rakyat Korea Selasa mengeluarkan ultimatum kepada kelompok boneka Korea Selatan,” kata pernyataan itu. Ultimatum, yang dikeluarkan bertepatan dengan Hari Matahari yang menandai ulangtahun pendiri Korut Kim Il-sung, mengatakan bahwaPyongyangakanmembalastanpaperingatanjikaSelatanterus melakukan kegiatan‘anti-Korut-nya.’“Tindakan balasan kami akan dimulai tanpa pemberitahuan sejak sekarang,” kata pernyataan itu.

Menteri: AS Segera Kerahkan 200 Tentara Ke Jordania AMMAN, Jordania (Antara/AFP): Amerika Serikat berencana untuk mengerahkan 200 tentara ke Jordania karena “situasi yang memburuk” di Syria yang dilanda perang, kata Menteri Informasi Mohammad Momani. “Penyebaran pasukan tersebut merupakan bagian dari kerja sama militer AS-Jordania untuk meningkatkan angkatan bersenjata Jordania dalam situasi yang memburuk di Syria,” kata Momani kepada AFP. Dia tidak mengatakan kapan pasukan dijadwalkan tiba di Jordania. “Para pejabat AS dan Jordania telah berhubungan selama dua hari terakhir. Hal ini masih belum jelas apakah peralatan militer dan senjata juga akan tiba dengan kelompok tentara, yang akan datang di kerajaan itu dalam tahap mendatang.” Jordania, satu sekutu penting AS di kawasan itu, mengatakan pihaknya telah menampung sekitar 500.000 pengungsi Syria. PM Abdullah Nsur mengatakan kepada parlemen pada Minggu bahwa dampak perang Syria merupakan ancaman terhadap keamanan kerajaan, dan Jordania akan meminta bantuan Dewan Keamanan PBB untuk mengatasi dampak tersebut.

Ormas Islam India Kecam Penyiksaan Muslim Myanmar NEW DELHI, India (AP): Organisasi Islam ternama di India, Jamiaat Ulama-e-Hind (JUH) mengecam keras tragedi kekerasan terahdap warga Muslim di Myanmar. Mereka mengeluarkan resolusi dan mendesak komunitas internasional untuk mengintervensi Myanmar agar kekerasan itu berakhir. “Inisiatif Pemerintah Myanmar (untuk mengatasi konflik) hanyalahtipuan,resolusiinimendesakpenghentianaksikekerasanterhadap warga Muslim yang dilakukan oleh warga Buddha,” demikian resolusi JUH, seperti dikutip IRNA, Rabu (17/4). JUH juga menuntut adanya program rehabilitasi pascakonflik. Mereka meminta Pemerintah Myanmar mengatasi warga-warga Muslim yang terpaksa lari dari rumahnya guna menyelamatkan diri dari konflik komunal itu. Resolusi itu membahas masalah kekerasan di Meiktila, Myanmar, danjugamasalahpengungsiRohingya.PemerintahIndiapundiminta menggunakanpengaruhnyauntukmendesakMyanmarmemberikan kewarganegaraan secara penuh ke warga Rohingya. “Semua yang sudah mengungsi di negara-negara lain harus diakui sebagai warga Myanmar, mereka juga harus diberikan status pengungsi dan perlindungan dari badan Perserikatan BangsaBangsa (PBB),” lanjut JUH dalam resolusinya. Sejauh ini, kekerasan di wilayah Meiktila Myanmar disamakan dengan kekerasan yang terjadi di wilayah Arakan. Meski demikian, situasi di Meiktila sudah berangsur reda usai Presiden Myanmar Thein Sein berniat merespons para pelaku kekerasan itu. Thein Sein juga meminta biksu-biksu Myanmar untuk menjaga perdamaian, karena sebelumnya kelompok biksu terlibat dalam insiden kekerasan ini. Meski demikian, sentimen anti-Islam masih berkembang di negara Asia Tenggara itu.(m10)

Pelaku Pengirim Surat Beracun Untuk Obama Ditangkap

Muslim Austria Minta Libur Hari Raya Idulfitri

WASHINGTON (Waspada): Seorang tersangka berhasil ditangkap oleh pihak penyelidik federal Amerika Serikat terkait suratberisiracunyangdikirimkan kepada Presiden Barack Obama. Surat serupa sebelumnya juga dikirimkan kepada Senator Roger Wicker. Paul Kevin Curtis ditangkap di rumahnya di Corinth, Mississippi. FBI menangkapnya setelah melakukan pelacakan atas surat beracun yang ditemukan di Gedung Putih dan Capitol Hill. Ditemukan Selasa 16 April

KAIRO, Mesir (Antara): Komunitas Muslim di Austria meminta pemerintah setempat untuk memberi satu hari libur setiap tahun pada lebaran Islam seperti liburan bagi umat Katolik dan Protestan. “Sudahlebihsatuabadpemerintahmemberipengakuanterhadap Islam sebagai agama resmi negara. Oleh karena itu kami minta untuk ditetapkan satu hari libur pada lebaran Idul Fitri dan Idul Adha bagi Islam setiap tahun,” kata Ketua Komunitas Muslim Austria, Fuad Sang kepada surat kabar berbahasa Arab Al Ahram, Selasa (16/4) lalu. Menurut Fuad Sang, pihaknya telah meminta pihak berwenang untuk melakukan perubahan Undang-Undang tahun 1912 yang salah satu ayatnya menetapkan Islam sebagai salah satu negara resmi negara, di samping agama Protestan dan Katolik. Sebagai penghormatan terhadap kedua agama mayoritas itu, pemerintah memberi libur setiap perayaan Jumat Agung bagi umat umat Protestan, sementara liburan Kenaikan Isa Almasih untuk umat Katolik, katanya.

lalu, surat tersebut ditujukan kepada SenatorWicker yang selama ini diketahui sebagai politisi Partai Republik dari wilayah Mississippi dan juga Presiden Obama. Pihak Kementerian Kehakiman juga merilis ada surat ketuga yang dikirim kepada pejabat Kementerian Kehakiman. Suratitudiketahuibertuliskan “Melihat kesalahan dan tidak mengeksposnya, sama seperti menjadi mitra terselubung yang terus berkelanjutan.” Berdasarkan keterangan yang diperoleh CNN, Kamis (18/

4), surat tersebut pun bertuliskan tanda “Saya KC dan saya mengakui pesan ini”. Pihak FBI mengatakan, penyelidikan surat ini tetap berlangsung, dan kemungkinan masih banyak surat yang diterima. FBI juga menegaskan tidak ada indikasi koneksi antara surat berisi racun ini ke serangan di Boston. Proses penyaringan surat pemerintah menguji positif adanya racun risin. Saat ini, surat yang berisiracundanditujukankeObama tersebut sedang diuji. (m10)


WASPADA Jumat 19 April 2013


Roma Rilis Final Spesial MILAN, Italia (Waspada): Mattia Destro mencetak dua gol untuk memenangkan AS Roma 3-2 atas Inter Milan pada leg kedua semifinal Coppa Italia. Kemenangan tandang di Stadion Giuseppe Meazza, Rabu (KamisWIB) tersebut, mengantar Serigala Merah ke partai puncak dengan agregat 5-3 sekaligus merilis final spesial melawan tetangganya SS Lazio. “Laga derbi di final Coppa Italia sesuatu yang spesial. Tapi kami tak boleh hanya fokus pada final. Itu berisiko membuang hasil baik lain yang telah kami lakukan sejauh ini,” ujar Aurelio Andreazzoli, allenatore Roma, seperti dilansir Football Italia, Kamis (18/4). Pelatih yang menggantikan Zdenek Zeman sejak Februari lalu itu yakin, duel final bertajuk Derby Della Capitale 25 Mei mendatang di Stadion Olimpico Roma bakal sangat sengit, karena rivalitas kedua tim sekota. Juga mengingat keributan yang sempat terjadi antara kedua kubu pendukung tim ibu-

kota musim ini. “Ketika ditunjuk, saya memiliki beberapa target pribadi, di antaranya final Coppa Italia,” klaim Andreazzoli. Mattia Destro mencetak gol kedua Il Lupo saat menang 2-1 pada semifinal leg pertama di Olimpiade, Januari lalu. Kesuburan gelandang Italia itu Si Kuning-Merah harapan meraih Piala Italia untuk pertama kalinya sejak 2008. Pemain berusia 22 tahun itu mempertahankan penampilan apiknya dengan menyarangkan dua gol ke gawang kiper Samir Handanovic menit 55 dan 69 di Giuseppe Meazza. Kehebatan Destro memupus harapan Inter yang mengawali duel dengan bagus dan unggul lebih dahulu ketika Jonathan memperlihatkan kemampuan lainnya. Selain bertahan dengan baik, Jonathan memain-

kan operan satu-dua dan menaklukkan kiper Maarten Stekelenburg menit 21. Tapi pelatih Inter Andrea Stramaccioni hanya dapat menikmati keunggulan timnya dalam waktu singkat. Destro membalikkan kedudukan dan gol Vasilis Torosidis menit 74 seperti menghabiskan peluang La Beneamata. “Kami tahu memiliki kualitas bagus. Tim memiliki gaya tersendiri dalam sepakbola. Mereka hanya kehilangan sedikit kepercayaan diri dan kami mesti mengembalikan antusiasme yang tepat,” papar Andreazzoli. Memang Pantas Pasukan Stramaccioni tidak pernah menyerah dan mampu memperkecil ketinggalan melalui gol Ricardo Alvarez menit 80. Tapi laju Serigala Merah tak terhadang lagi untuk menantang Lazio, yang sebelumnya menyingkirkan Juventus agregat 3-2 pada semifinal lainny. Roma bersama Juve pengoleksi gelar terbanyak Coppa Italia dengan sembilan gelar juara. Sedangkan Lazio mengo-

leksi tujuh piala. “Saya hanya bisa memuji para pemain saya, karena kami sudah berusaha sebaik mungkin dan memberikan segalanya di lapangan,” tutur Stramaccioni. “Roma bermain bagus di dua leg, mereka memang pantas lolos ke final. Jadi saya memberikan selamat kepada mereka dan juga para pemain saya. Saya berterimakasih kepada fans, yang sudah mendukung kami sejauh ini,” katanya lagi. Sedangkan kapten Javier Zanetti meminta I Nerazzurri kembali fokus sepenuhnya pada persaingan di papan atas Liga Seri A. “Kami mesti mengakhiri musim sebaik yang kami bisa dan para pemain perlu mencoba untuk membantu meraih hasil bagus,” tekadnya melalui Inter Channel. “Kami perlu dengan tenang menilai apa yang mesti dilakukan dengan tepat, sehingga kami bisa lagi memulai musim depan dan kembali meraih sukses. Inter adalah tim yang perlu bersaing setiap tahun,” beber bek veteran berumur 39 tahun tersebut. (m15/vvn/fi/tf/ic)

Penampilan Terburuk PSG P A R I S ( Wa s p a d a ) : Harapan Paris Saint Germain meraih gelar ganda musim ini, berakhir Rabu (Kamis WIB), ketika tim kecil Evian menyingkirkannya melalui adu penalti dengan skor 4-1 pada perempatfinal Piala Prancis. Setelah disingkirkan Barcelona dari Liga Champions pekan lalu, PSG sempat mengungguli Evian Thonon Gaillard melalui gol Javier Pastore menit kedelapan di Parc des Sports. Saber Khlifa kemudian menaklukkan David Beckham, sebelum mencetak gol balasan menit 44. Skor 1-1 bertahan hingga usainya babak perpanjangan waktu, sehingga penentuan tiket harus melalui drama adu tendangan 12 pas. Air Les Parisiens semakin lengkap karena kartu merah yang diberikan wasit kepada gelandang Thiago Motta akibat pelanggaran kerasnya terhadap Cedric Barbosa dua menit sebelum peluit panjang berbunyi. “Ini bencana, Ini penampilan terburuk dalam masa kepelatihan saya. Ini yang terburuk,” ratap pelatih PSG Carlo

Hasil Rabu (Kamis WIB) Evian v Paris SG Lens (II) v Bordeaux

4-1 pen 2-3

Hasil Selasa (Rabu WIB) St Etienne v Lorient Troyes v AS Nancy


Ancelotti melalui CanalPlus, yang dikutip Kamis (18/4). Apalagi dua bintang termahal klub kaya baru Prancis itu, striker Zlatan Ibrahimovic dan bek sentral Thiago Silva, justru gagal menyarangkan bola saat menjadi eksekutor pertama dan kedua. “Maafkan saya, saya sangat menyesal. Ini tanggung jawab saya,” tegas Ancelotti (foto). “Sikap kami tidak cukup bagus. Ketika tim bermain di

lapangan dengan buruk, itu kegagalan pelatih,” pungkas mantan pelatih AC Milan dan Chelsea asal Italia tersebut. Kekalahan ini membuat PSG tinggal punya satu peluang meraih gelar, yakni Ligue 1. Saat ini Les Parisiens masih kokoh di puncak klasemen dengan 67 poin dari 32 pertandingan, unggul 9 poin dari tim peringkat dua Olympique Marseille. Evian melaju ke semifinal untuk menghadapi FC Lorient

1-2 3-0

di Parc des Sports, 7 Mei mendatang. Satu semifinal lagi mempertemukan Troyes dengan Girondins Bordeaux di Stade de l’Aube. Bordeaux lolos setelah mampu bangkit dari ketinggalan saat melawan Racing Lens dari divisi Ligue 2. Tertinggal lewat gol bunuh diri Cedric Carrasso menit 11, Girondins bangkit dengan tiga gol pada babak kedua untuk mengunci kemenangan 3-2. Penyerang Mali Cheick Diabate menyumbang dua gol menit 81 dan 85. Tapi Gregory Sertic yang menjadi sumber inspirasi Bordeaux dengan gol penyama kedudukan yang dicetaknya menit 59. Gol hiburan Zakara Bergdich bagi Lens menit 91, tak mampu menghentikan laju tim tamu yang bakal tampil untuk pertama kalinya di babak empat besar Piala Prancis sejak tahun 2003 silam. (m15/ant/afp/cp)


BINTANG kemenangan AS Roma Mattia Destro (kanan) menaklukkan kiper Inter Samir Handanovic di Stadion Giuseppe Meazza, Kamis (18/4) dinihari WIB.

Munich Memuji Messi BERLIN (Waspada): Pelatih Bayern Munich Jupp Heynckes, memuji bintang Barcelona Lionel Messi (foto). Dia bahkan tak segan menilai La Pulga alias Si Kutu sangat fenomenal dan telah menorehkan berbagai prestasi yang melebihi torehan para legenda sepakbola. “Apa yang telah diraih Messi sulit dipercaya. Kata terbaik untuk menggambarkan Messi adalah fenomenal,” puji Heynckes, seperti dikutip dari koran AS, Kamis (18/4). “Pada usianya yang masih muda, dia telah mendapatkan predikat yang sama dengan Zinedine Zidane, Pele, Diego Maradona, dan Johan Cruyff,” tambah pelatih berusia 67 tahun tersebut. Messi cs merupakan lawan

Stuttgart Penantang FC Hollywood


STRIKER Stuttgart Martin Harnik (kanan) hysteria merayakan golnya ke gawang Freiburg dengan rekan setimnya Alexandru Maxim.

Problem Catur Putih melangkah, apa langkah tepat mengusir Gh6 dan menang?

Jawaban di halaman A2. 8







1 A








BERLIN ( Waspada): VfB Stuttgart menjadi penantang tim favorit Bayern Munich pada final Piala Jerman, Juni mendatang, setelah mereka menikmati kemenangan 2-1 atas tamunya SC Freiburg. Sukses memenangkan semifinal di Mercedez-Benz Arena, Rabu (Kamis WIB), bahkan merupakan bonus ganda bagi Stuttgart. Sebab mereka sudah terjamin mendapat tempat di Liga Europa musim depan, karena FC Hollywood mentas di Liga Champions sebagai juara Bundesliga. Stuttgart menyerang Freiburg tanpa lelah dan mencetak gol pembuka ketika gelandang bertahan Pantai Gading Arthur Boka meneruskan umpan silang Ibrahima Traore menit kesembilan. Boka kemudian terlibat pa-

da gol untuk pihak lawan ketika gagal menghentikan laju Jan Rosenthal. Gelandang tim tamu itu kemudian menempatkan tembakannya melewati kiper Stuttgart Sven Ulreich untuk menyamakan kedudukan menit 13. Tuan rumah Stuttgart merestorasi keunggulannya menit 29, setelah terjadi kemelut di pertahanan Freiburg. Striker asal Austria Martin Harnik lantas menanduk umpan silang Christian Gentner, yang bersarang ke gawang tim tamu sekaligus menjadi gol penentu tiket final. Harnik menyia-nyiakan peluang bagus untuk memantapkan kemenangan timnya, ketika tembakannya melebar meski gawang sudah terbuka lebar. Terdapat air mata yang membasahi wajah sejumlah pemain Freiburg saat gagal menembus final DFB Pokal untuk pertama kalinya sepanjang sejarah klub itu.



Hasil Rabu (Kamis WIB) VfB Stuttgart v SC Freiburg 2-1

Hasil Selasa (Rabu WIB) Bayern Munich v Wolfsburg 6-1 Sedangkan Stuttgart akan tampil untuk keenam kalinya di partai puncak, namun menjadi penampilan pertama sejak kekalahan pada final 2007. Bayangan kegagalan enam tahun silam mengemuka lagi, karena Bayern berusaha memenangi piala ini untuk ke-16 kalinya setelah kalah 2-5 dari Borussia Dortmund di Berlin tahun lalu. FC Hollywood menghancurkan Wolfsburg 6-1 di Munich, Selasa lalu, ditandai dengan hatrik striker Mario Gomez. Sang juara Bundesliga kini mengejar treble winner, setelah mencapai semifinal Liga Champions untuk menghadapi Barcelona. (m15/ant/afp/rtr)

pasukan Munich pada semifinal Liga Champions musim ini, semifinal lainnya mempertemukan Borussia Dortmund dengan Real Madrid. Javi Martinez, gelandang The Bavarians asal Argentina, mengamini pandangan bosnya menyangkut Si Kutu. Dia bahkan bahagia, karena El Messiah telah pulih dari cedera untuk melakoni semifinal leg pertama di Allianz Arena, Munich, 23 April mendatang. “Mendengar Leo pulih, itu akan jadi kabar baik bagi semua, buat sepakbola. Di kamar ganti, kami sadar siapa yang kami hadapi,” jelasnya kepada Football Espana. “Pertarungan melawan mereka akan ketat. Saya pernah kecewa karena gagal melawan mereka pada beberapa laga sebelumnya,” klaim Martinez, mantan bintang Athletic Bilbao. Mengacu pda pengalaman ketika membela Bilbao, Martinez menyarangkan, Munich sedini mungkin mesti menekan dan tak boleh sedetik pun membiarkan El Catalan mengembangkan permainan terbaiknya. “Anda harus terus menekan dan tak boleh membiarkan mereka berpikir. Dalam sepersekian detik, Anda bisa kejebolan.

Leg I Semifinal UCL Selasa, 23 April (GMT) Bayern Munich v Barcelona 18:45 Rabu, 24 April (GMT) B Dortmund v Real Madrid 18:45 Hasil terbaik yang pernah saya dapat hanya imbang di San Mames (markas Bilbao),” kenang gelandang berusia 24 tahun itu. Khusus mengenai trauma kekalahan 0-4 FC Hollywood atas El Blaugrana di Camp Nou pada semifinal Liga Champions 2008-2009, Presiden Bayern Uli Houness, berjanji hasil itu tak akan terulang kembali. “Memang benar pada 2009 kami memiliki Ribery dan Luca Toni. Namun pelatih saat itu juga perlu dipertanyakan,” jelas Houness kepada Sport Bild. Pelatih Bayern saat itu Juergen Klinsmann, sedangkan Barca diarsitike Pep Guardiola. “Hal terpenting punya pelatih bagus. Jupp Heynckes mengetahui Liga Spanyol dari dalam dan luar lapangan. Tak hanya saat dia bermain di sana, namun juga saat ini,” tegas Houness. “Dia menyaksikan banyak pertandingan, sehingga tak akan ada kejutan. Dia punya kepribadian besar dan tidak membutuhkan nasihat dari siapa pun.


Dia bisa menghadapi laga ini sendirian,” katanya menambahkan. Khusus mengenai Messi, Houness mengklaim; “Semua bicara mengenai Messi. Tapi kami memiliki Schweinsteiger, Lahm, Muller, Badstuber dan Alaba, yang telah menjadi bintang.” (m15/okz/as/fe)

Blatter Prihatin Petaka Boston HAVANA (Antara/Reuters): Ketua FIFA Sepp Blatter (foto) prihatin sekaligus mengingatkan, serangan bom pada lomba maraton Boston merupakan petaka dan tragedi bagi dunia olahraga. “Apa yang terjadi di Boston merupakan petaka, tragedi dan serangan terhadap olahgara yang paling populer di Boston, yaitu maraton,” kata Blatter dalam kunjungannya ke Kuba, Kamis (18/4) pagi WIB. “Kejadian itu amat menyakitkan, tetapi itulah masyarakat kita, masyarakat yang sadis. Jadi kita harus bertanggungjawab


melakukan pengamanan,” ujarnya lagi dalam kunjungan seminggu di Havana, ke Karibia dan Amerika Tengah. Ditanya tentang faktor keamanan penyelenggaraan Piala

Dunia 2014 Brazil, Blatter mengatakan, keamanannya tanggung jawab pemerintah dan penyelenggara olahraga yang bersangkutan. “Kita di FIFA harus menyiapkan semua informasi yang dibutuhkan. Polisi, tentara dan agen rahasia akan bekerja menjaga 31 tim yang lolos ke Brazil 2014. Itu semua ada di Interpol, kita tidak dapat melakukan apa pun,” tegasnya. Blatter pun memuji Piala Dunia 2010 Afrika Selatan dengan menyebutkan istilah pesta kemanusiaan.


1. Nama nabi yang mengerti bahasa hewan. 4. Nama nabi di atas yang dikenal di negara Barat. 7. Nama nabi yang berpenyakitan dan menjadi simbol kesabaran. 8. Nama nabi Ibrahim yang dikenal di negara Barat. 10. Huruf ke-7 abjad Arab. 11. Hukum positif, hukum amali yang disusun oleh mujtahid, bersumber dari Al Quran dan Sunnah. 12. Juz terakhir Al Quran (mulai surat 78 hingga 114). 13. Tidak halal. 15. Ad———, surat Al Quran yang artinya Ketika Matahari Sepenggalah Naik. 17. Pengakuan, berisi dua kalimat. 19. Huruf ke-27 abjad Arab. 20. Harta benda (uang, barang); Khazanah. 21. Pemimpin pemerintahan. 23. Dubur, bagian yang diharamkan untuk disetubuhi. 24. Pengadilan. 26. An Nahl, serangga yang menjadi judul surat ke-16 Al Quran. 27. Nama (bagi Tuhan). 28. Yang disembah. 29. Ucapannya “Bismillah”.


1. Hukum agama. 2. Surat Al Quran yang terdapat ayat Kursi. 3. Sebaiknya ditinggalkan tapi tidak haram. 4. Pertolongan. 5. Sesuatu yang diciptakan oleh Tuhan. 6. Tujuan suatu perbuatan ; Keinginan dalam hati. 9. Huruf ke-24 abjad Arab. 14. Utama; Lebih baik; Lengkap. 15. Kata lain dari surga; Alam kesejahteraan. 16. Ummul Quran, bacaan wajib dalam shalat. 17. Perkataan (bagi Tuhan, nabi, raja dsb). 18. Ucapannya “Alhamdulillah”. 22. Sejenis burung atau ribuan burung yang menyerang pasukan Abrahah. 23. Nama surat dan perang, ujian berat Allah kepada Nabi Muhammad SAW dan para pengikutnya. 24. Salah satu bagian tubuh yang dibasuh saat wudhu. 25. Kekuasaan; Kekuatan; Peringatan tahunan hari wafat.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

3 8 2 1 2 8 3 2 7 1 6 8 4 4 5 9 2 1 6 7 9 4 5 9 3 1 2 7 *****35



WASPADA Jumat 19 April 2013

Klasemen Liga Premier Man Unied 33 26 3 4 Man City 32 20 8 4 Chelsea 32 18 7 7 Arsenal 33 17 9 7 Tottenham 32 17 7 8 Everton 33 14 14 5 Liverpool 33 13 11 9 West Brom 32 13 5 14 Swansea 32 10 11 11 Fulham 33 10 10 13 West Ham 33 10 9 14 Southampton33 9 11 13 Newcastle 33 10 6 17 Norwich 33 7 14 12 Sunderland 33 8 10 15 Stoke 33 7 13 13 Aston Villa 33 8 10 15 Wigan 32 8 7 17 QPR 33 4 12 17 Reading 33 5 9 19

75-35 81 58-27 68 64-33 61 64-35 60 55-40 58 51-37 56 59-40 50 42-43 44 43-42 41 44-51 40 38-47 39 47-54 38 42-59 36 31-52 35 37-45 34 28-41 34 36-60 34 37-58 31 29-54 24 36-63 24

KEGANASAN striker West Ham Andy Carroll dalam laga Liga Premier, Rabu (Kamis WIB), mengundang kecaman dari manajer MU Sir Alex Ferguson. -Daily Mail-


BINTANG kemenangan City Carlos Tevez (atas) mengatasi hadangan bek Wigan James McCarthy di Etihad Stadium, Manchester, Kamis (18/4) dinihari WIB.

City Akui Latics Hebat LONDON (Waspada): Manchester City menang 1-0 atas tim terancam degradasi Wigan Athletic, Rabu (Kamis WIB), sehingga dapat mengurangi selisihnya dengan pemimpin klasemen Manchester United menjadi 13 angka. Namun laga tunda matchday 32 Liga Premier di Etihad Stadium, Manchester, Rabu (Kamis WIB), sejatinya menjadi gladi bersih final Piala FA antara Wigan dan City pada 11 Mei mendatang diWembley, London. The Citizens yang diprediksi bisa menang mudah, justru kesulitan melantak The Latics. Gol tunggal penentu kemenangan bahkan baru lahir menit 83 melalui striker Carlos Tevez. “Saya rasa mereka bermain lebih bagus daripada kami. Me-

reka tidak layak terdegradasi, juga karena Roberto Martinez pelatih hebat,” ucap Roberto Mancini, manajer City, seperti dilansir ESPN, Kamis (18/4). “Mereka bermain bola-bola panjang, Mereka juga mengambil banyak risiko ketika memulai pertandingan dari belakang. Mereka mencoba untuk selalu bermain,” pujinya lagi. Tetapi pelatih asal Italia itu juga mengklaim, sulitnya City mengatasi Latics tak terlepas dari faktor kelelahan usai menghadapi dua laga penting melawan Manchester United di Liga Premier dan Chelsea di semifinal Piala FA. “Kami berusaha dengan keras untuk bisa menang, kendati kami sangat kelelahan usai bermain di dua partai penting dalam lima hari dan kami memainkan pertandingan terakhir tiga hari yang lalu,” klaim Mancini. Dia pun memuji Tevez yang

menjadi pahlawan kemenangan Citizens. “Dia pemain berkualitas dan dia selalu bermain bagus. Tevez mencetak gol indah,” sanjung Mancini. Sebaliknya dia kecewa dengan performa bek Micah Richards, yang kembali tampil lagi setelah absen enam bulan karena mengalami cedera. Richards terakhir kali mentas kala The Eastland melawan Swansea City pada Oktober silam. “Saya pikir dia butuh banyak berlatih. Saya tak suka (performanya), tapi saya bahagia dia bisa kembali bermain,” jelas mantan pelatih Inter Milan dan Lazio tersebut. Soal disimpannya bek Pablo Zabaleta, Mancini menilai sang pemain perlu mendapatkan istirahat. “Pablo sudah tampil dalam banyak pertandingan, sangatlah penting untuk memberi dia rehat,” pungkasnya. (m15/goal/espn)

Carroll Mestinya Merah LONDON (Waspada): Calon juara Manchester United dua kali bangkit dari ketinggalan untuk bermain 2-2 di markas West Ham United, Rabu (Kamis WIB), sehingga kian dekat ke gelar Liga Premier. Meski tim peringkat kedua Manchester City menang 1-0 atas Wigan Athletic sehingga mengurangi selisihnya menjadi 13 angka, MU hanya perlu enam poin dari lima partai terakhir untuk mengunci gelarnya yang ke-20 di liga domestik. Tapi tetap saja Sir Alex Ferguson, meratapi kondisi pasukannya pasca laga di Upton Park, London. Terutama menyangkut ulah brutal bomber West Ham Andy Carroll saat duel dengan kiper MU David de Gea, serta bek Patrice Evra dan Nemanja Vidic. Jelang akhir babak pertama, Carroll yang berusaha menyundul bola sepakpojok tiba-tiba menabrak De Gea dengan keras. Namun wasit Lee Probert tidak menganggap kejadian itu sebagai pelanggaran.

“Menurut saya itu jelas-jelas pelanggaran. Dia (Carroll) mestinya mendapatkan kartu merah. Tapi wasit melihat kejadian tersebut dengan berbeda,” kecam Sir Fergie melalui Sky Sports, Kamis (18/4). The Hammers unggul lebih dahulu melalui tandukan Ricardo Vaz Te menit 16. Antonio Valencia menyamakan kedudukan melalui gol pertamanya musim ini menit 31. Mohamed Diame membawa West Ham kembali memimpin melalui tembakan mendatar brilian menit 65. Setan Merah bangkit lagi menyamakan skor lewat gol kontroversial striker Robin van Persie menit 77. Menurut Carroll, dirinya tidak sengaja membuat De Gea dan Evra sempat terkapar di la-

Pemanasan Bagus The Blues LONDON (Waspada): Memainkan pertandingan ketujuhnya dalam rentang waktu 19 hari, Chelsea tidak memperlihatkan tanda-tanda kelelahan dan membuat pemanasan bagus jelang semifinal Liga Europa. Melakoni derbi London melawan Fulhlam pada matchday 33 Liga Premier, Rabu (Kamis WIB), The Blues menang telak 3-0. Duel berlangsung tidak seimbang dan diwarnai tembakan 30 meter yang mengejutkan dari David Luiz untuk gol pertama tim tamu menit 30. John Terry menyumbang dua gol lainnya menit 43 dan 71, yang membawa Si Biru naik ke peringkat ketiga Liga Premier dengan 61 angka dari 32

partai, menggeser Arsenal dengan selisih satu poin. Kapten Terry pun mendapat pujian khusus dari manajer Rafael Benitez. “Ini bagus untuk dia dan tentu saja untuk tim. “Saya sangat senang, penampilannya sangat bagus,” sanjung Benitez melalui Telegraph, Kamis (18/4). Terry sempat tak dimainkan saat The Blues disingkirkan Manchester City di semifinal FA Cup. Namun ketika melawat ke markas Fulham, Benitez menurunkannya sebagai starter. Setelah gagal mempertahankan mahkota Liga Champions League serta menjuarai Liga Premier, Piala FA, Piala Liga dan Piala Dunia Antarklub, London Blues sangat fokus untuk menjuarai Liga Europa dan mempertahankan posisi di zona Liga Champions.

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham, menyalami pemain yang akan bertanding dalam turnamen antartim SSB di Stadion Binjai, Kamis (18/4).

Berharap Sepakbola Binjai Bangkit Lagi BINJAI (Waspada): Wali Kota Binjai, HM Idaham SH MSi, berharap pembinaan dan prestasi olahraga sepakbola Kota Rambutan bangkit lagi. “Di masa lalu, prestasi sepakbola Binjai sangat membanggakan, sehingga beberapa pemainnya dipercaya memperkuat tim nasional. Kita berharap masa-masa itu bisa diraih kembali dengan kerja keras dan pengorbanan semua pihak terkait,” ujar Idaham, saat membuka turnamen antartim SSB di Stadion Binjai, Kamis (18/4). Dia pun meminta KONI dan Disparpora Binjai melahirkan konsep dan program untuk pembinaan sepakbola Kota Binjai. Menurutnya, perlu dibuat program pembinaan pemain usia dini dengan bekerjasama Dinas Pendidikan. “Kompetisi antartim SSB seperti ini harus terus digalakkan sebagai wahana pembinaan. Pemain yang berbakat hendaknya bisa dijaring dan dilakukan pembinaan lebih lanjut, sehingga ke depan Binjai senantiasa siap dalam menghadapi berbagai kejuaraan,” ujarnya lagi. Kadisparpora Binjai Drs H Eka Dwi Sahputra, melaporkan turnamen tersebut diikuti 25 tim dari Binjai, Medan, Deliserdang, dan Langkat. “Turnamen ini sebagai program pembinaan pemain usia dini Disparpora Binjai,” jelasnya. Menurut Sujono SPd, Kabid Olahraga Disparpora Binjai, 25 tim yang bertanding dibagi dalam delapan grup. Setiap juara dan runner-up grup berhak maju ke babak selanjutnya. Pada laga pembuka, Kamis (18/4), SSB Etek Jaya FC mengalahkan KTB Binjai 3-0. (a04)

ngat keras. Saya sangat menikmatinya, mendapatkan sejumlah sikutan dan memberi beberapa sikutan,” jelas Carroll. “Itu bagian dari pertandingan. Soal Rooney? Itu hanya gurauan pertemanan antara saya danWazza,” pungkas mantan penyerang Timnas Inggris berusaha 24 tahun tersebut. (m15/ant/rtr/sky/uefa)


Van Persie Rampas 3 Poin Hammers

(GMT) 19:05 19:05

“Kami harus tetap di posisi tiga dan kami puna peluang di Europa League. Kami ingin bersaing di kedua kompetisi tersebut,” tegas Benitez. Bek David Luiz juga berpandangan demikian. “Saya selalu berfikir positif. Kami punya pertandingan penting di masa depan,” jelasnya. “Kami harus menang. Kami perlu berada di posisi terbaik Liga Premier dan fokus untuk memenangkan Liga Europa,” tekad bek berambut keriwil asal Brazil tersebut. (m15/tlg/sky)

Mantan penyerang Liverpool itu juga tertangkap kamera menyikut kapten MU Nemanja Vidic ketika duel di udara. Carroll pun sempat terlibat insiden kecil dengan Wayne Rooney. Bermula ketika Rooney dengan sengaja menginjak kaki Carroll ketika situasi sepak pojok. Carroll meresponnya dengan menendang kaki Rooney. “Ini laga yang hebat dan sa-

BOMBER MU Robin van Persie menimpa bek West Ham Ricardo Vaz Te di Upton Park.

Semifinal I Liga Europa Kamis, 25 April FC Basel v Chelsea Fenerbahce v Benfica

pangan. Dia mengaku berusaha menyundul bola dengan melompat hingga menabrak kedua pemain MU tersebut. De Gea dan Evra sempat mendapat perawatan tim medis. “Saya hanya berusaha mendapatkan bola dan menabrak De Gea. Jelas kiper juga ingin mendapatkan bola, dan saya tidak bisa berhenti ketika berada di udara,” dalih Carroll.


KAPTEN Chelsea John Terry (kanan) merayakan golnya ke gawang Fulham dengan rekan-rekannya di Craven Cottage, London, Kamis (18/4) dinihari WIB.

LONDON (Waspada): Manajer Sam Allardyce menuding, Robin Van Persie telah merampas kemenangan timnya West Ham United atas Manchester United di Upton Park, London. Van Persie membobol gawang kiper Jussi Jaaskelainen menit 77, sehingga Setan Merah MU mampu memaksakan hasil imbang 2-2 pada matchday 33 Liga Premier tersebut. “Agak sulit untuk menentukannya, itu tugas mereka (wasit) untuk memberikan keputusan offside. Dia (hakim garis) melihat Van Persie dalam posisi offside, namun dia tidak mengangkat benderanya,” hardik Allardyce, seperti dikutip dari

Sky Sports, Kamis (18/4). Tayangan ulang televise memang menunjukkan bomber MU asal Belanda berumur 30 tahun itu sudah berdiri pada posisi offside, sebelum menyarangkan gol ke gawang The Hammers. “Tim ini telah memainkan yang terbaik dan telah mencetak satu gol terbaik musim ini. Namun dia dan asisten wasit merampas kemenangan kami,” sesal pelatih 58 tahun itu. Roberto Mancini, manajer Manchester City, ikut kecewa dengan gol Van Persie tersebut. Dalam komentarnya setelah City mengatasiWigan 1-0, Mancini menilai gol striker kidal MU

Hasil Rabu (Kamis WIB) Fulham v Chelsea Man City v Wigan West Ham v MU

0-3 1-0 2-2

Hasil Selasa (Rabu WIB) Arsenal v Everton


itu tidak sah saat memaksimalkan bola rebound hasil tendangan Shinji Kagawa yang menerpa tiang gawang Hammers. “Jika mereka (United) tidak mencetak gol offside, maka selisih poin akan semakin sedikit. Kami bisa mengikisnya menjadi hanya 9 poin,” klaim pelatih asal Italia itu lewat The Sun. (m15/okz/sky/sun)


WASPADA Jumat 19 April 2013


Pro Duta Kurang Beruntung Ditahan Persebaya 1-1 MEDAN (Waspada): Pro Duta FC memperoleh hasil kurang menguntungkan setelah kehilangan poin saat menjamu Persebaya Surabaya 1-1 dalam lanjutan Indonesian Premier League (IPL) di Stadion Teladan Medan, Kamis (18/4). Dengan demikian, tim Kuda Pegasus ini mengoleksi 14 poin dan masih bertengger pada posisi ketiga klasemen sementara. Di hadapan 3000-an pendukung di antara puluhan suporter Bonek (Persebaya) yang turut hadir, pola 4-3-3 yang diterapkan Pro Duta berhasil merepotkan skuad Bajul Ijo yang turut diperkuat Andik Vermansyah. Menit 10, striker asing Persebaya Fernando Soler mengejutkan seisi Stadion Teladan ketika membobol gawang Dennis Romanovs. Namun gol itu dianulir wasit karena terlebih dulu berdiri dalam posisi offside. Kedudukan imbang tanpa gol bertahan sampai turun minum. Baru dua menit babak kedua, Rahmat Hidayat memecahkan kebuntuan Pro Duta. Wasit Faulur Rossi menunjuk titik putih, setelah Girts Karlons dijatuhkan Goran Ganchev di daerah penalti. Rahmat pun ber-

PSSI Tutup Konflik Antara

WASIT melihat bek Persebaya Surabaya Goran Ganchev (kanan) dan striker Pro Duta FC Girts Karlsons (kiri) terjatuh pada lanjutan Indonesian Premier League (IPL) di Stadion Teladan Medan, Kamis (18/4). hasil mengeksekusi bola dengan baik. Sayang, gol ini tidak bertahan lama. Menit 53, Maro Karlovic memaksa Romanovs memungut bola dari jala gawang. Tuan rumah nyaris mencetak gol andai tendangan Rahmat Hidayat dari jarak sekira 25 meter tidak membentur mistar. Sebaliknya, dua menit jelang

bubaran, aksi solo run AndikVermansyah berhasil diantisipasi Romanovs dan menghasilkan tendangan pojok. Hingga peluit panjang, Kuda Pegasus harus puas berbagi angka dengan Persebaya. Usai pertandingan, Pelatih Pro Duta Roberto Bianchi mengakui anak-anak asuhannya kurang beruntung meraih tiga

poin. “Kita banyak peluang, namun finishing touch tidak ada,” kata pelatih berkebangsaan Spanyol itu mengakui Persebaya yang diperkuat pemain Timnas juga tampil baik. Beto, sapaan akrab Bianchi, pun mengaku kesal dengan kurang maksimalnya lini tengah. Cederanya Faisal Azmi, Jose Pe-

drosa Galan, dan Agus Nova dinilai menjadi salah satu kurang menggigitnya lini tengah Pro Duta. Alhasil, Beto menegaskan akan melakukan evaluasi untuk laga berikutnya. Pelatih Persebaya Ibnu Grahan mengaku puas dengan membawa pulang satu poin. Dikatakan, Pro Duta bermain bagus secara kolektif. (m18)

Tunggal Indonesia Habis


48 SSB Ikuti Festival Surya Putra Syawal Sakti Cup III MEDAN (Waspada): 48 SSB akan mengikuti Festival Surya Putra Syawal Sakti Cup III yang berlangsung selama tiga hari pada 26-28 April mendatang di Lapangan Pasar VII Sampali Peercut Sei Tuan. Menurut Ketua Umum SSB Surya Putra Sampali, Ridwan Lubis (foto), di Medan, Kamis (18/4), kegiatan ini dimaksudkan sebagai pembinaan atlet usia muda dalam cabang sepakbola. Setelah sempat terhenti selama dua tahun, festival ini diperuntukkan bagi siswa berusia 13 tahun atau kelahiran tahun 2000. Guna mengantisipasi pencurian umur, pihaknya meminta kejujuran pemain, orang tua pemain dan pengurus dalam melengkapi berkas pemain seperti foto kopi akta kelahiran, STTB, rapor, dan lainnya. “Mulai Jumat (19/4), kita sudah melakukan pemeriksaan data dan kelengkapan pemain sampai Minggu (21/4) sampai pukul 13:00 WIB. Kemudian

TAIPEI (Waspada):Wakil Indonesia di Kejuaraan Bulutangkis Asia 2013 tinggal menyisakan ganda putri dan campuran saja, setelah ganda putra dan tunggal gagal meloloskan pemainnya di perempatfinal, Kamis (18/4). Kekalahan Bellaetrix Manuputty (foto) pun melengkapi kegagalan tunggal putri. Melawan Ratchanok Intanon (Thailand), Bella harus mengakui keunggulan finalis All England 2013 itu 13-21, 16-21. “Pada game pertama, saya kalah angin, jadi bola pengembalian saya tanggung semua sehingga saya takut untuk mengangkat bola. Serba salah juga, karena bola-bola saya jadinya jarang yang menyulitkan lawan. Permainan saya juga diatur oleh Ratchanok, apalagi bola-bola

Final LPI Batubara

Waspada/Setia Budi Siregar

dilanjutkan pertemuan teknik pada pukul 14:00 WIB,” jelas Ridwan. Untuk pertandingan perdana, Jumat (26/4), dilaksanakan pukul 15:00 WIB. Selanjutnya Sabtu dan Minggu dimulai pukul 08:00 WIB. “Kita berharap partisipasi sekolah sepakbola untuk mengirimkan skuad terbaiknya. Dengan demikian diharapkan muncul pemain berkualitas ke depan,” pungkas Ridwan. (m18)

LIMAPULUH (Waspada): SMKN 1 Airputih akan menantang MAN Limapuluh pada laga final Liga Pelajar Indonesia (LPI) Batubara di Lapangan Perkebunan Dolok Kecamatan Limapuluh, Jumat (19/4) ini. SMKN 1 melangkah ke partai puncak setelah menundukkan SMK Budhi Darma Indrapura lewat adu tendangan penalti 5-4, Kamis (18/4). Laga semifinal kedua tim merupakan lanjutan sehari sebelumnya, setelah terhenti karena hujan lebat dan angin kencang. Saat laga dihentikan, kedudukan imbang 1-1. Pertandingan yang tinggal menyisakan

“Pertandingan ini merupakan upaya menjalin silaturahim serta menyemarakkan HPN 2013,” kata Kabag Humas Pemkab Langkat, Rizal Gunawan Gultom didampingi Koordinator Olahraga HPN dan HUT PWI ke-67 Budi Zulkifli, seusai rapat koordinasi di Ruang Rapat Sekdakab Langkat, Rabu (17/4). Dalam pertandingan itu, nantinya pihak Pemkab Langkat akan menurunkan para pemain senior seperti Kadispora Drs TM Auzai, Asisten I Bidang Pe-

merintahan Drs Abdul Karim, Pimpinan Bank Sumut Cabang Stabat TM Jefri, dan Asisten III Drs. Sura Ukur. Sedangkan PWI Langkat Plus akan menurunkan para wartawan yang bertugas di Langkat dan Binjai, seperti Andika, Heri Putra Ginting (Analisa), Budi Zulkifli (Andalas), Bayu Aditama (Metro 24), Deva Armaya (TVRI), M Aswin (Monitor/Satya Bakti), M Hijrah (Metro 24 Jam), A Malik Ariadi (Medan Pos), dan Bambang (Pos Metro LangkatBinjai). (a01)

Peluru FC Antiklimaks MEDAN (Waspada): Impian Peluru FC menjadi peringkat ketiga di akhir kiprahnya pada Liga Futsal Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan akhirnya gagal terwujud. Di laga akhirnya, Kamis (18/4), Peluru harus puas menempati posisi kelima. Kondisi tersebut didapat Christopel Naibaho cs setelah dikalahkan Potret FC 2-5. Bagi Peluru, hasil ini menjadi penurunan setelah tahun lalu meraih predikat runner-up. Melawan Potret, penampilan Peluru pun terlihat antiklimaks. Kendati menang, posisi ketiga belum pasti bagi Potret FC mengingat laga penutup pada

Apri Nugroho/Annisa Saufika tidak berdaya menghadapi Shin Baek Choel/Jang Ye Na (Korsel) 15-21, 12-21, ganda campuran tinggal berharap pada Fran Kurniawan/Shendy Puspa Irawati. Fran/Shendy lolos ke babak delapan besar hasil menghentikan laju Lee Seng Mu/Cheng Wen Hsing (China Taipei) 2115, 21-12. Sementara asa ganda putri berada di pundak Gebby Ristiyani Imawan/Tiara Rosalia. Lewat pertarungan alot, Gebby/Tiara menang atas Yixin Bao/Qing Tian (China) 26-24, 21-23, 21-13. Sayangnya, Suci Rizky Andini/Della Destiara Haris gagal mengikuti jejak rekannya akibat takluk dari Amelia Alicia Anscelly/Fie Cho Soong (Malaysia) 19-21, 17-21. (m33/tsw)

SMKN 1 Tantang MAN Limapuluh

Panpel HUT PWI Eksibisi Sepakbola STABAT (Waspada): Panitia Pelaksana Perayaan Hari Pers Nasional (HPN) dan HUT Persatuan Wartawan Indonesia (PWI) tingkat Sumatera Utara ke-67, akan menggelar pertandingan sepakbola eksibisi antara Pemkab Langkat dan PWI Langkat Plus, Jumat (26/4). Acara puncaknya HPN dan HUT PWI sendiri akan dipusatkan di Stabat, Kabupaten Langkat, Sabtu (27/4). Sedangkan pertandingan eksibisi berlangsung di Lapangan Tengku Amir Hamzah di Kota Stabat.

saya masih monoton,” jelas Bella. Sebelumnya, wakil tunggal putri yang tumbang lebih dulu adalah ApriliaYuswandari, Maria Febe Kusumastuti, dan Hera Desi. Hasil serupa dialami tunggal putra ketika Mahbub Thomi Azizan dam Shesar Hiren tersingkir. Unggulan 10 asal Malaysia, Wei Feng Chong, mengakhiri laju Mahbub 21-17, 21-13 dan Zhengming Wang (China) memulangkan Shesar 21-9, 21-17. Ganda putra juga mengalami keterpurukan dengan tidak menyisakan wakil. Alhasil, ganda putri dan campuran menjaga harapan gelar bagi Indonesia. Setelah Markis Kido/Pia Zebadiah kalah dari Wei Hong/Jinhua Tang (China) 21-18, 16-21, 20-22 dan Lukhi

Sabtu (20/4) besok masih berlangsung duel antara Taka-Tiki kontra Tim Sisa Dunia (TSD). Berada di posisi keempat, Taka-Tiki yang notabene anggota BEM wajib menang atas TSD yang sudah berhasil mempertahankan gelar juaranya. Bila menang, Dio Utama cs dipastikan menempati runner-up menggeser Potret ke posisi empat dan Gunners FC ketiga. Gunners FC sendiri meraih kemenangan telak saat berhadapan dengan Federasi FC. Dengan modal lima gol dari Rizky Umara, Chandra (2), dan M Fadli (2), Gunners memukul Federasi 9-1. Satu-satunya gol Federasi dicetak Theodorus.

Disinggung terkait laga penutup yang tidak memengaruhi posisi puncak di klasemen, segenap punggawa TSD menegaskan kemenangan tetap menjadi target mereka. Hal ini dipicu tekad mengakhiri liga internal kampus ilmu komunikasi tersebut sebagai tim yang tak terkalahkan atau sama seperti tahun lalu. “Ya, kami tetap fokus menang sekaligus menggagalkan predikat runner-up untuk TakaTiki. Bila terwujud, maka sejarah gelar ini kian lengkap karena kamu belum pernah kalah dalam dua tahun terakhir ini,” sebut Wakil Kapten TSD, David Swayana. (cay)

adu tendangan penalti itu terpaksa ditunda karena cuaca tak mengizinkan. Dalam drama penalti, empat dari lima algojo SMKN 1 menjalankan tugasnya dengan baik. Keempat eksekutor penalti SMKN 1 yang sukses membobol gawang lawan adalah Rudi Khairudin, Jodi Setiawan, Mhd Fahrurrizal, dan Feri Astara. Sedangkan Heri Kurniawan gagal menjalankan tugas. SMK Budhi Darma harus mengakui keunggulan SMKN 1 setelah hanya mampu mencetak tiga gol dari lima eksekutor. Sebelumnya, juara bertahan

MAN Limapuluh melaju ke final setelah menundukkan SMAN 1 Talawi 2-1. Manajer Tim SMKN 1 Airputih, Sapta Andika didampingi ofisial Rijal Amin, mengaku bangga atas sukses tim asuhannya. “Sukses ini sekaligus revans atas kekalahan kami dari SMK Budhia Darma pada laga babak penyisihan grup sebelumnya,” ujar Sapta. “Kami yakin tim dapat mempertahankan pola permainan pada final nanti. Dengan demikian, kami akan dapat menundukkan MAN sekaligus meraih gelar juara,” tegasnya. (c04/a12)

BANDUNG ( Waspada): Ketua Umum PSSI, Djohar Arifin Husin, menegaskan konflik di PSSI sudah ditutup dan tidak boleh ada lagi. Karena itu, siapa pun yang masih mau ribut-ribut, yang bersangkutan diminta lebih baik duduk manis. Pasalnya, konsentrasi organisasi sepakbola nasional yang ia pimpin saat ini, tidak lagi pada penyelesaian masalah konflik. Akan tetapi bagaimana membangun prestasi sepakbola nasional ke arah yang lebih baik. Demikian ditegaskan Djohar kepada wartawan saat memberi keterangan seusai mengunjungi makam Ir R Soeratin di TPU Sirnaraga Pajajaran, Bandung, Kamis (18/4). “Sudah saatnya PSSI memikirkan cara agar Indonesia bisa berbicara di level Asia dan bukan lagi konflik yang harus terus Waspada/Yuslan Kisra menerus diurus. Yang masih menginginkan konflik, silakan KETUA Umum, PSSI Djohar Arifin Husin didampingi anggota duduk manis saja. PSSI tidak Exco La Siya, menabur bunga di makam Ir Soeratin, Kamis (18/4). butuh orang-orang seperti itu,” tegas Djohar. PSSI. Selain dalam rangkaian acara HUT PSSI, Pernyataan tersebut menyusul masih adanya kami pun sengaja ke sini untuk memanjatkan upaya yang dilakukan Wakil Ketua Umum PSSI, doa agar arwah almarhum Bapak Ir Soeratin Farid Rahman, bersama lima Exco PSSI terhukum diberi tempat yang layak di sisi-Nya,” kata Djohar. lainnya, untuk mengadukan masalah yang “Ini juga sekaligus ingin menunjukan tekad dihadapi ke FIFA. Sayangnya, FIFA menolak meneruskan cita-cita beliau untuk memimpin aduan yang disampaikan, karena hanya bersedia PSSI hingga meraih prestasi yang membanggakan melakukan korespondensi dengan Djohar selaku bangsa dan negara. Sebab tujuan awal pendirian Ketua Umum dan Sekjen Hadiyandra. PSSI memang demikian,” sambungnya. (yuslan) “Hari ini, kami ziarah ke makam pendiri

Jacksen Besut Timnas Senior JAKARTA (Waspada): Pelatih klub Persipura Jayapura, Jacksen F Tiago, resmi menangani Timnas Indonesia senior menggantikan posisi pelatih asal Argentina, Luis Manuel Blanco. Kepastian Jacksen menangani timnas senior itu disampaikan langsung oleh Ketua Badan Tim Nasional (BTN), La Nyalla Mattalitti, di Kantor PSSI Senayan Jakarta, Kamis (18/4). “Sebenarnya ada dua permintaan, yaitu tetap Blanco dan Rield (Alfred Riedl). Tapi akhirnya saya memutuskan timnas senior diserahkan ke Jacksen F Tiago,” kata La Nyalla seusai rapat BTN. Menurut dia, untuk memutuskan pelatih asal Brazil itu menjadi pelatih timnas terlebih dulu dibahas dalam rapat BTN yang melibatkan tokoh-tokoh olahraga seperti Andi Darussalam, TommyWelly, Anton Sanjoyo maupun Nilmaizar. “Selain melakukan koordinasi dengan tokohtokoh olahraga yang diundang dalam rapat, BTN juga melakukan koordinasi dengan manajemen Persipura, di mana Jacksen F Tiago saat ini mengadu nasib,” katanya. “Manajemen Persipura sudah setuju Jacksen F Tiago menangani timnas. Mereka mau melepasnya,” kata pria yang juga anggota Komite

Eksekutif PSSI itu. La Nyalla menambahkan, dengan menetapkan Jacksen F Tiago sebagai pelatih timnas senior, BTN memberikan keleluasaan penuh untuk menyusun tim pendukung termasuk pemilihan pemain yang akan memperkuat timnas. “Untuk asisten pelatih, BTN menyerahkan sepenuhnya kepada Jacksen. Kami tidak ikut campur masalah ini,” kata pria yang juga Ketua Pengprov PSSI Jawa Timur itu. Ditanya berapa lama Jacksen diberi kepercayaan menangani timnas senior, La Nyalla mengaku hanya menangani timnas saat turun di Pra Piala Asia (PPA) 2015. Hanya saja, peluang untuk diperpanjang tetap terbuka seiring dengan prestasi yang diraih timnas. “Jika hasilnya bagus, ya akan diteruskan,” kata anggota Komite Eksekutif PSSI yang statusnya kembali disahkan pada Kongres Luar Biasa (KLB) PSSI di Hotel Borobudur Jakarta, 17 Maret lalu itu. Untuk Blanco, kata La Nyalla, tetap diberikan tempat di timnas. Hanya saja pelatih asal Argentina itu diberi pos untuk menangani Timnas U-19, sedangkan Timnas U-23 dipercayakan kepada Rahmad Darmawan. (m42/ant)



WASPADA Jumat 19 April 2013

Lakers Selamat LOS ANGELES, AS (Waspada): Los Angeles Lakers tidak hanya menjadi tim terakhir yang lolos ke playoff NBA. Kemenangan atas Houston Rockets 9995, Kamis (18/4), membuat Lakers menempati posisi ketujuh klasemen Wilayah Barat. Tanpa Kobe Bryant yang cedera, Pau Gasol menjadi bintang Lakers dengan 17 angka

20 rebound, 11 assist. Steve Blake ikut bersinar dengan mengemas 24 poin ditambah

Hasil Kamis (18/4)


STEVE Blake (2) mengisi kekosongan LA Lakers yang kehilangan Kobe Bryant saat tampil gemilang menghadapi Houston Rockets di Staples Center, Kamis (18/4).

Murray Serba Salah MONTE CARLO (Waspada): Kesalahan demi kesalahan menyebabkan Andy Murray (foto) secara mengejutkan tersingkir dari Monte Carlo Masters 2013, Kamis (18/4). Petenis Inggris Raya itu sama sekali tidak berdaya menghadapi Stanislas Wawrinka (Swiss) yang menang telak 6-1, 6-2. Sejak awal, Wawrinka memang lebih memegang kendali permainan. Setelah tiga kali mematahkan servis Murray, Wawrinka berhasil merebut set pertama 6-1. Murray, berusaha merebut gelar Masters kedua, mencoba bangkit di set kedua. Setelah silih berganti merebut angka, perlahan Wawrinka mendikte lawan. Wawarinka langsung melejit dan memimpin 5-2. Meski Murray berusaha keras untuk bertahan, Wawrinka tetap berhasil menyingkirkan juara AS Terbuka itu 6-2. Di babak delapan besar, Wawrinka sudah ditunggu oleh Jo-Wilfried Tsonga. Petenis Prancis itu lolos setelah mengalahkan Juergen Melzer (Austria) 6-3, 6-0. Kejutan lain terjadi ketika Tomas Berdych (Rep Ceko) ikut angkat koper. Tanpa di-


duga, Berdych kalah dari Fabio Fognini (Italia) 4-6, 2-6. Nantinya, Fognini akan berhadapan dengan Richard Gasquet (Prancis) yang memupus harapan Marin Cilic (Kroasia) 7-5, 6-4. Juara bertahan Rafael Nadal juga lolos dan menjaga asa kampiun kesembilan beruntun di Monte Carlo. Petenis Spanyol itu mengandaskan Philipp Kohlschreiber (Jerman) 6-2, 6-4 dan berjumpa Grigor

Dimitrov (Bulgaria) yang menang 6-2, 6-4 dari Florian Mayer (Jerman). Pelengkap perempatfinal adalah Novak Djokovic (Serbia) dan Jarko Nieminen (Finlandia). Bila Djokovic menumbangkan Juan Monaco (Argentina) 4-6, 6-2, 6-2, maka Nieminen memaksa Juan Martin del Potro juga dari Negeri Tango menyerah 6-4, 4-6, 7-6. (m33/ap)

Brooklyn Nets vs Detroit Pistons Charlotte Bobcats vs Cleveland Cavaliers Chicago Bulls vs Washington Wizards Dallas Mavericks vs New Orleans Hornets Denver Nuggets vs Phoenix Suns Memphis Grizzlies vs Utah Jazz Miami Heat vs Orlando Magic New York Knicks vs Atlanta Hawks Toronto Raptors vs Boston Celtics Philadelphia 76ers vs Indiana Pacers Milwaukee Bucks vs Oklahoma City Thunder Minnesota T’wolves vs San Antonio Spurs LA Lakers vs Houston Rockets Golden State Warriors vs Portland T’blazers LA Clippers vs Sacramento Kings

103-99 105-98 95-92 99-87 118-98 86-70 105-93 98-92 114-90 105-95 95-89 108-95 99-95 99-88 112-108

Dwight Howard yang mengoleksi 16 poin 18 rebound.Torehan tersebut terasa terlalu banyak bagi James Harden yang tampil sebagai top skor Rockets hasil mendulang 30 poin. Keadaan Lakers juga diuntungkan lewat tumbangnya pesaing terdekat mereka, Utah Jazz. Melawan Memphis Grizzlies yang diperkuat Marc Gasol (adik kandung Pau Gasol), Jazz tumbang 70-86. Zach Randolph menjadi pemain terbaik Grizzlies dengan 25 angka 19 rebound. Meski kalah dari Lakers, Rockets tetap lolos sebagai unggulan delapan Wilayah Barat. Sebagai unggulan utama ada Oklahoma City Thunder disusul San Antonio Spurs, Denver Nuggets, LA Clippers, Memphis Grizzlies, Golden StateWarriors, dan Lakers. Di Wilayah Timur, Miami Heat mempertegas posisi unggulan utama. Tim juara berta-

han itu mengalahkan Orlando Magic 105-93. Pemimpin Heat kali ini adalah Dwayne Wade yang menoreh 21 poin 10 assist didampingi Mike Miller juga dengan 21 angka. Khusus Miller, 18 poin diraih dari garis three point kala mengisi tempat LeBron James yang diistirahatkan.

Pada playoff nanti, Heat akan bertemu Milwaukee Bucks. NewYork Knicks, runnerup Wilayah Timur, ditantang Boston Celtics diikuti pertarungan antara Indiana Pacers melawan Atlanta Hawks dan Brooklyn Nets kontra Chicago Bulls. (m33/ap)

Sumatera Utara

WASPADA Jumat 19 April 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:26 12:40 12:27 12:34 12:34 12:30 12:27 12:23 12:29 12:29

15:40 15:51 15:40 15:46 15:46 15:46 15:41 15:37 15:43 15:41

Magrib 18:33 18:48 18:34 18:42 18:41 18:36 18:33 18:29 18:36 18:37



Shubuh Syuruq


19:43 19:58 19:44 19:52 19:51 19:45 19:43 19:39 19:46 19:46

04:51 05:03 04:52 04:57 04:58 04:57 04:52 04:48 04:54 04:53

05:01 05:13 05:02 05:07 05:08 05:07 05:02 04:58 05:04 05:03

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:17 06:29 06:18 06:24 06:24 06:23 06:18 06:14 06:20 06:19

Zhuhur ‘Ashar 12:32 12:26 12:25 12:36 12:24 12:25 12:25 12:22 12:39 12:26

15:44 15:39 15:38 15:49 15:39 15:39 15:39 15:36 15:50 15:41



Imsak Shubuh Syuruq


18:41 18:32 18:32 18:44 18:29 18:31 18:31 18:27 18:48 18:31

19:50 19:42 19:41 19:53 19:38 19:41 19:40 19:37 19:58 19:41

04:56 04:50 04:49 05:01 04:51 04:50 04:51 04:48 05:02 04:52

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:06 05:00 04:59 05:11 05:01 05:00 05:01 04:58 05:12 05:02

06:22 06:16 06:15 06:27 06:17 06:16 06:17 06:14 06:28 06:18

Zhuhur ‘Ashar 12:26 12:27 12:37 12:30 12:27 12:34 12:22 12:32 12:25 12:24

15:41 15:41 15:48 15:44 15:40 15:46 15:36 15:46 15:40 15:38





Shubuh Syuruq


18:31 18:33 18:45 18:36 18:34 18:41 18:28 18:39 18:31 18:31

19:41 19:43 19:55 19:45 19:43 19:51 19:38 19:48 19:40 19:41

04:52 04:53 05:00 04:56 04:52 04:58 04:47 04:57 04:52 04:50

05:02 05:03 05:10 05:06 05:02 05:08 04:57 05:07 05:02 05:00

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:18 06:19 06:26 06:22 06:18 06:24 06:13 06:23 06:17 06:15

Zhuhur 12:23 12:30 12:28 12:23 12:25 12:22 12:22 12:32 12:26 12:21 12:22

‘Ashar Magrib 15:38 15:46 15:42 15:37 15:39 15:38 15:38 15:44 15:41 15:35 15:37

18:27 18:34 18:34 18:30 18:31 18:28 18:27 18:40 18:32 18:26 18:28



Shubuh Syuruq

19:37 19:43 19:43 19:39 19:41 19:37 19:36 19:50 19:41 19:35 19:38

04:50 04:57 04:53 04:48 04:51 04:49 04:49 04:55 04:52 04:47 04:48

05:00 05:07 05:03 04:58 05:01 04:59 04:59 05:05 05:02 04:57 04:58

06:16 06:23 06:19 06:14 06:17 06:15 06:15 06:21 06:18 06:13 06:14

Mantan Anggota DPRD Todongkan Senjata STABAT (Waspada): Mantan anggota DPRD Langkat diringkus aparat Polsek Kuala TEBINGTINGGI (Waspada): Sekira 20 kepala keluarga (KK) Resort Langkat karena di Kel. Pabatu, Kec. Padang Hulu, di belakang kantor Camat, belum memiliki senjata airmenikmati jaringan listrik secara normal. softgun dan menodongMeski permintaan untuk mendapatkan akses listrik sudah lama diajukan. Alasan klise yang muncul, tidak ada tiang kannya ke karyawan menyambung jaringan ke lokasi. kebun, Kamis (18/4) .

20 KK Belum Nikmati Jaringan Listrik

Hal itu mengemuka saat reses anggota DPRD kota Tebingtinggi daerah pemilihan III, Kamis (18/4), di halaman kantor Kec. Padang Hulu, di Jalan Gatot Subroto. Hadir H. Amril Harahap, Parlindungan Rajagukguk, SE, Kornel Sihaloho dan Christoph Munthe, Camat Drs. Bambang Sudaryono dan lurah serta ratusan warga. Siti Hajar, warga yang menyampaikan keluhan, mengatakan mereka cuma menikmati listrik sambungan dari rumah warga, dengan membayar kepada pemilik rumah. Warga lain menyampaikan masalah KTP elektronik yang hilang, tapi tak jelas bagaimana prosedur penggantinya. Ada juga warga belum mendapat e-KTP. Pihak Dinas Kependudukan dan Capil Zahidin, mengatakan untuk e-KTP yang hilang tidak ada gantinya, sehingga sementara harus menggunakan KTP sistem SIAK lama. “Untuk sementara gunakan saja KTP sistem SIAK,” terang dia. Kebanyakan warga dari Kel. Pabatu, Lubuk Baru dan Padang Merbau, mengeluhkan drainase yang tumpat, sehingga menimbulkan banjir di lingkungan mereka. Masalah keamanan juga mengemuka, ketika Ina warga Lk. 03, Kel. Lubuk Baru, mengeluhkan beroperasinya warung tuak di sekitar kediamannya. Menanggapi itu, Camat Drs. Bambang Sudaryono mengatakan segera melakukan koordinasi dengan sejumlah instansi untuk menutup warung tuak itu. (a09)

Pengusaha Galian C Perbaiki Jalan Patumbak PATUMBAK (Waspada): Pengusaha galian C tanah merah di Patumbak secara swadaya memperbaiki ruas jalan yang rusak di Jalan Pertahanan, Patumbak, Deliserdang, Kamis (18/4). Pantauan Waspada, perbaikan jalan dimulai dari Desa Patumbak I hingga perbatasan Kec. Patumbak dengan Medan Amplas. Sejumlah dump truk membongkar material sirtu campur tanah merah untuk menimbun jalan berlobang. Di bawah terik matahari, sejumlah pengusaha galian C di antaranya Ria Barus, Kasianto, Sulaiman, Bondan, Bistok Barus dan Koko dibantu puluhan pekerja menimbun jalan menggunakan peralatan seadanya. Bistok Barus mengatakan, perbaikan jalan secara swadaya untuk memberi kenyamanan bagi warga sekitar dan pengguna jalan. Menurutnya, sepekan ke depan perbaikan sudah rampung sehingga pengendara tidak lagi kesulitan melintasi Jalan Pertahanan. “Setelah ditimbun jalan akan diaspal,” sebutnya. Sementara, warga yang mengetahui perbaikan jalan tersebut mengapresiasi. “Terimakasih sudah membantu meringankan tugas pemerintah untuk memperbaiki jalan,” kata warga Desa Patumbak Kampung, Abdul.(c02)

Tersangka ZS, 45, warga Desa Beruam Kec. Kuala ditahan di Mapolres Langkat untuk pengembangan penyidikan. Kapolsek Kuala AKP SR Tambunan mengatakan, tersangka melarang karyawan Kebun Bekiun untuk panen sawit di kawasan Lau Kirik tanpa alasan jelas, dan

Sergai Raih Paviliun Terbaik Di PRSU SEI RAMPAH (Waspada: Kabupaten Serdang Bedagai (Sergai) kembali mengulangi kesuksesan di Pekan Raya Sumatera Utara (PRSU) ke-42 tahun 2013, dengan meraih predikat Terbaik I Paviliun Pemkab/ Kota kategori Penataan dan Penampilan Terbaik. Terbaik II diraih Pemko Medan dan III Pemkab Nias. Selain predikat terbaik I, Kab. Sergai juga meraih juara II kategori dekorasi paviliun. PRSU ke-42 yang berlangsung sebulan penuh sejak Jumat (15/3), telah berakhir dan ditutup Gubsu H. Gatot Pujo Nugroho, ST, diwakili Sekdaprovsu H. Nurdin Lubis, SH, MM di open stage PRSU kompleks Tapian Daya Medan. Malam penutupan yang dihadiri sejumlah unsur Forum

Komunikasi Pimpinan Daerah (FKPD) Provsu, para Bupati/ Walikota se-Sumut itu diumumkan pemenang berbagai perlombaan dan paviliun/stand terbaik. Gubsu H. Gatot Pudjo Nugroho dalam sambutan tertulis dibacakan Sekdaprov Nurdin Lubis, menyampaikan apresiasi atas bantuan dan kerjasama semua pihak yang telah mensukseskan PRSU ke-42 ini. Pada kesempatan itu Sekdaprovsu Nurdin Lubis menyerahkan penghargaan kepada Bupati Sergai Ir. HT. Erry Nuradi, M.Si diwakili Sekdakab Drs. H. Haris Fadillah, M.Si di dampingi Asisten Ekbangsos Drs. Amirullah Damanik dan Kabag Perekonomian Drs. H. Mariyono SP. Sergai Juara II Selain meraih Terbaik I

PTPN III Kebun Gunung Pamela Beri Tali Asih TEBINGTINGGI (Waspada): Pihak PTPN 3 Kebun Gunung Pamela memberi tali asih lahan kepada masyarakat yang mengembalikan lahan areal HGU perusahaan perkebunan tersebut, yang selama ini mereka usahai. Manajer PTPN III Perkebunan Pamela, H. Tambal Siregar, Rabu (17/4) mengatakan, tahap pertama pada 2012 diberikan tali asih kepada 67 orang dengan luas lahan 34,86 ha. Tahap kedua 2013 kepada 13 orang dengan luas 8,72 ha. Tahap ketiga tahun 2013, dengan luas areal 2,06, sehingga seluruhnya seluas 45,64 ha. Penyerahan tali asih disaksikan pihak dari Kejaksaan Tinggi Sumatera Utara, Muspika Kec. Sipis-pis dan Tebingtinggi, serta manajemen PTPN III. Dalam waktu dekat, menurut H. Tambal Siregar, pihaknya akan kembali menyerahkan tali asih kepada masyarakat yang akan mengembalikan areal HGU yang mereka usahai selama ini. Jumlah luas areal yang sudah dikembalikan masyarakat kepada PTPN III Gunung Pamela di masa kepemimpinannya, mencapai 100 ha. Karena itu dia berterimakasih kepada Muspika Sipis-pis dan Tebingtinggi yang mendukung program PTPN 3 ini, khususnya di Kebun Gunung Pamela.(a11)

Amri Tambunan Bantu Korban Puting Beliung PERCUT SEI TUAN (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan membantu masyarakat Kec. Percut Seituan yang jadi korban puting beliung, pada Minggu (14/4) sore. Bantuan diserahkan Camat Percut Seituan, Darwin Zein, S.Sos di Balai Desa Cinta Rakyat, Rabu (17/4), melalui Kepala Desa masing-masing disaksikan masyarakat. Dalam sambutannya Camat Percut Sei Tuan mengatakan, peristiwa bencana alam seperti puting beliung bukanlah kehendak manusia, namun kehendak TuhanYang Maha Esa yang tidak dapat diketahui oleh manusia kapan terjadi. Dikatakan, bantuan yang diterima korban merupakan salah satu bentuk perhatian Pemkab Deliserdang khususnya Bupati H. Amri Tambunan. Bantuan ini belumlah cukup untuk memperbaiki rumah yang rusak, namun setidaknya bisa meringankan beban yang diderita. Bantuan jumlahnya bervariasi sesuai tingkat kerusakan yang dialami. Bagi yang rumahnya rusak berat mendapat Rp2,5 juta, rusak sedang Rp1,5 juta dan rusak ringan Rp500 ribu. (crul)

kategori Penataan dan Penampilan Terbaik dan juara II Paviliun Pemerintah Kab/Kota kategori Dekorasi, Kab. Sergai juga meraih juara II Penampilan Kesenian Daerah Kab/Kota pada malam pesona budaya Sergai yang digelar 3 April lalu. Pada malam pesona budaya tersebut ditampilkan pagelaran seni drama dari Cermin Theater binaan Bagian Humas Setdakab Sergai diasuh M. Syafei Harahap, S.Pd menampilkan drama komedi musikal bertajuk “Musuh Berbuyutan”, dengan penulis skenario langsung oleh pimpinan sanggar Cermin Theater. Sanggar Cermin Theater Sergai banyak memperoleh penghargaan baik tingkat daerah, provinsi maupun nasional.(a08)

Waspada/Abdul Hakim

BUPATI Langkat, H. Ngogesa Sitepu, SH berdialog dengan anak-anak peserta khitanan massal yang digelar panitia Hari Pers Nasional (HPN) da Hut ke 67 PWI tingkat Sumatera Utara di Langkat.

Rangkaian HPN Dan HUT ke 67 PWI Sumut

Ngogesa Mendadak Tinjau Khitanan Massal STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH mendadak meninjau pelaksanaan khitanan massal di aula Kantor Camat Stabat, Kamis (18/4). Kegiatan tersebut rangkaian menyongsong peringatan Hari Pres Nasional (HPN) 2013 tingkat Sumatera Utara serta HUT Ke 67 Persatuan Wartawan Indonesia (PWI) yang dipusatkan di Stabat, Kab. Langkat, Sabtu 27 April mendatang. Bupati H. Ngogesa berdialog dan menghibur peserta khitanan seraya bertanya tentang sekolah mereka dan sebagainya. Bahkan ketika berdialog bersama Bagus Afrizal, 12, warga Desa Karangrejo Stabat, Bupati Ngogesa minta mereka membaca ayat-ayat pendek dari kitab suci Al Quran.“Wah bagus dan hafal bacaannya ya,” kata Ngogesa seraya memberi hadiah sejumlah uang. Sebelumnya Camat Stabat, M. Noerta didampingi Ketua PWI Langkat, Ibnu Kasir dan

pimpinan Puskesmas Stabat, dr. Hasby membuka pelaksanaan khitanan dengan melakukan tepungtawar dan doa dipandu Ka KUA Stabat, H. Syamsul. Sementara ketua panitia lokal dari PWI Langkat, Hasan Basri, S.Ag dan Sekretaris panitia Selamat, S.Pd mengemukakan, peserta khitanan 250 orang. Untuk Langkat Hulu, khitanan massal dilaksanakan di Salapian. “Peserta memperoleh bingkisan kain sarung dan uang serta fasilitas antar-jemput menggunakan bus bantuan Bupati H. Ngogesa Sitepu,” ujar Selamat. Masih dalam rangkaian kegiatan yang sama, diselenggarakan penghijauan di Desa Banyumas Kec. Stabat. Ratusan bibit pohon mahoni dibagibagikan secara gratis kepada warga untuk ditanam di pekarangan rumah. Kegiatan ini juga dibantu puluhan pemuda dari wadah Gabungan Anak Stasiun (GAS) Banyumas.(a01/a03)

Wabup DS:

2013, Tahun Terakhir Pelaksanaan Visi Misi Pembangunan 2009-2014

Sepedamotor Laga Kambing Satu Tewas Satu Luka-luka BINJAI (Waspada): Dua sepedamotor lagi kambing di Jalan Diponegoro Kel. Tunggurono, Kec. Binjai Timur, kemarin malam, mengakibatkan satu tewas dan satu luka-luka. Kedua korban Subur, 28, warga Desa Sialang Paku Kec. Kutalimbaru, Kab. Deliserdang, tewas di rumah sakit. Sedangkan korban luka berat Feri Fariansyah, 21, warga Jalan Sei Brantas Kel. Tanah Seribu, Kec. Binjai Selatan. Kanit Laka Satlantas Polresta Binjai Ipda N. Sinuraya, mengatakan Rabu (17/4), kejadian berawal saat korban Subur mengendarai Honda Astrea Grant putih BK 2912 NL melaju dari Tunggurono menuju Kel. Mencirim. Sementara dari arah berlawanan juga datang Honda Supra tanpa plat BK dikendarai Feri. Diduga karena dalam kecepatan tinggi tabrakan tak terelakkan.(a05)

mengancam dengan senjata tersebut. Ancaman itu dilaporkan kepada petugas dan ditindaklanjuti dengan mengamankan tersangka. ’’Hingga kini masih didalami motif tersangka melarang pihak kebun memanen sawit,’’ kata Kapolsek.(a03)


BUPATI Sergai Ir. HT Erry Nuradi, M.Si diwakili Sekdakab Drs. H. Haris Fadillah, M.Si didampingi Asisten Ekbangsos Drs. Amirullah Damanik, Kabag Perekonomian Drs. H. Mariyono, SP dan mewakili Ketua Yayasan PRSU, bersama Gubsu H. Gatot Pujo Nugroho, ST diwakili Sekdaprovsu HM Nurdin Lubis, SH, MM usai penyerahan plakat dan piagam penghargaan pada penutupan PRSU ke-42 tahun 2013.

Pertama Di Indonesia, Balon Ditentukan Dengan Sistem Undi SERDANG BEDAGAI (Waspada): Pertama di Indonesia pemilihan legislatif dengan menentukan sistem undi. “Penentuan sistem undi bertujuan agar penentuan nomor urut bagi bakal calon legislatif (Bacaleg) transparan, accountable dan kredibel di seluruh jajaran pengurus PKB Sergai,” ujar Ketua DPC PKB Sergai, Udin Sirip kepada wartawan, kemarin. Dia menyatakan DPC PKB Kab. Serdang Bedagai (Sergai) sudah mempersiapkan diri menghadapi Pemilihan Legislatif (Pileg) tahun 2014. Untuk itu penjaringan bakal calon legislatif dilakukan dengan menentukan sistem undi, dan baru pertama dilakukan di Indonesia penentuan nomor urut ini dengan sistem undi. Dengan sistem ini bakal calon legislatif dapat mengetahui berapa nomor urutnya setelah mengambil nomor undian. Lebih lanjut disampaikan Udin Sirip, bahwa sistem undi untuk pemilihan nomor bagi bakal calon legislatif (Bacaleg) ini sudah didiskusikan jauh hari sebelumnya di Jajaran kepengurusan PKB Kab Serdang Bedagai. Upaya penjaringan nomor urut ini guna mengakomodir partisipasi perempuan sebagaimana diamanatkan undangundang pemilihan umum yang mengharuskan keterwakilan 30 persen perempuan. Setiap bakal calon legislatif (Bacaleg) yang diusung Partai Kebangkitan Bangsa (PKB) para calon menandatangani fakta integritas selama proses pendaftaran di Komisi Pemilihan Umum Daerah (KPUD).

“Fakta integritas ini dilakukan agar bakal calon legislatif yang diusung Partai Kebangkitan Bangsa (PKB) Kabupaten Serdang Bedagai loyal dan patuh terhadap kebijakan partai. Apa pun nomor urut yang dipilih itu berdasarkan buah tangan yang diambil para calon itu sesuai dengan nomor urut yang dihasilkannya setelah diundi “, tegas Udin Sirip. Ditambahkan Udin Sirip bahwa selama ini kita melihat penomor urutan bagi calon legislatif itu ditentukan oleh Partai itu sendiri. Sehingga proses ini banyak menimbulkan ketidakpuasan bagi setiap orang yang akan ikut melaju menjadi calon legislatif serta unsur kedekatan seorang calon kepada pimpinan pengurus partai nomor urut itu dapat dipilih. Oleh karena itu, Partai Ke-

bangkitan Bangsa (PKB) menerapkan sitem undi atau cabut nomor untuk menentukan nomor urut bakal calon legislatif (Bacaleg). Bagi para calon legislative yang diusung Partai Kebangkitan Bangsa hanya dikenakan sebesar Rp 200 ribu saja, ungkapnya. Sementara, M.Yunus Purba salah seorang anggota DPRD Sergai yang juga akan melaju kembali menjadi calon anggota legisltatif di Pemilu Legislatif 2014 mendatang dari Daerah Pemilihan V (Dolok Masihul, Sipispis, Bintang Bayu, Kotari dan Silindak) usai pencabutan nomor dengan sistem undi kepada BPB mengatakan bahwa sistem undi atau pencabutan nomor bagi para calon anggota legislatif yang diusung Partai Kebangkitan Bangsa ini mengaku puas. (m38)


Ketua DPC PKB Sergai Udin Sirip didampingi Sekretaris PKB Ahmad Sudiar,Ketua Lembaga Pemenangan Pemilu Fajar Darmono menyampaikan bimbingan dan arahan sebelum dilaksanakan pencabutan nomor urut dengan system di undi di Rumah Makan Wak Doy, Desa Firdaus Kecamatan Sei Rampah, Kab Sergai.

LUBUKPAKAM (Waspada): Tahun Anggaran 2013 merupakan tahun terakhir efektifnya pelaksanaan visi misi pembangunan Kab. Deliserdang 2009-2014. Karenanya kita ingin pengerjaan berbagai proyek pembangunan di daerah ini terlaksana dengan baik dan tepat waktu, sehingga momentum percepatan pembangunan tetap terjaga dan terpelihara. Penegasan itu disampaikanWakil Bupati Deliserdang, H. Zainuddin Mars selaku Inspektur Upacara pada apel bendera jajaran Pegawai Negeri Sipil (PNS) Pemkab Deliserdang di halaman kantor bupati Deliserdang di Lubuk Pakam, Rabu (17/4). Wabup menyatakan telah berulang-ulang menegaskan di berbagai kesempatan, bahwa seorang aparatur pemerintah hanya akan dapat meningkatkan kinerjanya apabila benarbenar mampu memahami tugas pokok dan fungsi (Tupoksi) nya dengan baik, serta

menguasai potensi yang dimiliki baik berupa peluang mau pun yang menjadi hambatan. “Pemahaman akan hal ini merupakan kompas paling efektif untuk dapat mencari terobosan-terobosan baru mau pun inovasi baru,” tegas Wabup seraya mengingatkan, apel kesadaran nasional kali ini diselenggarakan bertepatan bulan pertama triwulan II TA 2013, di mana kita sedang mempersiapkan dan melaksanakan berbagai program kegiatan yang sudah ditetapkan untuk TA 2013. “Karena itu April ini harus kita jadikan waktu yang sangat efektif, untuk mengevaluasi kegiatan-kegiatan yang telah dilakukan pada triwulan pertama guna disempurnakan lagi di triwulan kedua. Ini penting, karena kita ingin pengerjaan berbagai proyek pembangunan di daerah ini terlaksana dengan baik dan tepat waktu, sehingga momentum percepatan pembangunan daerah tetap terjaga dan terpelihara,” tegas Wabup.(a06)

Anak Kebon Daftar Jadi Calon Bupati Deliserdang MEDAN (Wasapada): Anak “kebon” yang dibesarkan di kawasan Sampali, Deliserdang, Muhamad Idris, S.Sos, mendaftar sebagai bakal calon (Balon) bupati ke DPD PAN Deliserdang, Rabu (17/4). Di hadapan Ketua PAN Imran Obos dan pengurus lain serta wartawan, Idris yang berkarir di TNI AU dan kini bertugas di Kementerian Pertahanan RI itu pun menegaskan keseriusannya membangun tanah kelahirannya itu. “Saya lahir dan dibesarkan di sini (di kawasan Kebun Sampali, Deliserdang-red). Jadi saya tau betul dan merasakan bagaimana susahnya kehidupan masyarakat kebon. Karena itu, saya sangat serius untuk membangun tanah kelahiran saya ini,” tegas Muhamad Idris. Bukti lain keseriusannya, ditandai dengan keputusannya untuk pensiun dini dari keanggotaan TNI AU. Pengajuan pensiun dini sedang dalam proses.“Padahal, seharusnya saya masih memiliki masa tugas 16 tahun lagi. Tapi demi niatmembangunkampungtanahkelahiran,saya siap pensiun dini,” tegas putra Melayu tersebut. Muhamad Idris mengaku banyak hal yang dicanangkan untuk membangun Deliserdang. Misalnya Bandara Kualanamu di Deliserdang, harus bisa benar-benar diberdayakan untuk kesejahteraan rakyat. Masyarakat kawasan pesisir pantai juga jangan diabaikan. Idris menyoroti betapa birokrasi di Deliserdang yang sangat menyusahkan masyarakat. “Layanan pemerintah kurang baik. Perizinan usaha berbelit-belit. Tak cuma itu, biayanya juga sangat memberatkan para pengusaha. Saya sudah merasakan sendiri. Nah, bagaimana pengusaha mau berinvestasi bila iklim usaha tidak kondusif seperti ini?” tegas Idris. Ini dibenarkan Wakil Ketua DPD PAN

Deliserdang Zulkhairil Harahap. “Biaya perizinan di Deliserdang termahal di dunia. Ini terutama Izin Mendirikan Bangunan (IMB),” tegas Zulkhairil. Karena itulah, Muhamad Idris mengaku hatinya sudah sangat “panas” untuk membangun Deliserdang.“Orang pintar banyak. Tapi orang serius dan bertanggungjawab? Itu yang mungkin langka. Karena itu saya sangat serius dan bertanggungjawab untuk membangun Deliserdang,” tegasnya. Selain ke PAN Deliserdang, Muhamad Idris, kemarin, juga secara langsung mengambil formulir pendaftaran ke DPC PDIP Deliserdang. Selanjutnya, Muhammad Idris juga membangun komunikasi dengan DPC PKS Deliserdang. Pendaftaran ke sejumlah partai dilatarbelakangi ketentuan yang diatur dalam sistem politik. Sebab dalam undang-undang—selain melalui jalur independen—partai politiklah yang menjadi “kendaraan” untuk maju sebagai calon kepala daerah. Pendaftar Lain Ketua PAN Deliserdang Imran Obos mengharapkan Muhamad Idris terus mengikuti mekanisme proses penjaringan, penyaringan hingga penetapan siapa Cabup/Cawabup Deliserdang yang akan diusung PAN. Selain Muhamad Idris, lima tokoh lainnya juga telah mendaftar sebagai Cabup ke DPD PAN Deliserdang. Kelimanya adalah Sudiono Praka (Ketua Gerakan Silaturahmi Warga Jawa Sumut), Sukirmanto (Joko Tingkir Sumut), HM Subandi (kader PAN), HM Amin Daulay (birokrat) dan Sabar Ginting (Ketua MPP PAN Deliserdang). Sedangkan dua lagi mendaftar sebagai Cawabup, yakni Imran Obos (Ketua PAN Deliserdang) dan Adi Munasip, MM (Wakil Ketua DPW PAN Sumut).(m08/m16)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

BJ Ginting Kembali Pimpin KUD SMM-1 Torgamba TORGAMBA (Waspada): KUD Sawit Makmur Mandiri (SMM - 1) Kec. Torgamba, Kab. Labusel menggelar Rapat Anggota Tahunan (RAT) tahun buku 2012, sekaligus pemilihan pengurus priode 2013-2016 KUD di Balai Desa Asam Jawa, Rabu (17/4). Dalam RAT yang berlangsung alot itu, BJ Ginting kembali terpilih menjadi Ketua KUD SMM-1 untuk priode 2013-2016. Pengamatan Waspada, sejak awal dibuka RAT yang dihadiri 191 peserta dari 280 peserta KUD SMM-1 itu diwarnai aksi protes yang disampaikan sejumlah peserta KUD kepada pengurus. Perdebatan semakin memanas ketika dua peserta KUD yakni Rasta Perangin-angin dan Ali Topai melakukan interupsi kepada pimpinan rapat. Acara dihadiri Ketua DPRD Labusel Fery Andikha Dalimunthe, perwakilan Dinas Perindustrian, Perdagangan, Koperasi, dan UKM Pemkab Labusel, Dekopindo Labusel Kasmi Jamrin Ritonga, Kades Asam Jawa Husni Rizal, perwakilan Danramil/Babinsa setempat, serta perwakilan KUD SMM III Dalam pertemuan itu, mayoritas peserta rapat dari 191 peserta yang hadir dapat menerima laporan pertanggungjawaban pengurus, sehingga rapat dapat dilanjutkan ke pemilihan pengurus. Rapat tersebut akhirnya memutuskan BJ Ginting kembali memimpin KUD SMM-1 hingga 2016 mendatang. BJ Ginting terpilih secara aklamasi menjadi satu-satunya peserta yang lolos verifikasi untuk mencalonkan diri setelah mendapat dukungan pencalonan sebanyak 148 suara. Sementara bakal calon lainnya yakni H Gunung memperoleh 6 suara, Warman 2, dan Abdul Ajis 1. Pada kesempatan itu BJ Ginting mengatakan, pihaknya akan terus berkonsentrasi untuk merealisasikan program sertifikasi lahan peserta KUD SMM-1. Menurutnya, berbagai upaya telah dilakukan pihaknya dan kini sudah mulai membuahkan hasil. “Kita akan terus berupaya agar secepatnya program ini dapat segera terealisasi,” katanya. (c18)

WASPADA Jumat 19 April 2013

UN Di Asahan

62 Siswa Tidak Ujian 1 Sekolah Ujian Susulan KISARAN (Waspada): Ujian Nasional (UN) tingkat SMA/Sederajat di Kabupaten Asahan 2013, sedikitnya terdata 62 siswa yang tidak ikut ujian karena tidak hadir, sedangkan satu sekolah ujian susulan karena ketiadaan soal. Informasi dihimpun Waspada, 62 siswa itu terdiri 28 siswa SMK, 18 SMA, dan 16 MA. Dan selama UN berlangsung, siswasiswa itu tidak hadir dan belum diketahui dengan jelas penyebabnya, sedangkan Madrasah Aliyah Daar Uluum Kisaran, Jurusan Agama ujian susulan, karena tiga mata pelajaran (Tafsir, Hadist dan Fiqih). Demikian Kadis Pendidikan Ismail, melalui Kasi Pendidikan Menegah Mahmuddin Syah, yang dikonfirmasiWaspada, Kamis (17/4). Dia menuturkan hingga saat ini dilakukan pengecekan ulang terhadap 62 siswa yang tidak hadir itu, karena mereka terdaftar ikut UN. Dan sampai saat ini UN di Asahan berjalan dengan lancar. “Memang ada masalah, karena sewaktu UN ada 14 sekolah yang kekurangan soal, namun telah dilakukan langkah antisipasi dengan memfotocopy, dan

itu sesuai dengan persetujuan dari pengawas UN dan pihak polisi,” jelas Mahmuddin. Untuk ujian susulan, ada satu sekolah (MA Daar Uluum) jurusan Keagamaan, karena soal mata pelajarannya tidak ada. Dan akan ikut ujian susulan pada pekan depan. “Alhamdulillah, walaupun ada maslah, UN bisa berjalan dengan lancar, dan itu semua berkat ketanggapan petugas dan pihak sekolah,” jelas Mahmuddin. Kecewa Sementara Kepala MA Daar Uluum Kisaran Drs.Bob Yuswardi SPdI, dikonfirmasi menuturkan, secara akademis merasa kecewa karena ketiadaan soal tersebut. Namun pihaknya tetap bersabar, karena tidak ada yang bisa disalahkan. “Kita ambil pelajaran dalam kasus ini, sehingga tidak berulang lagi,” tuturnya. Bob menjelaskan, bahwa

jurusan keagamaan hanya satusatunya di Kisaran, sehingga soalnya tidak bisa dicopy. Sedangkan untuk jumlah murid hanya 10 orang. “Kita telah melakukan pertemuan dengan 10 siswa itu, dan memberikan pengertian kepada mereka, agar semangat belajar tidak kandas. Alhamdulillah mereka bisa menerimanya, jadi semua baik-baik saja,” jelas Bob, sambil menjelaskan sedangkan untuk jurusan lain, semuanya berjalan dengan lancar. Sebelumnya, Koordinator Pengawasan UN Sumut yang juga Rektor Unimed Prof.Dr. Ibnu Hajar Damanik.MSI, didampingi PR II Chairul Azmi Hutasuhut, saat memantau UN di Asahan, belum lama ini, mengapresiasi tindakan cepat yang ditempuh oleh Pamkab Asahan dalam masalah kekurangan soal, dengan melakukan fotocopy, sehingga UN bisa berjalan tanpa ada hambatan. “Ini adalah langkah yang cepat, dan langkah yang sangat baik. Sedangkan uang fotocopy itu akan kita ganti,” jelas Ibnu. (a15)

Kuota Pupuk Bersubsidi Di L. Batu Berkurang RANTAUPRAPAT(Waspada): Kuota pupuk bersubsidi untuk Kab. Labuhanbatu mengalami penurunan secara signifikan. Khusus untuk distribusi pupuk Urea bersubsidi Tahun Anggaran (TA) 2013 terjadi penurunan hingga mencapai 50 persen. “Penurunannya lumayan tinggi. Hingga mencapai 50 persen,” ujar Kabag Perekonomian Setdakab Labuhanbatu Adlin Tanjung (foto), Rabu (17/4). Ditambahkannya, untuk kuota pupuk urea bersubsidi produksi Pupuk Iskandar Muda (PIM), Kab. Labuhanbatu mendapat jatah sebanyak 3.786 ton. Sedangkan untuk pupuk jenis SP36 sebanyak 735 ton, jenis ZA sebanyak 666 ton, untuk NPK sebanyak 1327 ton. Sementara pupuk organic sebanyak 392 ton. Data kebutuhan pupuk di Labuhanbatu, kata dia sesuai

kebutuhan dimasing-masing kecamatan yang didapat dari pihak KIPP setempat. Sementara itu, jumlah distributor untuk melakukan distribusi pupuk ke petani disetiap kecamatan sebanyak lima perusahaan. Masing-masing diantaranya, CV Cinta Makmur untuk distribusi di wilayah Kec. Bilah Barat, Bilah Hilir dan Pangkatan. Selain itu, CV Tani Mulya untuk Kec. Bilah Barat, Rantau Selatan, Pangkatan, Panai Tengah dan Panai Hilir. CV Cipta Sejahtera distributor PT Gresik Non Urea meliputi pendistribusian ke wilayah Bilah Hilir, Bilah Hulu, Panai Hulu dan Rantau Utara. CV Citra Selaras meliputi Kec. Rantau Utara, Rantau Selatan, Bilah Hulu dan Panai Hulu. Sedangkan UD Berkat Usaha Tani pendistribusian hanya di kecamatan Panai Te-

ngah dan Panai Hilir. Guna menghindari penyimpangan pendistribusian pupuk bersubsidi dan nonsubsidi, Pemkab Labuhanbatu telah melanjuti surat Gubsu nomor 521.34/2501 tertanggal 27 Maret 2013 melakukan sosialisasi perubahan fisik warna pupuk jenis ZA. Untuk itu melalui surat bernomor 521.33/1263/ekon/ 1/2013, Pemkab Labuhanbatu membuat edaran ke setiap petani se Labuhanbatu dalam hal sosialisasi perubahan warna pupuk tersebut. “Sudah kita sosialisasikan penginisiasi warna pupuk itu,” jelas Adlin Tanjung. Ditambahkan Adlin, proses sosialisasi itu melibatkan unsur KIPP dan tenaga penyuluh Pertanian Lapangan. “Ya, mereka yang langsung melakukan sosialisai ke para Petani,” jelasnya. (c07)

OK Arya Maju Cabup Jalur Independen LIMAPULUH (Waspada): Bupati H OK Arya Zulkarnain SH MM menyatakan dirinya akan maju sebagai calon bupati (cabup) Batubara untuk kedua kalinya melalui jalur perseorangan (independen). “Saya akan maju kembali dalam Pilkada Batubara September depan, bersaing dengan pasangan calon lain. Kali ini saya tetap maju lewat jalur independen (perseorangan-red),” ujar OK Arya dalam sambutannya di hadapan ratusan warga saat meresmikan Rumah Pintar Lonsum di lapangan Kebun Dolok Limapuluh Batubara, Senin (15/4). Rakyat Batubara, lanjut OK Arya, sudah pintar. Sudah tau siapa yang bakal dipilih, yaitu orang yang jolas (logat Batuba-

ra). Tidak hanya kombo (bicara). Makanya rakyat Batubara mampu membuat rekor sebagai kabupaten pertama di Indonesia yang bupatinya terpilih lewat jalur independen. “Kali ini kita ciptakan lagi rekor baru. Sebagai kabupaten pertama di Indonesia yang dua kali berturut-turut dipimpin bupati dari jalur independen,” ujar OK Arya. OK Arya tidak menyebutkan siapa calon wakil bupati yang akan mendampinginya pada Pilkada Batubara nanti. Dia mengatakan, kini sudah banyak terlihat bakal calon Bupati yang akan maju dalam Pilkada Batubara, di mana sdah banyak yang pasang baliho dalam ukuran besar, bahkan dengan berbagai slogan. “Namun saya tak pernah

memikirkan jabatan ini hanya tinggal beberapa bulan, atau terpilih tidaknya pada Pilkada nanti. Bagi saya terus membangun dan membangun untuk Batubara ke depan yang sejahtera berjaya,” tegas OK Arya. Sekarang, lanjutnya lagi, kita sedang mempersiapkan pembangunan pelabuhan hub internasional. Panjang pelabuhan ini saja mencapai 21 kilometer. Pembangunannya mulai 2014 depan. Kemudian pembangunan Kawasan Ekonomi Khusus (KEK) Kualatanjung. “Di sinilah nanti tempat ribuan anak-anak Batubara bekerja untuk penghidupannya.Tak perlu lagi merantau ke daerah lain. Bahkan orang luar yang akan mencari pekerjaan di Batubara,” tegasnya. (c04)

Zona Tangkap Disetujui Jadi Perda Di Batubara LIMAPULUH (Waspada): Pemkab Batubara memberikan apresiasi setinggi-tingginya terhadap hasil pembahasan dilakukan Pansus atas Ranperda tangkap, dan berharap pasalpasal ditetapkan tidak terdapat hal-hal kontraproduktif menimbulkan perbedaan penafsiran. “Mudah-mudahan setelah disahkan menjadi Perda perekonomian nelayan semakin menggeliat dan memilikki kepastian hukum yang kuat,” tukas Bupati H OK Arya Zulkarnain, SH, MM dalam pendapat akhirnya pada sidang paripurna DPRD Kab. Batubara tentang Ranperda tangkap, Kamis (18/4). Ranperda terdiri 8 bab dan 19 pasal tersebut, walau dalam waktu singkat telah selesai dibahas atas kerjasama yang baik antara eksekutif dan legislatif sehingga nelayan dapat aman mencari nafkah di laut demi mewujudkan sejahtera dan berjaya. Bupati merasa yakin permasalahan dihadapi dapat segera teratasi, namun ada beberapa catatan sebagai masukan bagi Pansus sebelum disahkan menjadi Perda.

Selanjutnya Ketua DPRD Kab Batubara Selamat Arifin, SE, MSi meminta Wakil Ketua Drs Suwarsono membacakan persetujuan bersama DPRD dengan Bupati Batubara tentang Ranperda jalur penangkapan ikan ditetapkan menjadi Perda, sekaligus memerintahkan mengundangkan ke dalam lembaran daerah dan menandatanganinya bersama.

Ketua DPRD Batubara Selamat Arifin, SE, MSi mengatakan, sebelum Perda diundangkan kedalam lembaran daerah dikirim ke Gubsu dalam keperluan evaluasi dan selanjutnya disosialisasikan oleh eksekutif guna diterapkan. Sedangkan pihaknya hanya sebagai pengawas, walaupun Perda merupakan inisiatif dewan. (a13)

Waspada/Budi Surya Hasibuan

BUPATI Bupati Labuhanbatu dr H Tigor Panusunan Siregar SpPD didampingi Wakil Bupati Suhari Pane SIP dan para kepala SKPD memberikan arahan kepada para pengelola Pasar Gelugur Rantauprapat.

Bupati L.Batu Sidak Pasar Gelugur RANTAUPRAPAT(Waspada): Dalam menyikapi berbagai permasalahan di Pasar Gelugur Rantauprapat, Bupati Labuhanbatu dr H Tigor Panusunan Siregar SpPD mengadakan inspeksi mendadak (Sidak) ke pasar semi modern berlatai dua itu, Rabu (17/4). Dalam sidak ini, bupati didampingi didampingiWakil Bupati Suhari Pane SIP, Kaban Kesbang Linmas H Hasnul Basri S Sos, Kadis PPKAD Ahmad Muflih SH, Kadis Perhubungan Komunikasi dan Informatika Saiful SP, Kadis Pasar dan Kebersihan Drs Edy Gani Ginting dan Kakan Satpol PP A Haris Nasuiton SH Tigor dan rombongan langsung memasuki lorong demi lorong mengelilingi Pasar Gelugur, sesekali berdialog dengan pedagang. Tigor dan Suhari tidak henti-hentinya menanyakan kepada Kepala Dinas Pasar Edi Gani Ginting yang didampingi para Kabid tentang kios yang belum ditempati para pedagang. Tigor meminta Kadis Pasar agar tegas dalam menentukan sikap terhadap pedagang yang tidak mau menempati kios di lantai dua tersebut. “Kalau memang pedagang tidak mau menempati kiosnya akan kita tarik kembali hakhaknya dan akan kita salurkan kepada pedagang yang lain,” tegas Tigor, seraya meminta Kadis Pasar dan Kebersihan agar melakukan sosialisasi dengan memberikan surat peringatan kepada pedagang yang bersangkutan secara berulangulang.

Setelah puas meninjau lantai dua, Tigor tampak memeriksa sanitasi/got yang dipenuhi sampah. Tampak juga pedagang yang menggelar dagangannya di tangga, yang membuat Tigor sedikit gusar kepada pengelola Pasar Gelugur tersebut. Tigor juga menemukan kios kosong melompong yang dipenuhi dengan sampah. Melihat ini Tigor langsung meminta pengelola Pasar Gelugur agar membersihkan segera tempat itu tanpa alasan apapu. “Saya minta tempat itu segera dibersihkan, karena berbau tidak sedap. Kan terganggu kios di sebelahnya, mereka juga membayar retribusi”, tegasnya. Sementara Hutagalung, 50, salah seorang pedagang mengatakan, dia berharap kepada Bupati melalui Dinas Pasar dan Kebersihan merespon keluhan para pedagang sayur dan ikan untuk mengefektifkan Pasar Gelugur, di mana para pedagang sayur dan ikan yang berjualan di ruko supaya diarahkan masuk ke dalam pasar atau ditepati janji untuk memagar keliling pasar Gelugur. Uun, 43, pedagang sayur mengungkapkan, kalau pagi hari dia berdagang di bawah, dan baru pada siang baru masuk ke dalam, karena di bawah pedagang sayur semua. “Kalau kami di atas terus, pembeli tidak ada yang dating. Pedagang di ruko juga merusak suasana pasar Gelugur ini. Kami yang lemah ini terpaksa dengan segala upaya naik turun mengangkat barang dagangan” sebutnya. (c07/a18)

Tabligh Akbar Di Desa Sipaku Area SIMPANGEMPAT (Waspada): Kegiatan Tabligh Akbar gabungan perwiritan Desa Sipaku Are, Kec.S impangempat, bekerja sama dengan Majelis Taklim Adz Dziniyah, merupakan sarana meningkatkan hubungan antara masyarakat dan semangat membangun demi terwujudnya visi pembangunan Asahan yang religius, sehat, cerdas dan mandiri. “Tablig Akbar ini adalah kegiatan meningkatkan ketaqwaan kepada Allah, dan sekaligus membina hubungan dengan masyarakat,” jelas Ustaz Dahmul Daulay, dalam tausiyahnya, Rabu (17/4). Dahmul, mengimbau kepada masyarakat untuk selalu mengintrospeksi diri, sejauh mana perintah Allah SWT kita lakukan. Dengan

demikian, keimanan dan ketaqwaan bisa terus ditingkatkan. Sementara Bupati Asahan Taufan Gama Simatupang, dalam sambutannya menuturkan bahwa membangun Asahan tidak semudah membalikkan telapak tangan, namun dilakukan dengan secara perlahan dan tepat sasaran. “Kita akan terus melaksanakan pembangunan secara merata, sehingga masyarakat bisa terus dalam meningkatkan kehidupan masyarakat yang lebih baik,” kata Taufan. Turut hadir dalam acara Ketua Umum Majelis Taklim Adz Dziniyah Kab. Asahan Ny.Winda Fitrika Taufan Gama Simatupang, dan memberikan sekitar 100 kaca mata baca kepada warga yang lanjut usia. (a15)


KETUA Umum Majelis Taklim Adz Dziniyah Kabupaten Asahan Ny.Winda Fitrika Taufan Gama Simatupang, memberikan kaca mata baca Alquran kepada masyarakat lanjut usia, dan didampingi Bupati Asahan Taufan Gama Simatupang yang memeluk salah satu warga penerima kaca mata tersebut.

Wakil Bupati L.Batu Resmikan KCP PT Jamsostek RANTAUPRAPAT (Waspada): Wakil Bupati Labuhanbatu Suhari Pane SIP meresmikan pemakaian Kantor PT Jamsostek (Persero) Kantor Cabang Pembantu (KCP) Rantauprapat, di Jalan WR Supratman Nomor 27, Kamis (18/4). Wabup yang didampingi Kepala Dinas Sosial Tenaga Kerja dan Transmigrasi L.Batu Mahadi, SH dalam sambutannya mengatakan, peran serta tenaga kerja dalam pembangunan nasional semakin meningkat dengan disertai berbagai tantangan dan resiko yang dihadapi. Oleh karena itu tenaga kerja perlu diberikan perlindungan, pemeliharaan dan peningkatan kesejahteraannya sehingga pada gilirannya akan dapat meningkatkan produktivitas sehingga

dapat memberikan kontribusi dalam pembangunan nasional. Dikatakan, PT Jamsostek mempunyai tugas dan tanggungjawab memberikan perlindungan bagi tenaga kerja dari resiko yang dialami tenaga kerja, yaitu kecelakaan, cacat, sakit, hari tua dan meninggal dunia melalui melalui program jaminan kecelakaan kerja ( JKK), jaminan kematian (JK), jaminan hari tua (JHT) dan Jaminan pemeliharaan kesehatan. Hadir pada acara itu, Kepala Kanwil PT Jamsostek Sumatera Utara IGM Suartika, Kepala Cabang PT Jamsostek Kisaran, Kadisnakertrans Labusel dan para pimpinan perusahaan di L.Batu. (a18)

Puluhan Baliho Dihantam Angin Satu Ruko Terbakar

Waspada/Iwan Has

UNSUR pimpinan dewan ketika menandatangani persetujuan bersama dengan Bupati H OK Arya Zulkarnain, SH, MM tentang Ranperda zona tangkap menjadi Perda dalam sidang paripurna.

BATUBARA (Waspada): Puluhan baliho bakal calon Bupati Batubara yang terpasang dipinggir jalan Sei Bejangkar -Tanjungtiram - Kedai Sianam- Perupuk ‘terbang’ bercopotan dihantam angin ribut,Rabu (17/4) malam. Menurut warga, angin ribut disertai petir, terjadi sejak pukul 20:00. Aliran listrik padam juga. Belum diketahui apakah ada bangunan rumah penduduk yang rusak. Yang pasti, aliran listrik PLN padam selama tujuh jam dan baru menyala sekira pukul 03:00 dinihari. Sebelumnya, Warga Tanjungtiram sempat panik ketika sebuah rumah toko (ruko) milik almarhum H. Mali di simpang Jl. Merdeka/Jl. Rakyat, terbakar sekira pukul 11.30, Selasa (16/4).

Tidak ada korban jiwa, dan penyebab kebakaran masih dalam penyidikan polisi. Dugaan sementara akibat hubungan arus pendek listrik Menurut warga, kejadian kebakaran ruko yang menjual rempah dan ramuan obat tradisional itu diketahui setelah melihat asap dan kobaran api di tingkat dua. Kebetulan penghuni rumah tidur lelap terpaksa warga mendobrak pintu secara paksa. Warga memberikan bantuan dengan menyiramkanairparitdankemudiandatangmobil pemadam kebakaran Pemkab Batubara. Setengah jam kemudian. kobaran api berhasil dipadamkan namun dinding/asbes, barang-barang berharga seperti televisi dan kulkas turut terbakar. (a12)

Sumatera Utara

WASPADA Jumat 19 April 2013


6.142 Peserta UN SMP/MTs Di P. Siantar 95 Tidak Hadir UN SMA/SMK PEMATANGSIANTAR (Waspada): 6.142 Peserta dari 50 sekolah akan mengikuti Ujian Nasional (UN) SMP/MTs tahun ajaran 2012/2013 di Kota Pematangsiantar 22-25 April 2013.

Sidang KDRT Anggota DPRD Jadi Perhatian Mahasiswa PEMATANGSIANTAR (Waspada): Pelaksanaan sidang lanjutan kasus kekerasan dalam rumah tangga (KDRT) melibat terdakwa FM, ketua komisi III DPRD Pematangsiantar, digelar di ruang sidang Pengadilan Negeri (PN) Pematangsiantar, Selasa (16/4) sore, menjadi perhatian kalangan mahasiswa fakultas hukum di kota itu. Persidangan semakin menyedot perhatian, setelah media massa memberitakan majelis hakim yang menangani kasus itu diketuai Janner Purba, SH yang statusnya masih menunggu putusan hukum dari Mahkamah Agung (MA) setelah dia diperiksa tim pengawas MA sesuai dengan pengaduan masyarakat. Selain itu, hakim tersebut menjadi sorotan karena dinilai dengan mudah memberi izin bepergian ke Jakarta kepada terdakwa FM selama beberapa hari, padahal ketika itu terdakwa berstatus tahanan kota dan jaminan apa yang diberikan FM masih menjadi. Minat mahasiswa yang mendalami masalah hukum tersebut juga ingin melihat lanjutan persidangan dan ingin melihat bagaimana keputusanpengadilanataskasustersebut,apakahbenar-benarmampu memuaskan pencari keadilan yang juga istri FM, bernama Christian Napitupulu, yang mengadukan suaminya dan dijerat dengan pasal KDRT dengan ancamann empat tahun penjara. (crap)

Bandar SS Ditangkap KABANJAHE(Waspada): Personil Polres Tanah Karo tidak saja menangkap tiga pemakai sabu-sabu (SS), juga menciduk seorang tersangka diduga bandar SS, kemarin. Penangkapan ini dilakukan pasca penggerebakan di Perumahan Sarinembah Kec Kabanjahe, Selasa(16/4). Kapolres Tanah Karo AKBP Marcelino Sampouw SH Sik MT melalui Plt KasatNarkoba AKP Saryfuddin SH kepada Waspada membenarkan, pihaknya telah melakukan pemeriksaan terhadap tiga tersangka diduga kuat memakai SS. Selanjutnya, di lakosi kedua dari hasil pengembangan, pihaknya mengamankan IB,32, warga Jalan Udara Berastagi yang diduga sebagai Bandar. Polisi mengamankan dua paket SS 0,91gram dan 1 unit HP. IB ditangkap hasil pengembangan dari ketiga tersangka masingmasing SG alias Anto,42, TP alias Pak Kidu,43 warga Desa Samura Kabanjahe, SU,24 warga Namosalak Desa Lama Kec. Pancurbatu di Perumahan Sarinembah. Dari lokasi pertama, petugas mendapatkan 1paket SS seberat 0,5 gram,1 pipet kaca yang di dalamnya mengandung sisa SS, 1 bong, 1unit HP. Keempat tersangka sedang menjalani pemeriksaan di ruang Sat Narkoba Polres Tanah Karo. (c10)

Sosialisasi Sensus Pertanian Di Sibolga SIBOLGA ( Waspada): Untuk lebih memasyarakatkan pelaksanaan Sensus Pertanian digelar mulai 1 Mei, Badan Pusat Statistik (BPS) Sibolga menggelar sosialisasi di aula Bank Indonesia Sibolga, baru-baru ini. Acara tersebut selain diikuti petugas sensus, juga dihadiri Wali Kota Sibolga Drs HM Syarfi Hutauruk beserta sejumlah SKPD Pemko Sibolga. “Meski Kota Sibolga termasuk yang paling kecil wilayahnya di Sumatera Utara, namun kita berharap Sensus Pertanian yang akan kita gelar dalam waktu dekat, bisa berhasil sesuai harapan, terutama dalam pengumpulan data dari door to door dan juga melalu snowball sampling, yang akan digunakan sebagai data dalam perencanaan di sektor pertanian,” kata Kepala BPS kota Sibolga Rika Vintina SE MSi di sela rehat kepada Waspada. Wali Kota Sibolga mengharapkan dukungan dari seluruh warga Kota Sibolga yang akan disensus, termasuk dukungan dari para camat dan lurah serta aparatnya, sehingga Sensus Pertanian ini bisa mencapai sasaran yang efektif yang pada akhirnya dapat memperoleh data yang akurat dan digunakan sebagai bahan untuk perencanaan program pertanian di masa mendatang. (cpol)

425 Prajurit Infantri 125/Simbisa Uji Kompetensi Siap Tempur KABANJAHE (Waspada): 425 perajurit TNI-AD Bataliyon Infantri 125/ Simbisa Kab. Karo mengikuti uji kompetensi siap tempur selama empat hari di Sibolangit, Kab. Deliserdang. Kegiatan ini dilakukan untuk mengasah kemampuan prajurit secara teknis di lapangan. “Di Indonesia ini masih ada sekelompok orang yang ingin memecah-belah kesatuan NKRI, atau bertujuan memisahkan diri dari RI. Kita selaku TNI-AD harus siap melawan gejolak yang memungkinkan kita untuk berperang demi nama Indonesia,” ujar Danyon 125/Simbisa, Letkol. Inf. Parluhutan Marpaung saat mengadakan persiapan perajuritnya di lapangan markas komando (Mako) 125 / Simbisa, Kabanjahe, baru-baru ini. Dikatakan, tujuan latihan uji siap tempur yang aktif diadakan oleh 125, gunanya melatih kemampuan diri perajurit secara profesional, yang bila ada gejolak terjadi di lapangan serta tidak lagi kaku menghadapin lawan. “Ada tiga yang wajib dijunjung tinggi setiap perajurit TNI – AD. Pertama, siap tempur, bertindak profesional, dan menghadang lawan yang sedang bergejolak,” tegas Letkol. Inf. Parluhutan Marpaung usai memberi penghargaan kenaikan pangkat kepada 48 anggotanya. (c19)

Meriahkan HUT Ke-67 Persit KCK PEMATANGSIANTAR (Waspada): Dalam memeriahkan dan menyemarakkan peringatan HUT ke-67 Persit KCK 2013, Persit KCK Koorcab Rem 022 PD I/BB menyelenggarakan berbagai perlombaan seperti lomba memasak nasi goreng diikuti ibu Persit KCK, lomba menggambar dan mewarnai tingkat SD serta lomba mewarnai tingkat TK. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menyebutkan, perlombaan itu dilaksanakan di arena rekreasi dan olah aga Pantai Timur, dan disaksikan Ketua Persit KCK Koorcab Rem 022 PD I/ BB Ny. Ayu RestuWidiyantoro didampingi pengurus Persit lainnya. Para peserta sangat antusias mengikuti perlombaan itu. Untuk lomba memasak nasi goreng, Persit KCK Denkesyah 01.04.01 keluar sebagai juara I, Persit KCK Cabang XXXIV Dim 0207/Sml juara II dan Persit Tim Intelrem 022/PT juara III. Pemenang lomba menggambar dan mewarnai tingkat SD sebagai juara I atas nama Silvio, anak dari W. Siregar, anggota Ajenrem 022/PT, juara II Septi, anak dari Ana, anggota Kodim 0207/Sml dan juara III Nauval, anak dari Dimas, anggota Tim Intelrem 022/ PT. Untuk mewarnai tingkat TK, juara I diraih S. Novita (Sultan Agung), juara II Sania Putri (Sultan Agung) dan juara III Saskia D Fahira (SD komplek Veteran). (a30)

Sementara, 95 orang tidak hadir saat pelaksanaan hari terakhir UN SMA/MA dan SMK dan kemungkinan akan mengikuti UN susulan bersama 169 siswa yang tidak ikut UN utama akibat pendistribusian soal ke Pematangsiantar tidak mencukupi. Kadis Pendidikan Drs. Setia Siagian melalui Kabid Dikmenti Meisahri Uga Lubis, S.Pd, MM selaku Wakil Ketua Panitia UN dan Kasi Kurikulum Dikdas Roslina Sinaga selaku anggota Panitia UN menyebutkan itu di Kantor Dinas Pendidikan, Kamis (18/4). Menurut Roslina, peserta UN SMP/MTs itu masing-masing 5.604 siswa SMP terdiri 13

negeri dan 28 swasta serta 538 siswa MTs terdiri satu negeri dan delapan swasta. Sementara, matapelajaran diujikan Bahasa Indonesia, Bahasa Inggris, Matematika dan Ilmu Pengetahuan Alam (IPA) serta waktu pelaksanaannya pada 22-25 April pada pukul 07:30-09:30, sedang UN susulan pada 29 April-2 Mei. Mengenai target kelulusan, Roslina mengharapkan sama dengan hasil yang dicapai pada tahun ajaran 2011/2012 yakni 99,06 persen. “Kalau boleh, yang lulus diharapkan 100 persen.” Sementara, Meisahri Uga Lubis menyebutkan, dari 95 siswa yang tidak hadir itu, 63 siswa dari SMK negeri dan swasta

serta 32 siswa dari SMA negeri dan swasta, sedang dari MA semuanya hadir. Menjawab pertanyaan, Lubis mengungkapkan baru dua sekolah yang melaporkan siswanya yang akan mengikuti UN susulan yakniSMKHotmagunasatusiswa dan SMAN 1 dua siswa. Siswa SMK Hotmaguna itu hanya hari pertama tidak mengikuti UN akibat kecelakaan, sedang UN berikutnya diikuti. Tentang naskah soal UN utama bagi siswa yang tidak ikut UN akibat naskah soal tidak ada, Lubis mengakui sampai saat ini belum ada informasi dan masih menunggu pada Sabtu (20/4) apakah naskah soal itu akan datang atau tidak.” (a30) Waspada/Parlin Hutasoit

SMAN 1 Berastagi Rayakan Tradisi Usai UN BERASTAGI( Waspada): Sejumlah siswa/i tingkat SMA, SMK sederajat terlihat begitu gembira setelah mengakhiri ujian nasional (UN) yang di selenggarakan sejumlah sekolah di Tanah Karo, Kamis (18/4). Jika lulus UN, mereka mengancangancang akan melanjutkan pendidikan ke perguruan tinggi. Dari pantauan Waspada di beberapa sekolah seperti di SMA Negeri 1 Berastagi, terlihat sejumlah siswa/i bergemberia ketika keluar dari lokal mereka masing-masing baik kelas IPA dan IPS, selanjutnya menuju ke

halaman sekolah mereka sambil mendengarkan beberapa arahan yang disampikan kepala sekolahdiSMANegeri1Berastagi. Di hadapan para siswa/i yang telah mengahiri UN dimulai sejak Senin, Kepala sekolah SMU Negeri 1 Berastagi Alberto Colia berharap, lulusan SMA Negeri 1 Berastagi dapat memberikan contoh yang baik di hadapan para siswa lain seperti bagi adik kelas mereka, terutama ketika melanjutkan ke jenjang perguruan tinggi. “Selain itu, diingatkan agar ketika merayakan tradisi coret-

KASAT Narkoba AIPTU SB Simamora menunjukkan barang bukti narkoba jenis sabu bersama dua tersangka dan telah diamankan di Mapolres Taput.

mencoret, para siswa/i dapat lebih tertib dan pulang ke rumah tepat waktu,” ujarnya. Alberto Colia berharap, anak didiknya tidak ada yang tidak lulus ujian dan mendapatkan nilai memuaskan.Para siswa/ i di sekolah ini, kata dia, selama berlangsungya kegiatan belajarmengajar, pihaknya juga melakukan kegiatan lain di luar jam sekolah seperti membuat palajaran tambahan dan menyarankan kepada siswa/i untuk mengikuti palajaran tambahan di luar sekolah seperti les dan bimbingangan lainnya. (c10)

Banyak Aset Sejarah Pakpak Terlantar PAKPAK BHARAT (Waspada): Gerakan pemeliharaan benda budaya dan pengembangan nilai budaya lokal di Kab. Pakpak Bharat dirasakan belum mendapat perhatian serius. Terlihat dari sejumlah benda budaya dan aset sejarah budaya Pakpak masih benyak yang terlantar bahkan tidak jarang rawan terhadap pencurian. Seperti yang terlihat pada benda budaya milik Marga Sinamo berupa situs (mejan)

yang terletak dipinggiran jalan menuju Pronggil Julu, Kec. Tinada, Kab. Pakpak Bharat butuh perhatian, sehingga tidak terkesan terlantar dan seolah tidak bernilai. “Padahal belakangan kerap terjadi pencurian benda-benda budaya di wilayah kita ini, bahkan beberapa tahun lalu warga sempat melakukan pembakaran terhadap satu unit kendaraan yang berusaha mencuri mejan Marga Solin,” ujar S.

Berutu warga Tinada, kemarin Sebelum hal sama terjadi, diharapkan kepada warga Marga Sinamo dan Pemerintah Pakpak Bharat melakukan upaya pengamanan berupa perbaikan tempat dan pengawasan. Selain itu, melihat kondisi mejan, jika tidak segera dilakukan pemasangan gubuk/ atap benda budaya tersebut dikhawatirkan akan mengalami kerusakan oleh terpaan hujan dan terik matahari. (csb)

Waspada/Saut Boangmanalu

MEJAN (situs) milik marga Sinamo yang terletak di pinggir jalan menuju Pronggil Julu, Kec. Tinada, Kab. Pakpak Bharat teronggok di pinggir jalan.

Pertamina Bangun Pustu Di Karo BERASTAGI (Waspada): Melalui program Corporate social responsibility (CSR) Sehati, PT Pertamina meresmikan pembangunan Puskesmas pembantu (Pustu) di Desa Semangat Gunung, Kec. Merdeka, Kab. Karo dihadiri unsur Muspika serta masyarakat setempat, Rabu(16/4). Kordinator Operasi Pertamina Area Sibayak, Idham Pulungan mengatakan, gedung Pustu di Desa Semangat Gunung merupakan satu dari beberapa kegiatan di bidang kesehatan dan pendidikan yang dijalankan pihaknya. Sebelumnya, aplikasi CSR mereka telah menyentuh penambahan gizi balita di Desa Semangat Gunung Kec.n Merdeka, Doulu dan Sempa Jaya Kec. Berastagi, Kab. Karo. Selain itu, juga dilaksanakan pemberian alat kesehatan, perlengkapan olahraga kepada lansia, beasiswa tingkat SD dan SMP di delapan sekolah bagi siswa kurang mampu. Kegiatan

ini diharapkan berlanjut, bahkan ke depan pihaknya sedang merancang aktifitas berbentuk kemandirian yang tentu bermanfaat bila dikelola dengan serius dan terencana. “Kalau ini kan bagian dari bantuan putus, kita berfikir untuk melangsungkan program kemandirian. Nantinya, bersama-sama masyarakat, kita akan coba buat rancangan yang matang, hingga berdampak pada peningkatan kualitas ekonomi rakyat,” terang Pulungan usai penguntingan pita Gedung Pustu Desa Semangat Gunung. Kadis Kesehatan Karo diwakili Nikodemous Ginting, SKM menyampaikan rasa bangga terhadap program dilaksanakan dengan selalu mengedepankan kesehatan, di samping itu kepada Kepala Desa diharapkan mampu membantu mengontrol kinerja bidan desa di wilayah “kekuasannya”. Langkah ini menjadi penting dilakukan guna penurunan angka kekurangan gizi yang

walau jumlahnya kecil masih mengganggu dunia kesehatan di Kab. Karo. Sejauh ini terdapat 7,8 % masyarakat, termasuk balita di daerah ini yang belum mendapat gizi sehat. Dikakatakan, hampir bisa dipastikan, bangunan gedung Pustu ini adalah yang paling layakdiKaro.“Kitasampaikanapresiasi mendalam kepada Pertamina, mudah-mudahan ini dapat dikembangkan ke beberapa desa lainnya,” harapnya. Pada acara yang dihadiri Camat Merdeka Kasman Sembiring, Kapolsek Simpang Empat AKP Irianto, Kades Semangat Gunung J Ginting ,Kepala Puskesmas Merdeka dan unsur masyarakat ini turut dilaksanakan penandatanganan berita acara serah terima gedung dari pihak Pertamina Area Sibayak ke Dinas Kesehatan Kab Karo. Pustu itu dilengkapi ruang rawat inap, lobi bersofa , ruang bidan, rumah bidan dan kamar mandi berikut peralatan yang cukup memadai. (c10)

TARUTUNG (Waspada): Kabupaten Tapanuli Utara (Taput) nampaknya sudah rawan peredaran narkoba. Polisi berhasil menangkap dua pemakai narkoba jenis sabu di Kec. Siborongborong, Rabu (17/4). Kedua tersangka yakni S alias Anto (40) penduduk Jalan S. Parman Gg Langgar N) 41 – A Kel. Petisah Hulu, Kec. Medan Baru, Medan, Y boru S alias Yuni (30) penduduk Desa Pohan Tonga, Kec. Siborongborong, Taput. “Dari dua tersangka yang juga merupakan sepasang kekasih, berhasil diamankan barang bukti satu paket sabu berbungkus plastik. Tempatnya berhasil kita grebek atas informasi dari masyarakat. Keduanya ditahan di sel Mapolres Taput,” ujar Kapolres Taput melalui Kasat Narkoba IPTU SB Simamora didampingi Kasubbag Humas IPTU W Baringbing, Kamis (18/4)

kepada Wartawan di Mapolres Taput. Dikatakan, terungkapnya pemakai shabu itu setelah mengrebek rumah di Jalan Makmur Siborongborong milik boru H dan ada didapatkan narkoba jenis sabu. Di sana ada lima orang penghuni dan dibawa ke Mapolres untuk di interogasi. “Dari pengakuan lima orang tersebut, barang haram tersebut bukan milik mereka. Setelah dilakukan pemeriksaan, ternyata pemiliknya berada di tempat lain. Saat itu juga kedua tersangka berhasil ditangkap dari Jetun Silangit, Kec. Siborongborong,” terang Kasat Narkoba dan Kasubbag Humas. Kedua tersangka mengaku sangat menyesal. “Baru kali ini saya tertangkap. Kami berdua berkenalan baru empat bulan,” ujar tersangka Y boru S kepada wartawan. (a21)

Golkar Pendaftar Caleg Pertama Ke KPUD Karo KABANJAHE (Waspada): DPD Partai Golkar Kab. Karo resmi mendaftar sekaligus menyerahkan berkas Daftar Caleg Sementara (DCS) ke Komisi Pemilihan Umum (KPU) Kab. Karo sebagai peserta Pemilu 2014, Rabu (17/4). Partai berlambang pohon beringin ini merupakan partai peserta Pemilu yang mendaftarkan DCS-nya ke KPU Kabu. Karo, dengan jumlah 35 orang didominasi calon legislative (Caleg) berpendidikan sarjana. Penyerahan berkas DCS Caleg Partai Golkar dipimpin Ketua DPD Partai Golkar Kab. Karo Ferianta Purba SE didampingi Sekeretaris Saulian Munte, Bendahara Hery Ricardo Ginting dan sejumlah pengurus lainnya, diterima anggota KPUD Karo Sidarta Peranginangin didampingi Sekeretaris dan staf. Menurut Ferianta Purba SE, pihaknya tidak

menyangka, kalau baru partai Golkar dengan nomor peserta Pemilu 5 yang pertama mendaftarkan DCS-nya ke KPU. “Ini merupaka wujud keberhasilan partai Golkar dalam pengkaderan dan menunjukkan benar-benar siap untuk mengikuti pesta demokrasi 2014 mendatang”,ujarnya kepada wartawan. Dia berpesan, kiranya 35 calon legislatif Partai Golkar yang telah terdaftar di DCS, agar segera mensosialisasikan diri dengan sebaik mungkin, untuk dapat memenangkan hati rakyat, karena Suara Golkar adalah Suara Rakyat. Ferianta mengatakan,dari 35 orang DCS Partai Golkar ,38 % (13 orang) di antaranya mewakili perempuan, laki-laki 62% (22 orang) dan 80 % (28 orang) tingkat pendidikannya sarjana (S1) bahkan di antaranya ada yang S2, sedangkan tamat SMA sederajat 20% (7 orang). (c09)

Bupati Dan Kajari Dukung IJTI Simalungun-Siantar SIMALUNGUN (Waspada): Bupati Simalungun JR Saragih dan Kepala Kejaksaan Negeri (Kajari) Simalungun-Siantar, Polin O Sitanggang mendukung dibentuknya Ikatan Jurnalis Televisi Indonesia (IJTI) Komisariat Daerah (Korda) Simalungun-Pematangsiantar. Dukungan itu disampaikan Bupati dan Kajari Simalungun, ketika menerima panitia Musyawarah Daerah Waspada/Ist (Musda) Korda IJTI, SimaluBUPATI Simalungun JR Saragih foto bersama dengan panitia ngun-Pematangsiantar. Musda IJTI Simalungun-Pematangsiantar,usai pertemuan. Bupati Simalungun JR Saragih mengatakan, pihaknya berharap IJTI tandas Polin. Simalungun-Pematangsiantar mampu menjadi Ketua Panitia Musda IJTI Simalungun-Pemamitra pemerintah daerah dalam mensosiali- tangsiantar Yan Asmara (SCTV) didampingi sasikan program pembangunan daerah kepada Sekretaris Dharma Setiawan (MNCTV) dan Benmasyarakat. dahara Syahru I Silitonga (TVRI) serta Rahmad Dalam audensi itu JR juga menyerahkan Umri(Trans7)menyampaikanapresiasiatasdukubantuan untuk pelaksanaan kegiatan Musda ngan Bupati Simalungun dan Kajari Simalungun. IJTI Simalungun-Pematangsiantar sebesar Rp “Kami memberikan apresiasi atas dukungan 40 juta kepada panitia pelaksana. Bupati Simalungun JR Saragih dan Kajari Kajari Simalungun, Polin O Sitanggang juga Simalungun, Polin O Sitanggang dan IJTI mendukung terbentuknya IJTI Simalungun- Simalungun-Pematangsiantar siap menjadi Pematangsiantar yang diharapkannya ikut mitra mendukung pembangunan daerah dan mendukung program peningkatan kesadaran peningkatan kesadaran hukum di kedua daerah hukum kepada masyarakat. ini (Simalungun-Pematangsiantar),” paparYan. “IJTI Simalungun-Pematangsiantar, saya Dia menambahkan pelaksanaan Musda harapkan bisa menjadi salahsatu lembaga atau IJTI Korda Simalungun-Pematangsiantar akan organisasi yang mendukung program pening- dilaksanakan,Jumat (26/4) di Simalungun City katan kesadaran hukum kepada masyarakat,” Hotel,Pematang Raya. (a29)

Banyak Anggota DPRD Tapteng Harus Mundur

Truk Melebihi Tonase Rusak Jalan Sibolga SIBOLGA (Waspada): Truk ekspedisi Sibolga-Nias yang rusak di tengah badan jalan di Kota Sibolga, sering terlihat. Penyebab rusaknya badan jalan tersebut diduga kuat karena truk melebih tonase. Seperti terjadi di salahsatu truk ekspedisi terlihat muatannya melebihi bodi truk, mengalami rusak berat di badan Jalan Suprapto, yang merupakan akses menuju Pelabuhan Sambas Sibolga. Meski begitu, keberadaan truk melebih tonase itu, terkesan diabaikan petugas terkait. Akibatnya, selain membuat badan jalan cepat rusak, juga dapat mengancam pengguna badan jalan lainnya. “Sebenarnya, keberadaan truk Sibolga-Nias yang sering melintas di Jalan Suprapto ini, telah lama meresahkan. Selain mengganggu arus lalulintas, juga diduga kuat dapat membuat badan jalan cepat rusak,” kata A Hutagalung, warga Kota Sibolga didampingi warga lainnya. (cpol)

Taput Rawan Narkoba

Waspada/Micky Maliki

KORDINATOR Operasi Pertamina Area Sibayak Idham Pulungan diabadikan bersama para undangan yang menyaksikan serah terima pembangunan puskesmas pembantu di Desa Semangat Gunung, Kec. Merdeka.

TAPTENG (Waspada): Karena partai politik yang akan mengikuti Pemilu Legislatif 2014 hanya 12 parpol, maka diperkirakan akan banyak anggota DPRD Tapteng yang akan mengundurkan diri. Tak hanya anggota DPRD yang tak akan memperoleh “perahu” yang akan mengundurkan diri, namun juga beberapa anggota DPRD dari partai pengantarnya sebagai anggota DPRD pada periode ini, dan telah hengkang dan menjadi pengurus partai yang akan digunakannnya sebagai “perahunya”. KPU Tapteng mengaku akan tegas memverifikasinya. “Sesuai Keputusan KPU Nomor 7 tahun 2013, di antaranya mengisyaratkan anggota DPR, DPRD Provinsi, dan DPRD Kabupaten/ Kota yang partainya tidak lolos verifikasi peserta pemilu tetapi hendak maju kembali sebagai calon legislatif dari partai politik lain, harus

mengundurkan diri sebagai wakil rakyat dan dibuktikan dengan surat keputusan pemberhentian dari partai asal. Maka kita dengan tegas menyatakan akan memverifikasi para calon legislatif yang akan mendaftarkan diri,” egas salahseorang anggota KPU Tapteng Halomoan Lumbantobing kepada wartawan, Kamis (11/4). Dijelaskannya, ada beberapa orang anggota DPRD yang saat ini telah sah sebagai pengurus salahsatu partai dan juga beberapa orang yang hengkang dari partainya.”Untuk para caleg ini, kita memang harus tegas meminta surat pengunduran dirinya sebagai anggota DPRD dan juga Surat Keputusan yang menyatakan dia sebagai pengurus teras partai, kalau tak ada surat pengunduran dirinya, kita akan tegas mendiskualifikasinya,” jelas Halomoan. (cpol)

B4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive


: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000







HYUNDAI TERAJET M/T THN 2004. HITAM, BK MDN. Rp 65JT. HUB: 77863981 Dijual Hyundai Avega 2007 warna Abu-Abu,sudah ada jok kulit,Alas dasar,TV,CD player JVC.Harga 90jt/ Nego.Bisa kredit Dp 26jt. Angsuran 1,9jtan. 081370999998/77388133





CARRY PICK UP : Dp 13jtan Ertiga : Dp 30 jtan Proses cepat, Data Dijemput, Pasti Ok! Hub: 081397533889 ASEN SUZUKI KARIMUN TH.2000. WARNA SILVER. MET. MDN ASLI. AC,TAPE DVD, BAN BARU,CET MULUS. H. NEGO HUB:082368829897, 082368829897

SUZUKI Escudo thn 1995 Ungu Tua BK Medan Lengkap. siap pakai Hrg 76 juta / Damai. 081265451974 SUZUKI CARRY TH 86 MINIBUS BK MEDAN WARNA MERAH MESIN BAGUS CAT BAGUS PELAK RACING Rp.14.000.000, Hub. 085275752050





BARU HUB: SIMARMATA 0852 7570 2790


A/T THN 2005 SILVER, BK MDN Rp 155JT. HUB: 91327433 TOYOTA 2013


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


TOYOTA Kijang Grand Extra Sgort Thn 1995 Abu-Abu BK Medan Lengkap siap pakai Hrg 70 juta / Damai HUB: 081396204033 Dp 33jt, A = 3,3 jt, Innova TOYOTA AvanzaDp 44jt, A = 4,3jt.

Dp Free Sarung Jok / terima tukar tambah. Termurah Hub: PURBA 081397360333

TOYOTA FORTUNER V 4 X 4 MATIC BENSIN THN 2007. HITAM. BK MDN Rp 265jt. Hub: 081265942789


1 UNIT KIJANG INNOVA G, thn 2010 warna Hitam Metalic 2000cc, Bensin, Bk 227 E, Mulus. Harga 200jt(Nego). Hub: 081370407447



RX King Thn 2005. Pajak mati. Harga. 8,5jt Nego. Hp. 085262610699 DIJUAL CEPAT




2009. HIJAU MET,BK MDN Rp 85jt. HUB: 085370899893




TOYOTA BARU READY : Avanza, Inova, Rush, Fortuner, Yaris, Etios dll. Cash/ Kredit 1 s/d 5 thn, bunga mulai 3,5% 1 thn, bersedia tukar tambah, info Hub: Tomi 0813 7043 7766


Toyota Kijang Kapsul SSX Thn. 1997 warna biru metalik, BK, Medan. Kondisi siap pakai. Ban 4 baru, Velg Racing, jok kulit, harga 85Jt/Nego. Hubungi: 0812 657 2613 DI JUAL TOYOTA KIJANG KOMANDO Th. 88. WARNA BIRU mulus HARGA 43 JUTA DAMAI. HP 08126509416

TOYOTA KIJANG LGX 2000 BIRU DIESEL BK PANJANG 2014 Mobil tinggal pakai. Cukup Sehat harga Nego. 085261752131 TOYOTA YARIS E M/T 2007

SILVER Metalic Doubel firbag Sangat mulus sekali bisa bantu kredit Harga 140jt/nego. Hub: 085362036644

9 CM Rp. 126.000 10 CM Rp. 140.000 BU T U H DAN A

TOYOTA AVANZA G 2008, HITAM, SANGAT TERAWAT. DP 33JT. ANGSURAN Rp 3.371.000/ 7 bln. Hub: 0811615365


DAIHATSU BARU Pick Up Dp 11 jt Xenia L3 Angsuran 2,9 jt/36 bln Terios Angsuran 3,4 jt/36 bln Hub: 081361656010/ 77764009

Rp. 91.000 Rp. 104.000

CARRY PICK UP DP 16 JT-an atau Angs 2,4Jt-an, APV ARENA DP 30 JT-AN atau Angs 3 JT-an, ERTIGA DP 40 JT-an atau Angs 3 Jt-an. HUB. 081397929119

DAIHATSU Espass 1.3 Maroon Th. 95. Rooling Door. Sgt mulus, orisinil, VR, BR, RTP, AC Dingin. Hrg. 34Jt. Nego. Hub. 0812 6063 7823

Xenia D Plus…………DP 28jt……..Angs 3,2jt Terios TS Extra……..DP 32 jt………Angs 4jt Pick Up…………………DP 12,5jt……..Angs 2,4jt Hub. Josua 0812 6311 0820

7 CM 8 CM




Spesialis Surat Rumah dan BPKB. Proses 5 Jam Cair, Tanpa Usaha, 3 Juta - 1 Milyar. Jaminan, SHM, SK Camat, HGB. BPKB Mobil, Spd. Mtr, Truk, Mobil kredit. Dan Bantu Pelunasan BPKB. Hub. Family Finance. 0813 7044 6668 - 0813 7044 6633




Surat tanah A/N Alm. Tiomas Br Mainggolan yang terletak di jl. kesatria Timur no 72 Lingk. Xlll kel. Pahlawan kec. Medan Perjuangan yang seluas 10,70 m x 19,00 m = 203,30 m.


SURAT KETERANGAN TANAH (SKT) No : 11.6474/A/VII/15 TGL 24-12-1975. Luas =+/- 15.554M2. A/N : HWE HENG Tercecer Di Sekitar Desa SEI BAMBAN s/d Lubuk Pakam. Bagi yang menemukan Harap Di Kembalikan Di Kantor Kepala Desa SEI BAMBAN Serdang Bedagai TERCECER














BK 1297 EG A/N ENTO BUKIT TOYOTA KIJANG Hub 0812644500548

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Jumat, 19 April 2013

FAX.4561347 Iklan Anda Dijemput Wilayah Marelan, Labuhan, Belawan Hub. 0812 6390 660




Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

DIJUAL 2 UNIT RUMAH TINGGAL Lokasi Strategis, 1 Unit minimalis di grand Harjosari, Blok 81. Sp. limun Mdn dan 1 Unit di Taman Riviera Blok NCT 41 Dkt. Poldasu Medan Hub. 0812 8165 2225


JL. Sisingamangaraja KM 5 JL. Selamat pulau No 2.B Medan. LT= 60. L= 5m. P = 12m. KT= 3. KM= 1 (Di tengah kota 5 menit ke tugu S.M Raja) harga Rp.275 JT/ Nego Hp:081263157934 081264425558 RUKO DIJUAL

Comp MAKRO BISNIS CENTRE, 4 Tingkat No c27, SHM, 1469, Aman. Security 24 jam, Dekat kodam Bukit Barisan Khusus Tempat Bisnis atau usaha, mau Ke Ring Road 3 menit Harga nego. Hub : 082160562406


LT.1.930M2 di Jl. S.M. Raja Km.6,5 Medan, sblh Sipirok Nauli Ekspress/SHM Harga Rp. 7,5 Milyard/nego Hub: 0812 6352 858/0812 6200 1879 DIJUAL RUMAH 1,5 TKT LT.159M2, LB.150M2, di Jln. Pertiwi No. 4 Kel. Binjai Kec. Medan Denai Harga 350 jt/ nego Hub: 0812 6200 1879/ 0821 6289 4506


LT.344M2 di Jl. Utama Link.VII Kel. Kotamatsum IV Kec. Medan Area/SHM. Harga Rp. 650 juta/nego. Hub: 0812 6200 1879 0821 6289 4506


LT.395M2, LB.200M2 Lokasi Jln. Elang No.7 Medan/ SHM. Harga Rp. 800 juta/ nego Hub: 0812 6200 1879/ 0821 6289 4506


JL. Sisingamangaraja KM 5 JL. Selamat pulau No 2.B Medan. LT= 60. L= 5m. P = 12m. KT= 3. KM= 1 (Di tengah kota 5 menit ke tugu S.M Raja) harga Rp.275 JT/ Nego Hp:081263157934 081264425558


Baru Selesai di Bangun 2 ½ tingkat PERMANEN Jl. STM Ujung/ Jl. Suka Teguh 2 NO 11. Lantai Keramik Hub : 08126051602



UMROH 2013


Umroh Reguler 9 Hari 3/ 9/ 16/ 26 Mei, 14 Juni Umroh Reguler 11 Hari 23 Mei, 15 Juni Umroh Reguler 14 Hari 17 Mei, 21 Juni Umroh Plus Cairo 12 Hari 17 Juni 2013 Umroh Plus Turkey 12 Hari 17 Juni 2013 Umroh Plus Dubai 22 Juni Umroh Plus Aqso 20 Juni Umroh Ramadhan Awal, Pertengahan, Full Ramadhan


Bagi Jamaah luar kota menginap di Hotel Madani (Gratis) Pesawat via Singapore



TELP. 061-4576116 FAX 061-4512319 HP. 0813.6137.2321 – 0812.6495.8456

Jl. SM. Raja No. 4 / 18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488




Solusi Yang Tepat Menuntaskan Masalah Seksual Pria Baik Di Usia Tua Dan Muda


KAMI TIDAK ADA MEMBUKA CABANG DI TEMPAT LAIN Hubungi: Jl. Krakatau Simp. Jl. Sido Rukun No. 3A, Medan HP. 0813 6169 1789 IZIN DINKES: 06/YAN/KES/BATRA/III/445/2003


IZIN (BKO): 0038/SP3T - SUMUT /XI/2012


Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT KHUSUS PRIA: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia KHUSUS WANITA: - Memperbesar payudara - Mempersepit vagina KONSULTASI UMUM: - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: Jl. SM. Raja depan Hotel GARUDA PLAZA samping Klinik BUNDA Gg. Keluarga No. 13C HP. 0812 6057 6444


uk. 6x30m2,Lt 4 SK Camat/ Notaris. Jl. Letjen Jamin Ginting No. 144. Sp. Kampus Usu - Padang Bulan Medan. Hub: Hp. 081376570563 - 08126566188


1(SATU) UNIT RUMAH KOPPEL 2 Kmr Tidur,R.Tamu,DAPUR FULL Kramik, Jl. Penampungan 1 No 35 B. Belakang ZIPUR Jl. Kapt.Muslim. HUB: 081370407447



Kavling Murah, siap bangun. Lokasi Desa Baru Kecamatan batang kuis, +/-12 km ke Bandara baru Kuala Namu. Jalannya sertu persiapan aspal, SK Camat. Instalasi Listrik sudah Terpasang. Hub: 085261492672 (Tanpa Perantara)


LT. ±1.176M2 Lokasi di Jl. Bandar Labuhan Dusun V Desa Bandar Labuhan Kec. Tanjung Morawa Kab. Deli Serdang/SHM. Harga Rp. 325 juta/nego. Hub: 0812 6200 1879/0821 6289 4506




Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -




Beberapa karyawan untuk bergabung dengan kami untuk mengisi posisi:

1 . Full Maintenance Contract (FMC) 2. Administrasi

Lokasi Kerja : a. B. Aceh, Meuredue, Blang Pidie, Meulaboh, Sigli (1) b. Kutacane, Takengon, Lhokseumawe (1) c. Sibolga, Gunung Tua, Penyabungan (1) d. Tarutung, Porsea (1) e. Kisaran (2) Dengan syarat sebagai berikut : - Laki-laki usia max 27 tahun (1) Laki-laki/ Perempuan usia max 25(2) - Pendidikan min SMK Jurusan listrik, elektro, mesin atau SMA sederajad (1), min D III (2) - Berbadan sehat (1&2) - Bersedia ditempatkan di luar kota (1), Penempatan Kisaran (2) - Berani bekerja diatas ketinggian (1) - Bisa mengendara mobil dan mempunyai SIM A (1) - Dapat mengoperasikan MS Office (1&2) - Diuttamakan yang sudah mempunyai pengalaman dibidang genset & ATS (1) Lamaran & CV dikirim ke : Kisel Medan, Jl. Abdullah Lubis No. 44 Medan (a, b , c ,d ,e), atau Kisel B. Aceh, Jl. T. Bendahara No. 73 Kuta Alam B. Aceh (a) Kisel Sibolga, Jl. P. Sidempuan No. 16 A Komp. Hockli Sarudik Tapanuli Tengah (c) Kisel P. Siantar, Asahan Komp. Megaland Blk. C No. 9 P. Siantar (d) Kisel Kisaran, Jl. A. Yani Komp. Graha Asahan Indah Blok C-20 Kisaran(e)

Lt.556M2 dan 994M2 Lokasi di Jl. Talun Sungkit Kel, Tiga Raja Kec.Girsang Sipangan Bolon Kab. Dati II Simalungun/SHP. Harga Rp. 150 juta/nego Hub: 0812 6200 1879/0821 6289 4506


LT.3.732M2 dan 2.921M2 Lokasi di Desa Jonggir Leto Kec. Panai Kab. Simalungun/SHM. Harga Rp. 900 juta/nego. Hub: 0812 6200 1879/0821 6289 4506 DIJUAL CEPAT

Tanah Berukuran 20 x 25 M. Lokasi di Tembung Psr &. Hubungi : 085-371507046/ 081-362164220




TRAVEL/ WISATA WINA TRAVEL Tiket pesawat termurah, paket Tour Bangkok, paket Tour Bali, Hotel dalam/luar negri, gratis antar tiket. Jl. Pepaya No.2 samping Milo Karauke. 061 – 4577 046, Hp. 0823 6209 059



Gaji UMR, makan 2x Ditanggung,mess disediakan, gaji UMR. Jln gatot Subroto No 181 Mdn. 081269190557,085297743036

DCR IIs SLATA/sdrj U/ didd & lsg dislrkn mjd Guru PG/ TK hub Jl. KH Wahid Hasyim 92 Medan. Tlp. 4533875, 4569269




Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA








Sumatera Utara

WASPADA Jumat 19 April 2013


Retribusi Dikutip Tiap Hari

Terminal Sadabuan Dibiarkan Hancur P. SIDIMPUAN (Waspada): Pemko Padangsidimpuan diduga sengaja melakukan pembiaran terhadap kehancuran terminal Sadabuan, Kec. Sidimpuan Utara. Padahal terminal ini penyumbang Pendapatan Asli Daerah (PAD), yakni uang retribusi yang setiap hari dikutip dari para sopir angkutan umum. Pantauan di lokasi, kemarin, lantai terminal yang terbuat dari aspal dibiarkan rusak. Terdapat tiga kubangan besar yang kedalamannya mencapai 50 cm, sehingga pengendara, khususnya sopir angkutan umum dan becak bermotor, harus mengelakkannya jika tidak ingin kendaraan mengalami kerusakan. “Sudah hampir dua tahun dibiarkan begini. Terkadang kubangan air ini dipenuhi sampah dan menimbulkan bau busuk yang cukup menyengat

hidung. Banyak kendaraan yang rusak saat melintasi kubangan ini,” kata Ali Rambe, sopir angkutan umum yang tiap hari mangkal di terminal Sadabuan. Dijelaskannya, pada saat antrean mobil angkutan banyak di terminal itu, kendaraan terpaksa harus melintasi kubangantersebutkarenaberadatepat di jalur keluar terminal. Becak bermotor sering mengalami kejadian mesin mati tiba-tiba saat melintasikubangan,karenaposisi mesinnya cukup rendah.

2 Agen Togel Dibekuk Di Aek Tampang P. SIDIMPUAN (Waspada): Dua pria berinisial SS, 37, dan PL, 28, yang selama ini berprofesi sebagai agen judi togel, ditangkap aparat Polres Kota Padangsidimpuan. Polisi mencurigai keduanya hanya sebagai ‘kaki’ dari bandar besar di balik layar. Saat ini keduanya masih dalam pemeriksaan di Mapolresta Padangsidimpuan. Diketahui, omset per hari bisnis haram itu mencapai jutaan rupiah. Kapolres Kota Padangsidimpuan AKBP Budi Hariyanto diwakili Kasat Reskrim AKP Anjas Asmara Siregar, S.Sos kepada Waspada mengungkapkan, Rabu (17/4), SS warga Kel. Aek Tampang, Kec. Padangsidimpuan Selatan dan PL juga warga Aek Tampang ditangkap Selasa (16/4). Kabar itu sebelumnya didapati setelah Polres Kota Padangsidimpuan mendapat informasi dari masyarakat yang resah dengan aktivitas judi togel di kawasan Pos TPR Jalan Tapian Nauli, Kel. Aek Tampang. Dari tangan kedua tersangka disita uang tunai Rp1.118.000, satu unit HP, tiga buah buku tulis rekapan nomor tebakan dan satu buah kalkulator. Selain kasus judi togel, Anjas menerangkan, dalam sebulan terakhir ini jajaran Polresta Padangsidimpuan mengamankan enam unit sepedamotor. Masyarakat yang kehilangan sepedamotor diharap datang ke Mapolres melihat sepedamotor tak bertuan yang diamankan polisi. (c13)

Camat Halongonan Tutup Usia GUNUNGTUA (Waspada): Camat Halongonan, Pangaribuan Dalimunte tutup usia, Kamis (18/4) siang sekitar pukul 12:34. Pangaribuan mengembuskan nafas terakhirnya diduga karena penyakit jantung yang diidapnya. Pria yang akrab disapa pak Dalimunte ini tiba-tiba jatuh pingsan sesaat menyampaikan pertanyaan dalam suatu acara yang digelar Badan Pusat Statistik (BPS) Paluta di Aula Hotel Mitra Gunungtua. Saat datang, Camat Hulu Sihapas Roni Ananda, mengaku berada bersebelahan dengan almarhum saat acara, beliau diduga terkena serangan jantung saat memberikan pertanyaan dalam rangka sensus pertanian yang diselenggarakan BPS Paluta. Almarhum diduga mengembuskan nafas terakhir dalam perjalanan dari aula Hotel Mitra Gunungtua ke Rumah Sakit Umum Daerah (RSUD) Gunungtua di Desa Aek Haruaya, Kec. Portibi. Pria kelahiran 1970 (43 tahun) ini meninggalkan duka yang mendalam bagi sanak keluarga, rekan kerja, kerabat dan tentunya segenap masyarakat Halongonan. Terutama terhadap Sang istri dan ketiga anaknya. Direktur RSUD Gunungtua dr H Naga Bakti Harahap dikonfirmasi Waspada membenarkan bahwa pihaknya telah melakukan pertolongan kepada almarhumsebelum mengembuskan nafas terakhir. Ketika mendengar kabar camat Halongonan meninggal mendadak, para kerabat, teman dan pegawai dilingkungan Pemkab Paluta, langsung bertakziah ke rumah duka di Jalan Lintas Gunungtua- Rantauprapat, Simpang Barumun, Kec. Halongonan. Di rumah duka tampak hadir Asisten II Pemkab Paluta Drs Rachmat Effendi Harahap, Kapolsek Padangbolak AKP JW Sijabat, para camat, Muspika Padangbolak, para kepala dinas seta para insan pers teman almarhum semasa hidupnya. (a35)

Sedangkan Rahman Pane, pedagang di sekitar terminal menuturkan, pada musim hujan sepeti sekarang ini kubangan tersebut selalu digenangi air, sehingga tidak jarang kios milik pedagang di sekitarnya kecipratan air jorok pada saat kendaraan melintasi kubangan. Kepada pemerintah daerah, diminta agar memperhatikan kerusakan tersebut. “Jangan taunya cuma mengutip retribusi dari parasopirangkutan,tapitidakpernah mendengar atau menyahuti

keluhan mereka,” ujar Pane. Sedangkan Boriz, aktivis penggiat masyarakat Sadabuan, menyebut sangat percuma Wali Kota Padangsidimpuan saat ini punya visi menciptakan rakyat yang Sehat, Maju, Sejahtera (SMS), sementara persoalan sepele seperti ini saja tidak bisa dituntaskan. Terminal yang juga berada di lingkungan Pasar Inpres Sadabuan ini, katanya, merupakan urat nadi perekonomian dan lalulintas masya-rakat Kec.

Sidimpuan Utara, Sidimpuan Hutaim-baru, Sidimpuan Angkola Julu, dan lima kecamatan lainnya di wilayah Kab. Tapanuli Selatan. Sehingga, sedikit saja masalah yang terjadi di terminal itu, sudah mampu mempengaruhi kepentingan hidup orang banyak yang berada di tujuh kecamatan tersebut. Boriz berharap Pemko Padangsidimpuan segera mengatasi persoalan terminal Sadabuan yang rusak parah ini. (a27)

Bupati Madina Optimis Nilai UN Siswa Bagus PANYABUNGAN (Waspada): Bupati Mandailing Natal (Madina) HM. Hidayat Batubara, SE optimis perolehan nilai siswa dalam Ujian Nasional (UN) tahun ini tetap bagus seperti tahun sebelumnya. Itu disampaikan bupati saat meninjau langsung pelaksanaan UN di sejumlah sekolah di Kec. Panyabungan meliputi MAN I Panyabungan, SMA Negeri 2 Plus, dan SMK Negeri 1 Aek Galoga, Rabu (17/4). “Saya optimis, nilai siswa bagus karena selama ini Dinas Pendidikan telah melakukan berbagai upaya program studi ektrakurikuler, salah satunya pelaksanaan les tambahan dan try out di semua sekolah,” ucap bupati. Turut hadir dalam peninjauan UN Wakapolres Madina Kompol.Rinaldo, SH, Sekda M.Daud Batubara, MM, Asisten II Drs.Syafei Lubis, Kadis Pendidikan Imron Lubis, MM dan

Waspada/Sukri Falah Harahap

TERMINAL Sadabuan, Kota Padangsidimpuan, mengalami kerusakan sejak dua tahun lalu. Kubangan besar yang berada di jalur keluar terminal dibiarkan begitu saja.

UN SMA/SMK Di Madina Lancar

Waspada/Sarmin Harahap

BUPATI Madina HM. Hidayat Batubara damping Wakapolres Kompol.Rinaldo,SH dan Sekda, Daud Batubara saat meninaju UN di SMU Negeri 1 Plus Panyabungan. Kabag Humas dan Protokol Arbi Harahap,AP. Kadis Pendidikan Madina Imron Lubis mengatakan,

sejauh ini pelaksanaan UN di Madina berjalan baik meskipun ada kendala terkait naskah UN yang terlambat datang. (c14)

Air Masam Resahkan Warga Lembah Sorik Marapi PANYABUNGAN ( Waspada): Pengaruh air asam semakin menyulitkan dan meresahkan masyarakat di berbagai desa di Kec. Lembah Sorik Marapi, Kab. Mandailing Natal, dalam beberapa puluh tahun terakhir ini. Pasalnya, air asam itu telah mengganggu areal persawahan dan perikanan, sehingga perlu mendapat penanganan serius dari pemerintah daerah. Harapan tersebut disampaikan sejumlah warga Lembah Sorik Marapi kepada wartawan, kemarin. “Kami telah kesulitan akibat pengaruh air masam itu. Ini menjadi persoalan utama yang melanda hampir 70 persen desa di Kecamatan Lembah Sorik Marapi, seperti Desa Maga Dolok, Kelurahan Pasar Maga, Maga Lombang, Pangkat, Aek Marian dan Bangun Purba,” ujar A. Rangkuti, 35, salah seorang warga kecamatan itu.

Rangkuti mengatakan, akibat pengaruh air masam itu, telah menyebabkan gangguan dan kendala dalam bertani utamanya bersawah dan membudidayakan ikan tawar. Selain itu, air masam itu telah membuat tanah jadi gersang, sehingga tanah persawahan tidak lagi mengandung lumpur, kemudian membuat petani har us melakukan pemupukan padi tiga kali lipat ditambah pengapuran, yang mendatangkan kerugian bagi petani karena besaran modal daripada untung serta tanah yang terkena air masam mudah longsor mengakibatkan areal persawahan dan perkebunan menjadi berkurang. Untuk itu, Rangkuti bersama warga lainnya meminta Pemkab Madina agar bisa mengatasi permasalahan air masam itu dengan serius, kemudian dalam merealisasikan

pembangunan yang ada seperti pembangunan insfrastruktur dan proyek lainnya. Apa yang dikeluhkan warga itu dibenarkan Kepala Desa Aek Marian Bahsanuddin Nasution, S.Pd, sehingga pemerintah daerah perlu segera mengatasinya, apalagi tujuannya sebagai upaya untuk meningkatkan perekonomian masyarakat. Masyarakat, lanjut dia, tidak tahu harus berbuat apa lagi untuk mengatasi hal itu, bahkan keberadaan air masam tersebut telah menyebabkan banyaknya areal pertanian yang tidak lagi dimanfaatkan sebagai penopang hidup dan kehidupan warga di kecamatan itu. Ia menjelaskan, persoalan pengaruh air masam ini sudah berulangkali disampaikan kepada pemerintah daerah, namun hingga saat ini belum ada langkah maupun upaya konkrit dilakukan pemerintah. (a28)

PANYABUNGAN (Waspada): Hari terakhir pelaksanaan Ujian Negara (UN) tingkat Sekolah Lanjutan Atas (SLTA), Sekdakab Mandailing Natal M. Daud Batubara bersama Kadis Pendidikan (Kadisdik) Madina Imron Lubis, S. Pd, MM meninjau pelaksaanaan UN di beberapa sekolah di Mandailing Julu, Kab. Mandailing Natal. Selain keduanya, ikut juga bersama rombongan ini Asisten II Pemkab Madina, Syafii dan anggota DPRD Madina Rahmad Rizky Daulay. Pantaun Waspada, Kamis (18/4) di lapangan, sekolah yang pertama sekali didatangi adalah SMA 1 Kotanopan. Di sini, Sekda dan Kadisdik berdialog langsung dengan Kepala SMA 1 Kotanopan, Annagian Siregar, S. Pd terkait kesiapan sekolah, pengawas dan kendala yang dihadapai di lapangan. Usai itu, keduanya langsung memantau pelaksanaan UN di depan kelas sambil melihat daftar peserta UN. “Alhamdulillah, pelaksanaan UN selama empat hari ini di SMA 1 ini berjalan lancar. Walaupun, 60 siswa IPS tidak ujian karena soal tidak ada, namun secara umum pelaksaan UN berjalan dengan baik. Terkait pelaksanaan UN ulangan bagi yang IPS, kita masih menunggu informasi dari Dinas Pendidikan Madina,” ujar Annagian Siregar kepada Sekda Madina. Usai peninjauan di SMA Kotanopan, rombongan kemudian mendatangi Pondok Pesantren Subulussalam Sayurmaincat Kotanopan. Kedatangan rombongan langsung diterima Kepala Sekolah Aliyah Ponpes Subulussalam, Esmin Pulungan beserta Tim Independen. “Siswa yang ujian di pesantren ini berasal dari empat sekolah, yaitu Ponpes Subulussalam,

MA Sulaiman Baqi, MA Babussalam dan Darul Mursyid Muara Sipongi. Baik jurusan IPA dan IPS tidak ada kekurangan soal, alhamdulillah semua siswa kita ikut ujian dan berjalan lancar,” kata Esmin Pulungan. Sedangkan di MA Darul Ulum Muara Mais, Kec. Tambangan, rombongan Sekda diterima langsung Kepala Sekolah, Musaddad. “Ujian UN selama empat hari berjalan lancar, terkait dengan soal alhamdulillah semua lengkap, tidak ada yang kurang,’ ujar Musaddad kepada rombongan. Usai peninjauan, Sekda Madina mengatakan, secara umum pelaksanaan ujian di hari terakhir berjalan lancar. Sampai saat ini menurut keterangan panitia dan Kepala Sekolah tidak ada masalah yang dijumpai di lapangan. Terkait dengan pelaksanaan ujian bagi siswa yang belum ujian, sepenuhnya kita serahkan kepada Dinas Pendidikan dengan menunggu petunjuk dari pusat,” ujarnya. Hal sama juga dikatakan Kadis Pendidikan Madina, Imron Lubis, S. Pd, MM. “Secara menyeluruh pelaksanaan UN di tingkat SLTA di Madina berlangsung lancar dan aman. Mulai hari pertama sampai terakhir hari ini kita sudah meninjau pelaksaan UN hampir di semua sekolah yang ada di Madina, alhamdulillah berjalan dengan baik,” katanya. Anggota DPRD Madina, M. Risky Daulay menyesalkan tidak ada soal di beberapa sekolah. “ Kita cukup menyesalkan tidak ada soal di beberapa sekolah. Ke depan kita berharap manajemen pengaturan soal ini agar diperbaiki. Kondisi ini tentunya sangat menganggu mental siswa. Dari awal mereka sudah siap menghadapi UN, namun soalnya ternyata tidak ada, otomatis mereka sangat kecewa,” ujarnya. (c15)

Kerjasama Bidang Pendidikan Jurnalistik

STAIN P.Sidimpuan Dan Harian Waspada Teken MoU P.SIDIMPUAN (Waspada): Sekolah Tinggi Agama Islam Negeri (STAIN) Padangsidimpuan menggandeng Harian Umum Nasional Waspada sebagai mitra tunggal kerjasama pendidikan jurnalistik kepada mahasiswa Jurusan Dakwah, Program Pendidikan (Prodi) Komunikasi Penyiaran Islam (KPI). Program kerjasama lima tahun ini dituangkan dalam sebuah nota kesepahaman (MoU) yang diteken bersama Ketua STAIN Padangsidimpuan, DR. Ibrahim Siregar MCL, dan Kepala Perwakilan Harian Umum Nasional Waspada Wilayah Tapanuli, Syarifuddin Nasution, Kamis (18/4). “STAIN Padangsidimpuan satu-satunya perguruan tinggi di Tapanuli Bagian Selatan (Tabagsel) yang membuka Prodi Komunikasi Penyiaran Islam. Kami sangat butuh bantuan dalam menciptkan mahasiswa yang kompeten dan memahami jurnalistik Islami. Karena itulah kami pilih Harian Waspada sebagai mitra,” kata Ibrahim. Ketua STAIN Padangsidimpuan menjelaskan, selama ini hubungan kemitraan dengan Waspada terjalin sangat baik. Namun baru inilah

ditingkatkan dan ‘diikat’ dalam sebuah nota perjanjianbersama(MoU).Diharapnya, kerjasama iniberjalansukses,lancar,dandapatdikembangkan lagi dalam bentuk kesepakatan lainnya. “Harian Waspada suratkabar besar dan tertua di Sumatera Utara, hingga usia ke-66 tahun tetap tegas, teguh, dan konsisten melakukan syiar Islam lewat jurnalistik. Itulah alasan utama kenapa kami harus memilih Waspada,” ujarnya. Menyikapi kerjasama ini, Kepala Perwakilan Harian Umum Nasional Waspada Wilayah Tapanuli, Syarifuddin Nasution, berterimakasih kepada STAIN. Karena telah menunjukkan kepeduliannya terhadap jurnalistik, yakni dengan membuka program pendidikan komunikasi dan penyiaran Islam. “Meski bersifat khusus tentang jurnalistik Islami, kami menilai ini sebagai sebuah langkah maju dari ‘kaum’ akademisi di Tabgasel terhadap profesi wartawan. Kami berharap langkah positif seperti ini bisa diikuti perguruan tinggi lainnya yang ada di Tabagsel,” ujar kepala perwakilan. Tentang kerjasama yang di-ikat dalam sebuah nota kesepa-katan (MoU). Syar ifuddin mengatakan, selama program itu dibuat untuk kebaikan dan apalagi kemaslahatan umat, Waspada akan selalu siap bekerjasama denganlembagamanapun.“Apalagi kerjasama kita ini bertujuan untuk mencerdasakan generasi bangsa yang Islami,” tegasnya. Penandatanganan MoU di ruang kerja Ketua STAIN ini disaksikan Pembantu Ketua I, Drs. Irwansyah MA, Kajur Dakwah, Fauziah Nasution MA, Kajur Syariah, DR. Sumper Mulia HarahapMA,KaprodiKPI,LisYulianti Waspada/Sukri Falah Harahap S.Psi.MA, Kepala Laboratorium KETUA STAIN Padangsidimpuan DR. Ibrahim Siregar dan Dakwah, Ali Amran MSi, warKepala Perwakilan Waspada Wilayah Tapanuli, Syarifuddin tawan Waspada, Sukri Falah HaNasution, menandatangani MoU program kerjasama rahapdanMohotLubis,sejumlah pendidikan jurnalistik. dosen dan mahasiswa. (a26/a27)

Lakalantas Di Sibolga Menurun SIBOLGA (Waspada): Jumlah kecelakaan lalulintas (Lakalantas) di wilayah kerja Polresta Sibolga hingga pertengahan April 2013 jauh menurun bila dibandingkan periode yang sama pada tahun lalu. Hal ini diindikasikan makin tingginya kesadaran berlalulintas warga. “Kalau kita lihat data Lakalantas di kota Sibolga dari Januari hingga pertengahan April tahun ini, Alhamdulillah jauh menurun dibandingkan periode yang sama pada tahun lalu. Bahkan pada bulan April ini masih nihil. Hal ini mengindikasikan makin tingginya kesadaran warga mematuhi peraturan lalulintas dan juga program “hunting” (razia rutin) yang kita gelar di beberapa titik rawan lalulintas,” kata KapolrestaSibolgamelaluiKasatlantasAKPSyahrul kepada Waspada di ruang kerjanya, Rabu (17/4). Dijelaskan AKP Syahrul, tahun lalu jumlah Lakalantas periode Januari hingga April mencapai20kejadianlakalantasdenganrinciansatuorang meninggal dunia, tujuh luka berat dan 17 luka ringan serta kerugian materil Rp17,5 juta, namun pada tahun ini lima kejadian yang mengakibatkan satu meninggal dunia, lima luka berat dan dua

luka ringan serta kerugian materil Rp 6,5 juta. “Meski begitu kita tetap melakukan tindakan preventif dan refresif untuk meminimalisasi kecelakaan lalulintas,” ujar Kasatlantas yang pernah bertugas di Kota Pematangsiantar itu. Masih menurut Kasatlantas Polresta Sibolga, salahsatu tindakan preventif yang dilakukan untuk meminimalisasi kecelakaan lalulintas, pihaknya bersama masyarakat Kota Sibolga pada Sabtu (13/4) yang lalu di Jalan AYani Sibolga telah digelar “launching” pelopor berlalulintas. “Bersama Pak Kapolresta diwakili Wakapolresta Sibolga Kompol T Manaf, kita telah menggelar kegiatan pelopor berlalulintas yang baik, sehingga kita harapkan melalui kegiatan ini, kesadatan warga untuk tertib lalulintas semakin tinggi,” kata AKP Syahrul. Beberapa kegiatan yang digelar untuk usia dini (siswa TK dan SD) dengan menggelar lomba melukis dengan tema berlalu lintas yang baik. Selain itu juga, kepada warga yang telah dewasa pihaknya juga memberikan sosialiasi berlalulintas yang baik dan dampak negatif yang ditimbulkan akibat kecelakaan lalu lintas. (cpol)




AS Perlu Introspeksi

edakan bom pada ajang maraton internasional di Boston terus menuai komentar masyarakat dunia. Sampai kemarin, pemerintah Amerika lewat Presiden Barack Obama masih belum berani menyebut siapa pelakunya walau FBI sudah bekerja keras melakukan pemeriksaan terhadap sejumlah orang yang dicurigai. Boleh saja Presiden Obama bersumpah akan memburu pelaku bom Boston sampai ke ujung dunia, namun kita harapkan jangan asal menuduh, seperti pada kasuskasus sebelumnya. Ujung-ujungnya kelompok Islam fundamentalis jadi sasaran, seperti Al-Qaeda, Taliban, Hizbullah yang selama ini tidak mau tunduk pada kezaliman pemimpin AS. Tekad yang begitu membara dari pemimpin Amerika dan dukungan dari pemimpin di Eropa untuk menangkap pelaku bom Boston tentunya bisa menimbulkan dampak negatif bila tanpa bukti kuat Obama bertindak represif terhadap kelompok Islam garis keras, seperti selama ini. Puluhan tahun sudah kelompok Islam fundamentalis selalu dijadikan kambing hitam. Mereka dituduh melakukan aksi teroris padahal tak ada buktinya. Dengan disebut kelompok Islam membuat citra umat Islam rusak dan tercemar di mata masyarakat dunia. Sebutan teroris jelas ditujukan pada kelompok Islam, walaupun pelaku teroris bisa datang dari kelompok dan penganut agama mana saja di dunia ini. Peristiwa berdarah bom Boston yang direkayasa lewat wadah panci bertekanan tinggi sepertinya tidak sulit dilakukan oleh siapa saja. Namun dampaknya luar biasa. Tiga orang tewas dalam insiden tersebut, 176 orang lainnya terluka, beberapa terpaksa diamputasi karena parahnya luka. Agak mengherankan jika penyidik Amerika kebingungan, mengalami kesulitan membekuk pelakunya (Waspada, 18/4). Sampai kemarin belum terdapat bukti-bukti yang meyakinkan untuk menetapkan tersangka bom Boston, walau sejumlah saksi dan bukti foto dan rekanan video sudah diambil penyidik, namun sejumlah orang yang terlihat mencurigakan ketika diperiksa mengaku kalut dan membantah terlibat dalam aksi kejahatan. Dalam rekaman CCTV terlihat pula logo Navy Seal ala Amerika Serikat pada seorang pemuda, serta menggenggam alat yang mirip dengan detonator bom.Hal itu membuat aparat penyidik tidak yakin dilakukan kelompok Islam. Keterlibatan Al-Qaeda dan Taliban dalam bos Bostom sudah dibantah pemimpinnya Intisari sejalan dengan bukti-bukti di lapangan tidak meyakinkan kalau aksi bom Boston dilakukan Mengapa Amerika jadi Islam fundamentalis. Atas dasar itu, tidak tertutup aksi bom Boston dilakukan oleh sasaran aksi terorisme? kelompok non-Muslim atau kelompok yang kepemimpinan Barack Obama Perlu kajian komprehen- membenci atau mereka yang sakit hati atas keterlibatan sif dan introspeksi diri Amerika dalam berbagai kasus main hakim sendiri di Palestina, Afghanistan, Pakistan, Irak, Iran, Libya, Mesir dan kini Syria juga diobok-obok. Hemat kita, jarang-jarang pemimpin Amerika bersikap hati-hati dalam menetapkan pelaku teror seperti bom Boston. Namun dalam kasus event lari maraton ini sepertinya Amerika harus bersabar dalam mengungkap pelakunya. Perubahan karakteristik negara adidaya tersebut menunjukkan pemimpin Amerika mulai sadar akan sikap arogansi dan menduanya selama ini hanya menimbulkan antipati banyak pihak. Ketika Amerika dipermalukan dengan hancurnya dua gedung kembar WTC pada 11 September 2001 akibat ditabrak pesawat, langsung pemimpin Amerika menuduh Al-Qaeda. Padahal, banyak bukti peristiwa itu direkayasa, dilihat dari rapuhnya bangunan sehingga bisa hancur dalam sekejap saja dan banyaknya korban tewas namun tak seorang pun katanya warga Yahudi di dalam gedung, seakan sebelum peristiwa terjadi sudah ada pemberitahuan sehingga pekerja Yahudi di WTC selamat semua. Kasihan rakyat Afghanistan karena negaranya langsung diserang oleh pasukan Amerika untuk mencari Osama bin Laden yang dituduh sebagai dalang peristiwa WTC. Ribuan rakyat Afghanistan tewas, termasuk kelompok Taliban harus menyerahkan kekuasaannya digantikan pemimpin boneka Amerika. Kasus yang sama terulang di Irak. Presiden Saddam Hussein dituduh punya senjata kimia sehingga menjadi alat pembenaran bagi Amerika untuk menginvasi negara berdaulat. Faktanya tak ada senjata kimia dimiliki Irak. Irak hancur dan Saddam tewas di tiang gantungan. Sama halnya nasib Libya. Untuk menggantikan pemerintahan terlama Mohammad Khadafi AS merekayasa rakyat Libya untuk memerangi Khadafi dengan persenjataan. Perang saudara pun tak terhindari, ribuan orang tewas, istana Khadafi jatuh, dan pemimpin kharismatik Libya yang keras menentang Amerika itu pun tewas mengenaskan. Tak pelak lagi sasaran tembak Amerika terhadap negara-negara yang melawannya sangat erat kaitannya dengan sumber daya alam, terutama minyak. AS menggunakan segala cara untuk menguasai minyak Libya, Irak dll. Sebentar lagi Iran bakal menjadi sasaran tembak tapi tidak untuk Korut karena negara komunis itu miskin. Justru itu, kehati-hatian Amerika mengungkap pelaku pengebom Boston cukup mengherankan namun hal itu baik untuk kemajuan demokrasi dan kedamaian dunia. Sebab, mencuatnya aksi terorisme membuktikan kepada masyarakat dunia bahwa aksi terorisme bisa datang dari negara mana saja, tidak mengenal suku, agama, warna kulit.+


Faks 061 4510025

Facebook Smswaspada

+6285261277343 Tragedi dolok pardamean adalah pelajaran untuk polri agar dgn tegas menangkap agen togel di nkri, masa kepemimpinan jend.sutanto kok bisa berhenti, saat ini gak bisa? Ada apa dibalik ini? Kpd bpk kapolri agar mencontoh bpk jend.sutanto. +6283199025981 AMRI TAMBUNAN , KADER PARTAI DEMOKRAT , Bupati DeliSerdang , sudah memasuki priode kedua masa jabatan Bupatinya • Tak berbilang lama , akan ditinggalkannya Kursi class v.v.i.p. di D.S. • Adakah kader lain didalam P.D. Sum.Ut. yang mampu seperti beliau? Partai Kunenglama , sudah menampak kan candidate Bupatinya di DeliSerdang • Muka lama di partai kuneng da-erah itu dan juga ikut contest pada Pil.Bup. nan silam • Kader Gol.Kar. ini , akan bersaing suara dengan Zainuddin Mars yang sudah mendapat penilaian tersendir idi qolbu masyarakat • “ Dari Wakil , wajar thoh dia meng-inginkan Kursi Amri yang akan kosong !” Mampukah personel-per sone l partai kunenglama , me nghalau tangan pemilih ke arah gambar T. Akhmad Thala‘a dan mencobloskan paku yang dipegangnya ?? # awalsiang akhad 07 apr il ; awak tak ahli meneng ok rahsia ilahi * addres; k r. sikameng siblah kiri # +6281219617084 Salam pada petinggi rawat jalan RSUP H ADAM MALIK Medan yg menunda-nunda oprasi pasien a/n Asni Situmorang poli urologi yg alasan nya tdk jelas dan berbelit2. +6281264974076 2014, 14 hari bulan purnama. Umat Islam utamanya Caleg partai-partai Islam tidak termakan issu LSN/LSI bahwa PI sedikit pemilihnya. Justru PKS akan dapatkan 17% suara, PPP10%, PAN7%, PKB/PBB5%, amin ya Rabb ya Khairunnashirin. Mulai malam ini para caleg sholat tahajjud, sholat wajib di awal waktu kalau bisa berjama’ah/di mesjid, kerjakan Dhuha kalau sempat, bersedeqah setiap hari sesuai kemampuan.’Amalan ini menjemput keridhoan, keceriaan hati, sehat selamat dan tercapainya asa dan cita, amin ! (Rizal Mahmuzar,dosen Politik Linguistik dan guru Qiroat Quran) +62811638291 Assw, wahai saudara2. muslim se tanah air dan dunia, bagaimana reaksi kita tehadap tindakan kekejaman kepada saudara2 kita muslim di Myanmar dan Srilangka? Yang dilakukan kelompok agama lain. Bagaimana kita Indonesia ini? Khusus kota Medan, di Sri langka di tuduh mau mengusai ekonomi, di Medan siapa yg mengusai? Kita sangat prihatin. Wass. +6281370626898 Maaf sebelum nya pada seluruh pembaca . mengenai masalah mobil pajero melindas anak balita di tuntut 6 tahun penjara supir nya kalau saya tidak setuju sebelah pihak penyebab nya kan kelalaian si penjaga anak itu seharus nya di hukum juga atas kelalaian nya tapi hukum menjerat nya padahal sudah berdamai , hukum banyak yg salah harus di simak dan di benarkan . ..Trimakasih fsal +6281361455577 Muak lihat PSSi prestasi tak ada pengurus berantem trs BUBARKAN saja ! +628126329716 Kepada Pengelola AN TV dan TV ONE, Mengapa siaran langsung Sepakbola ISL DITUTUP(DIACAK)? kami penggemar sepakbola yg nonton melalui parabola sangat KECEWA ! Mohon dibuka kembali seperti biasa, trimks. +6282370585631 Negara kita MERDEKA sudah sangat lama sekalee !!! Tapi hanya untuk menayangkan siaran langsung sepak bola eropa, kenapa tidak seperti negara TETANGGA ?? aneh nya lagi, sarana penyembuh luka yang bersifat sementara,,?? Terutama bagi kita orang2 yg nota bene, selalu di sakiti oleh hukum2 dan peraturan yg selalu berpihak kepada orang KAYA.!, sudah stasiun negara sendri di haramkan.?? Stasiun negara TETANGGA di bajak oleh PEMBAJAK LOKAL MADE IN INDONESIA..??? padahal siaran tersebut, adalah salah satu !! ini lah indonesia.? Persatuan dan kesatuan BANGSA.

WASPADA Jumat 19 April 2013

Defek Moral & Kejahatan Sadis Oleh Nursariani Simatupang Kejahatan merupakan persoalan yang dialami manusia dari waktu ke waktu. Kejahatan merupakan problema manusia. Karena itu, dimana ada manusia di sana pasti ada kejahatan.


anusia sebagai makhluk sosial kesehari-harianya tidak terlepas dari kehidupan bermasyarakat. Sebagai makhluk sosial, manusia akan mengalami berbagai proses, dimulai dari masa kecilnya yang akan mengantarkannya pada sebuah keputusan dalam menentukan masa depannya.Tentunya hal ini diawali dari pengalaman kehidupan anak dalam keluarganya. Dalam keluarga tidak sedikit anak yang menemukan perilaku tidak sesuai nilainilai moral yang berlaku dalam masyarakat yang diakibat orang tuanya yang tentunya tidak memiliki moral yang baik. Moral diartikan sebagai perbuatan/ tingkah laku/ucapan seseorang dalam berinteraksi dengan manusia. Apabila perbuatan yang dilakukan seseorang sesuai nilai rasa yang berlaku di masyarakat, dan dapat diterima serta menyenangkan lingkungan masyarakatnya, maka orang itu dinilai mempunyai moral yang baik, begitu juga sebaliknya. Moral biasanya digunakan untuk mengarahkan, mengendalikan, dan menentukanperilakuseseorang,dandijadikanstandarperilakuindividudalamkelompok pergaulan dalam hubungannya dengan masyarakat. Manusia merupakan makhluk ciptaan Tuhan yang paling sempurna.Tuhan menciptakan manusia berbeda antara satu denganyanglainnya.Denganmoralmanusiamemilikiciripembedadenganmakhluk lain ciptaanYang Maha Kuasa dan dengan moral pula manusia akan memiliki keindahanbaikdalamucapanmaupuntingkah lakunya. Sumaryono mengemukakan tiga faktor penentu moralitas perbuatan manusia, yaitu motivasi, tujuan akhir, dan lingkungan perbuatan. Perbuatan manusia dikatakan baik apabila motivasi, tujuan akhir dan lingkungannya juga baik. Apabila salah satu faktor penentu itu tidak baik, maka keseluruhan perbuatan manusia menjadi tidak baik ( Bentuk dari kerusakan moral yang paling mudah dilihat saat ini adalah munculnya berbagai kejahatan yang terjadi dalam masyarakat. Dari segi kriminologis setiap tindakan atau perbuatan tertentu yang tidak disetujui masyarakat diartikan sebagai kejahatan. Ini berarti setiap kejahatan tidak harus dirumuskan dalam suatu peraturan hukum pidana. Jadi setiap per-

buatan yang anti sosial, merugikan, serta menjengkelkan masyarakat, secara kriminologis dapat dikatakan sebagai kejahatan (Made Darma Weda, 1996;12). Kejahatan adalah suatu nama atau cap yang diberikan orang untuk menilai perbuatan- perbuatan tertentu, sebagai perbuatan jahat. Kejahatan merupakan perbuatan yang tidak baik, menjengkelkan, membuat orang kesal, dan sangat merugikan masyarakat. Kejahatan merupakan perilakuyangtidakdapatditerimamasyarakat. Walaupun demikian sulit rasanya memisahkan diri dengan kejahatan, karena kejahatan tidak terpisahkan dari kehidupan manusia sehari-hari. Kejahatan merupakan persoalan yang dialami manusia dari waktu ke waktu. Kejahatan merupakan problema manusia. Karena itu,dimanaadamanusia di sana pasti ada kejahatan.“Crime as eternal, as eternal as society” (J.E.Sahetapy, 1979; 1). Kejahatan yang terus terjadi dan tiada henti banyak ragamnya. Bahkan kita terbiasa membaca, mendengar,danataumelihat di media, banyak beritayangdisajikanmengenaikejahatan. Tiada satu hari pun tanpa berita kejahatan. Pembunuhan, perampokan yang disertai denganpembunuhan,perampokanmenggunakan senjata api dan senjata tajam, perkosaanyangdiakhiridenganpembunuhan, penipuan, penculikan, penjambretan, perampasan barang, penganiayaan, dan berbagai bentuk kejahatan lainnya kerap terjadi. Ini memperlihatkan bahwa kejahatan terus berlangsung, bahkan kita tidak bisa menghitung berapa banyak jumlah kejahatan yang sudah terjadi. Aneka ragam bentuk dan modus kejahatan yang kerap terjadi di masyarakat saat ini. Modus yang digunakan oleh pelaku tidak bisa diterima oleh akal sehat manusia. Tidaksedikitperlakuankejahatandilakukan dengan sangat sadis, kejam, dan tidak berprikemanusiaan. Sungguh pelaku kejahatan tidak pernah memikirkan kerugian yang akan terjadi pada korbannya. Pelaku kejahatan hanya memikirkan berapa besar ke-

untungan yang akan diperolehnya serta bagaimana caranya menghilang dari upaya pengejaran masyarakat dan pihak keamanan. Bukan hanya bentuk dan modusnya yang beraneka ragam, pelaku dan korban kejahatan juga berasal dari berbagai kalangan, baik dewasa maupun anak-anak, laki-laki maupun perempuan, orang yang tidak berpendidikan maupun sebaliknya. Sayangnya, kita kerap tidak mengetahui bahwa di antara kita ada calon pelaku kejahatan yang selalu waspada mengincar.Wajah-wajah criminal tidak terlihat lagi pada calon pelaku. Mereka sangat pandai menyimpan hal tersebut. Pola penyimpanan yang dilakukan sangat rapi, sehingga raut wajahnya tidak terlihat sebagai tampang pelaku kriminal. Hal itu tersembunyi dalam balutan pakaian yang mentereng, rapi, sepatu mengkilat atau malah berdasi. Polapenyimpananyangrapimembuat masyarakat terperdaya. Kita tidak mengira orang yang di samping, di depan, atau di belakangadalahorangyangsiapmenerkam dan menjadikan kita sebagai korbannya. Daritindakanpelakukejahatan yang sangat sadis, kejamsertatidakberperikemanusiaan tanpa rasabelaskasihankepada korbannya, pada umumnya mereka adalah individu yang mengalami defek moral, dengan mental dan karakter sangat lemah. Defek moral (Kartini Kartono, 1997; 205) adalahkondisiindividu yang hidupnya delinquent (nakal, jahat), selalumelakukankejahatan dan bertingkah laku asosial atau anti sosial, namun tanpa penyimpangan atau gangguan organis pada fungsiinteleknya,hanyasajainteleknyatidak berfungsi sehingga terjadi kebekuan moral yang kronis. Ciri orang yang mengalami defek moral adalah cenderung psikotis dan mengalamiregresi,denganpenyimpanganpenyimpangan relasi kemanusiaan. Sikapnya dingin, beku, tanpa afeksi. Emosinya steril terhadap sesama manusia, munafik, jahat, sangat egoistis, self centered, dan tidak menghargai orang lain. Tingkah laku seseorang yang mengalami defek moral selalu salah dan jahat (misconduct), sering melakukan kekerasan, kejahatan, dan penyerangan. Ia selalu melanggar hukum, norma dan nilai-nilai yang berlaku di masyarakat. Jika dalam masyarakat ada anak yang mengalami defek moral di masa kecilnya, maka anak akan mudah tumbuh menjadi orang dewasa yang defek moral. Anak-anak yang tumbuh dalam kondisi defek moral

yangdiakibatkanpengaruhdarilingkungan yang buruk, kejam dan tidak kondusif, pada usia dewasanya akan tumbuh menjadi pelaku-pelaku kriminal yang tidak berperikemanusiaan dan tidak memiliki rasa belas kasihan pada setiap korbannya serta sulit untukdiperbaiki.Bahkanancamanhukuman yang terdapat dalam berbagai peraturan perundang-undangansertavonisyangdijatuhkandanreaksimasyarakatataskejahatan tidak pernah menyurutkan mereka melakukan perbuatanjahat.Seolahmerekaakan sakit jika tidak melakukan aksinya. Para penjahat yang defek moral biasanya disebabkan konstitusi disposisional dan perkembangan mental yang salah. Selain itu lingkungan juga dianggap sebagai faktor yang mendukung terjadinya defek moral, terutama lingkungan yang tidak memberikan iklim yang kondusif bagi tumbuh kembang anak. Penolakan keluarga danmasyarakatdapatmengakibatkananak mencari tempat dimana ia dapat diterima. Sangat disayangkan jika ia akan bertemu dengan lingkungan yang tidak bisa membentuk perkembangan mentalnya secara baik, maka anak akan mudah dipengaruhi hal-halyangburukdansifatnyasangategoistis. Mereka sering bertingkah agresif dan menjadikan individu lain yang berbeda denganmerekasebagaimusuhnya.Mereka akan tumbuh menjadi individu yang tidak memiliki rasa belas kasihan. Banyak para pelaku kejahatan yang sadis adalah bagian dari mereka yang mengalami defek moral. Setiap individu seharusnya menyadari bahwasanya keamanan, kenyamanan, ketentraman, kedamaian setiap individu lainnya adalah tanggungjawab bersama dalam masyarakat. Kesadaran itu pulalah yang semakin hari semakin menipis dalam diri individu. Keluarga dianggap sebagai faktor yang mendukung untuk menanggulangi anak-anak yang defek moral. Dalam sebuah keluarga seharusnya setiap individu memperoleh pendidikan mengenai pemahaman agama yang dapat menjadi bekal tidak hanya di dunia tetapi sampai ke akhirat. Keluarga memiliki perananpentinguntukmemberikanpemahaman betapa pentingnya sikap saling menghormati,salingtolongmenolong,sikapjujur, adil, menebar kasih sayang, serta menghargai hak milik orang lain. Peran terpenting tentunya ada pada orang tua. Orang tua hendaknya senantiasa memberikan jaminan penuh terhadapseluruhkebutuhanfisik, psikis, dan kebutuhan sosial anak, sehingga anak akan mengalami ketentraman, ketenangan,kenyamanandalamkehidupannya dan tidak berakibat kepada tumbuhnya defekmoralbagisianakyangtentunyaakan merusak anak sebagai generasi penerus bangsa. Penulis adalah Dosen Fakultas Hukum UMSU.

Menggugat Tanggung Jawab Pemimpin Oleh Sofyan Harahap Apa konsekuensi logis dari gagal dan amburadulnya UN serentak digelar, semestinya M. Nuh mundur dari jabatannya. Hidupkan budaya malu.Tidak perlu saling tuduh, antara Kemendikbud dengan pihak percetakan.


uar biasa tanggung jawab Pangdam IV Diponegoro Mayjen Hardiyono Saroso dan Komandan Jenderal Komando Pasukan Khusus (Kopassus) Mayor Jenderal Agus Sutomo. Keduanya tegas menyatakan siap bertanggung jawab atas penyerangan LP Cebongan, Sleman,Yogyakarta.Tidaksedikitpunterbersitkeduanya takut jabatannya bakal copot. WalaupadaakhirnyajabatanPangdam IV diserahterimakan, namun Mayjen Hardiyono Saroso tidak bersedih hati. Apalagi, suasana heroik dan emosional mewarnai serah terima jabatan Pangdam IV Diponegoro di Semarang, JawaTengah awal bulan lalu. Sang mantan Pangdam diberi‘’tondi’’ berupa keris dan dipanggul para prajurit anak buahnya. Dia pun menyatakan banggapada11 anggotaKopassusyangmenyerbu LP Cebongan, Yogyakarta. Sama halnya dengan Danjen Kopassus MayjenTNI Agus Sutomo. Dia bahkan menyatakansiapmenggantikan11anakbuahnya masuk penjara sebagai sikap / bentuk tanggung jawabnya. Dalam penyerangan yang merenggut empat nyawa yang disebut-sebut preman besar diYogyakarta, \\t “_blank” ke-11 pelaku adalah prajurit Kopassus Grup Dua, Kandang Menjangan, Sukoharjo Jawa Tengah. Hal serupa diucapkan Kapolda DIY Brigjen Polisi Sabar Rahardjo. Dia banyak dihujat publik karena memindahkan tahanan ke LP Cebongan. Kesannya ingin lepas tanggung jawab karena sudah mengetahui bakal terjadi penyerangan jika keempat tersangka pembunuh Serka Heru Santoso di Hugo’s Café ditahan di rumah tahanan polisi. Masalahnya, Kapolda Brigjen Polisi Sabar Rahardjo mengaku sempat berkomunikasi dengan Pangdam IV Diponegoro Mayjen Hardiyono Saroso pasca tewasnya Serka Heru Santoso. Namun ia membantahkomunikasimenyangkutadanya rencana penyerbuan ke Lapas Sleman. Hal tersebut dikatakan Sabar Rahardjo usai serah terima jabatan Kapolda DIY di Mabes Polri, Senin 8 April 2013. UN gagal KasuspenyerbuanLPCebongansudah memakan‘’duakorban’’pejabat,yaituPangdam dan Kapolda, sementara Danjen Kopassus siap menunggu giliran.Tampaknya tak lama lagi Mayjen Agus Sutomo bakal menyusul dicopot dari jabatannya, apalagi kalau dalam penyidikan tim independen dalamaksipenyerbuanLPCebonganterdapat unsur pelanggaran hak asasi manusia (HAM). Bagaimana dengan kasus gagalnya Ujian Nasional (UN)? Mestinya Menteri Pendidikan dan

Kebudayaan(Mendikbud)jugamengambil sikap serupa dengan mantan Pangdam Diponegoro, Kapolda DIY, dan Danjen Kopassus. Bukannya malah marah-marah karena terjadi keterlambatan cetak dan distribusi soal ke daerah-daerah. Apa konsekuensi logis dari gagal dan amburadulnya UN serentak digelar, semestinya M. Nuh mundur dari jabatannya. Hidupkan budaya malu.Tidak perlu saling tuduh, antara Kemendikbud dengan pihak percetakan. Pihak bercetakan tidak bisa disalahkan jika terjadi keterlambatan cetak gara-gara master soal dari Kemendikbud diberikan tidak sesuai jadwal (molor), namun mengherankan juga mengapa hanya di satu percetakan saja mengalami keterlambatan sedangkan di percetakan-percetakan lainnya bisa selesai tepat waktu. Itu sebabnya perlu dilakukan investigasi oleh tim yang benar-benart independen, melibatkan semua pihak yang terkait sehingga jelas siapa biang kerok yang membuat UN kacau-balau, penuh masalah, memalukan, dan merusak citra dunia pendidikan nasional. MemalukanUNsemakinsaratmasalah karena proyek ini sudah berlangsung lama, setiaptahunUNmenghabiskandanaratusan miliar rupiah, setiap tahun pula bermasalah, seperti kebocoran soal dan jual-beli kunci jawaban, pendongkrakan nilai, dan sekarang mengalami penundaan-penundaan di banyak daerah. Belum lagi efek negatif, seperti banyak siswa yang meminta doa pada orang-orang yang sudah tiada. Di seluruh Indonesia seharusnya UN berlangsung serentak Senin 15 April 2013. Tapi gagal di 11 provinsi dan kacau-balau di banyak provinsu lainnya, termasuk di Sumut. 11Provinsi yang gagal itu antara lain Kalimantan Selatan, Kalimantan Timur, Bali, Nusa Tenggara Barat, Nusa Tenggara Timur, Gorontalo, Sulawesi Utara, Sulawesi Selatan, Sulawesi Tengah, dan Sulawesi Barat. Di Sumut sendiri kondisinya sangat memprihatinkan. Sudah tahu bakal muncul masalah karena pendistribusian soal tidak merata di semua kabupaten-kota, bahkandi Medansaja banyaksekolahgagal mengadakan UN karena hal serupa, termasuk masalah berkas soal tertukar dll. Harusnya Gubsu segera turun tangan dengan memanggil semua pihak terkait, seperti Kanwil dan para Kadis serta kepala sekolah untuk membahas UN beberapa hari sebelum hari-H. Sehingga bisa diputuskan, apakah lebih baik menunda UN, atau tetap menyelenggarakannya dengan beberapa terobosan agar tidak terjadi masalah di lapangan. Perintah Gubsu H Gatot Pujo Nugroho

ke daerah-daerah untuk memfotokopi saja naskah soal bila terjadi kekurangan seharusnya ditindaklanjuti oleh para kadis dan kepala sekolah. Jika perintah Gubsu itu dijalankan maka tidak akan terjadi penundaan UN karena tidak sulit melakukan fotokopi soal asal dilakukan dengan benar. Artinya, mekanisme siapa yang mengawal harus jelas sehingga kerahasiaan dokumen negara tidak sampai bocor sebelum waktunya. Banyaknya sekolah yang gagal UN jelas berdampak besar bagi anak didik. Mereka tidakhanyakecewatapijugamembuyarkan konsentrasi dan kesiapan menghadapi hari menentukan itu. Sebab, percuma saja sekolah tiga tahun kalau dalam waktu singkat tiga hari UN gagal. Banyak siswa yang terguncang kejiwaannya sehingga saat UN ulangandilakukanpastitidakdalamkondisi fit. Nah,siapayangbertanggungjawabjika sampai banyak siswa yang gagal lulus UN nantinya?Sebab,UNditundabukankarena anak-anak SMU itu tak siap, tapi orang tua mereka yang salah, gagal menyiapkan soal ujiantepatwaktusehinggapemerintahtidak bisa lepas tangan. Pemanggilan Mendikbud M. Nuh ke Istana Negara menghadap Presiden SBY merupakan konsekuensi dari gagalnya UN tahun ini. Di sinilah Presiden harus tegas dalam memberi sanksi terhadap pembantunya yang tidak mampu menjalankan tugasnya dengan baik. Apalagi proyek UN ini sudah pernah diprotes para orang tua/ masyarakat, oleh para guru, bahkan sudah diputus oleh Mahkamah Agung untuk dihentikan. Nyatanya pemerintah tetap ngotot menyelenggarakan UN dengan hasil memalukan. Ini klimaks kegagalan UN. Justru itu, Presiden SBY harus berani meminta menterinya untuk mundur dari jabatan. Tidak hanya mundur, tapi menghentikan proyek UN sehingga menjadi UN terakhir karena memang manfaatnya sampai sekarang tidak jelas dan tidak dirasakan oleh dunia pendidikan, karena selalu menjadi‘’momok’’ bagi siswa walaupun aspirasi sekolah/guru sudah ditampung 40 persen nilai sekolah dan 60 persen nilai UN syarat kelulusan. Pemerataan dunia pendidikan tidak mampu dijalankan oleh Kemendikbud, sehingga tidak hanya antarprovinsi berbeda kualitasnya, tapi juga di dalam satu provinsi dan kabupaten-kota kualitas pendidikannya masih memprihatinkan. Penumpukan guru hanya di sekolah perkotaan dan sekolah-sekolah favorit, jumlahnya demikian banyak sehingga rebutan untuk mengajar, namun di sekolah luar kota jumlah gurunya sedikit. Bahkan di kawasan terisolir satu sekolah hanya punya 1-2 guru saja. Kondisi itu sudah berlangsung bertahun-tahun, sehingga UN yang deprogram bagus untuk memetakanpendidikandanmeningkatkan kualitas kelulusan tampaknya hanya dalam wacana belaka, sedangkan implementasinya nol besar. Penutup Kementerian Pendidikan dan Kebuda-

yaan (Kemendikbud) harus bertanggung jawab.Bentuknya,bisamundurdandimundurkan. Harus ada sanksi sebagai risiko pemimpin gagal, seperti ditunjukkan pimpinan kasus LP Cebongan. Namun aparat penyidik termasuk dari KPK harus turun tangan karena amburadulnya UN tahun ini berbau KKN tender cetakan. TidakcukuphanyamengakuUNtahun ini gagal, tapi harus ada evaluasi jujur untuk memutuskan UN tidak layak diselenggarakan lagi tahun depan. Idenya saja bagus namunlemahdalamimplementasisehingga perlu diganti dengan peningkatan kualitas guru dan infrastruktur pendidikan, terutamadikawasanterpencil.UNbisadiganti dengan EBTA dan EBTANAS asal dilakukan dengan jujur! Jika terbukti gagalnya UN serentak dan sarat menimbulkan masalah terkait pencetakan soal yang dimonopoli pusat, sebaiknya daerah-daerah diberi kewenangan melakukan pencetakan soal termasuk kebutuhan pemilu/pilkada/pilpres sehingga pendistribusian naskah tidak terulang lagi di masa mendatang.*** Penulis adalah Wapenjab Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * KPU siapkan pelantikan Gatot-Erry - Terasa semakin lama hari berganti, he...he...he * Solidaritas antar anggota KORPRI masih rendah - Masing-masing cari jalan sendiri * Dinas Pertamanan tertibkan 150 papan reklame - Asal jangan tertib sementara


D Wak

Ekonomi & Bisnis APBD Sumut Tahun 2012 Tidak Sehat


WASPADA Jumat, 19 April 2013

MEDAN (Waspada): DPRD Sumatera Utara menilai struktur Anggaran Pendapatan dan Belanja Daerah (APBD) Sumut tahun 2012 tidak sehat. Karena belanja tidak langsung lebih besar dari belanja langsung. Penilaian tentang struktur APBD tahun 2012 itu disampaikan Rauddin Purba, pada rapat paripurna DPRD Sumut, Kamis (18/4). Raudin Purba, merupakan Ketua Panitia Khusus (Pansus) DPRD Sumut tentang pembahasan Laporan Keterangan Pertanggungjawaban Gubsu akhir tahun anggaran 2012. Pada rapat paripurna dipimpin Ketua DPRD H.Saleh Bangun itu, Rauddin Purba, menyebutkan APBD Sumut tahun 2012 sejumlah Rp7,6 triliun lebih. Dari dana itu 67,22 persen diperuntukkan bagi

belanja tidak langsung. Sedangkan untuk belanja langsung hanya dianggarkan 32,78 persen. Kata Rauddin Purba, struktur APBD seperti ini bukan saja tidak sehat, tapi juga dipastikan tidak dapat menjangkau masyarakat Sumut secara signifikan. Untuk itu Pansus merekomendasikan agar Pemprovsu pada tahun-tahun mendatang lebih memprioritaskan anggaran pada belanja langsung. Dengan begitu dana APBD secara langsung dapat bersentuhan dengan masyarakat. Selain menyoroti tentang struktur APBD, Pansus DPRD Sumut juga mengkritisi kinerja Dinas Pendapatan (Dispenda) yang tidak berhasil mencapai target penerimaan pajak. Disebutkan Rauddin Purbam realisasi pendapatan yang sebagian besar tidak mencapai target bukan karena target terlalu tinggi, tapi karena kinerja rendah dan kebocoran yang terlalu tinggi. Untuk mengatasi persoalan ini, Pansus merekomendasikan kepada D ispenda untuk melakukan program peningkatan pendapatan dari sisi

selama ini tidak tersentuh oleh pemeriksa (Inspektorat). Sedangkan untuk meminimalkan kebocoran pada sisi retribusi perizinan, direkomendasikan agar Pemprovsu memberdayakan seluruh pengurusan perizinan yang selama ini berada di berbagai SKPD teknis untuk dilimpahkan secara keseluruhan ke Badan Pelayanan Perizinan Terpadu (BPPT). Tidak penting Sementara itu Fraksi Partai Amanat Nasional (FPAN) menilai, pada tahun 2012 Gubsu tidak melakukan pembangunan dengan baik. Pada tahun itu infrastruktur pemerintahan diarahkan untuk persiapan dan pemenangan Pilgubsu 2013. Akibatnya agenda pembangunan menjadi dianggap tidak penting. Disebutkan juru bicara FPAN Irwansyah Damanik, kepemimpinan pemerintahan di Sumut periode 2008-2013 ditandai oleh ketidakstabilan politik. Diantaranya peragaan ketidakharmonisan gubernur dan wakil gubernur yang disusul oleh permasalahan hukum

Buruh Tolak Kenaikan Harga BBM Biaya Operasional Hotel Terpengaruh MEDAN (Waspada): Para buruh yang tergabung dalam Konfederasi Serikat Pekerja Indonesia (KSPI) dan Majelis Pekerja Buruh Indonesia Sumatera Utara (MPBISU) menolak rencana kenaikan harga bahan bakar minyak (BBM) bersubsidi. Alasannya, karena pasti akan berpengaruh pada kenaikan ongkos transportasi. Ketua KSPI Sumut Minggu Saragih, kemarin, mengatakan sikap itu dikeluarkannya sehubungan dengan instruksi dari Presiden KSPI Said Iqbal. Katanya, walaupun kenaikan BBM hanya Rp500-Rp1.000/liter, tapi akan berpengaruh pada kenaikan ongkos transportasi sebesar Rp30.000/bulan. Selain itu, katanya, kenaikan harga BBM bersubsidi ini juga akan mempengaruhi mahalnya biaya bahan makanan yang membuat buruh semakin terjepit. Untuk itu, pihaknya sedang berencana untuk melakukan aksi menentang kenaikan harga BBM dan pemberian BLT bagi rakyat miskin. “KSPI akan melakukan aksi penolakan di seluruh indonesia termasuk di Sumut bersama mahasiswa dan elemen gerakan sosial lainnya menentang rencana kenaikan BBM dan pemberian BLT,” ujarnya. Biaya hotel Sementara itu, kenaikan harga BBM juga diyakini akan mempengaruhi biaya operasional hotel. Dengan begitu otomatis berdampak pada tarif harga kamar dan convention di hotel tersebut. General Manager Grand Aston City Hall Medan, Wahyono, mengatakan kenaikan harga BBM ditambah lagi dengan kenaikan tarif dasar

listrik (TDL), jelas sangat mempengaruhi biaya operasional hotel. ‘’Dengan kenaikan tersebut, kami akan menyesuaikan biaya operasional dengan besarnya persentase harga BBM. Semua orang sudah tahu, bila BBM naik maka harga beberapa kebutuhan pokok pun ikut naik,” katanya. Dia menjelaskan, naiknya harga BBM akan menyebabkan naiknya biaya operasional hotel sebesar 20 persen. Seperti diketahui, katanya, pemerintah merencanakan menaikkan harga BBM untuk kendaraan pribadi atau berplat hitam dari Rp4.500 ke Rp6.500 hingga Rp7.000 atau naik sebesar 30 persen. Wahyono, mengatakan untuk mengantisipasi naiknya harga BBM tersebut, Grand Aston Hotel Medan berencana menyesuaikan tarif kamar yang disesuaikan dengan potensi kamar itu sendiri dan dia yakin bahwa setiap hotel akan memberlakukan hal yang sama. Namun demikian, agar masyarakat tidak bingung, pihaknya akan mengedukasi masyarakat terlebih dahulu. Dia menambahkan, seperti biasanya sebelum menaikkan tarif harga kamar, pihaknya akan melakukan pemberitahuan awal. “Selambat-lambatnya, dua bulan sebelum menaikkan tarif harga kamar, kami akan pemberitahuan awal terlebih dahulu lewat brosur dan semacamnya. Hal tersebut bertujuan agar masyarakat tidak terkejut,” ungkapnya. Menurutnya, naiknya tarif harga kamar juga memungkinkan akan mempengaruhi jumlah occupancy hotel. “Bisa jadi occupancy hotel juga menurun,

namun kemungkinan penurunannya tidak terlalu besar,” ujarnya. Sementara itu, Public Relation Manager Hotel Santika Medan Gledy Simanjuntak, mengatakan kenaikan harga BBM tidak mempengaruhi tarif harga kamar. Namun membuat tarif convention hotel berbintang empat tersebut naik. Pengaruh lainnya adalah membuat hotel ini mengefisiensikan seluruh penggunaan listrik. Sebab, seiring dengan adanya perbaikan pembangkit tenaga listrik di Sumut membuat Hotel Santika merubah fungsi gensetnya tidak lagi sebagai back up ketika listrik padam namun berubah menjadi fungsi utama yakni sebagai sumber utama tenaga listrik di hotel itu. “Kami memiliki dua genset dengan tenaga yang besar. Salah satunya digunakan untuk sumber utama tenaga listrik di hotel ini. Otomatis menggunakan BBM yang banyak,” paparnya. Selain itu, dengan naiknya harga BBM, pihaknya tidak menaikkan harga kamar namun menaikkan harga convention. Karena convention menggunakan chiller atau alat pendingin yang besar. Seperri diketahui, alat pendingin mengonsumsi tenaga listrik yang besar ketimbang lampu penerangan. “Kami menaikkan harga tarif convention kurang dari 5 persen dan harga kamar tidak kami naikkan. Sebab, convention menggunakan alat pendingin yang besar. Alat pendingin itu mengkonsumsi 60 persen dari total tenaga listrik di hotel,” ungkapnya. (m41)

Pekerja Wajib Jadi Peserta Jamsostek M E D A N ( Wa s p a d a ) : Pekerja yang berisiko tinggi mengalami kecelakaan kerja wajib mendapatkan perlindungan melalui program jaminan sosial tenaga kerja (Jamsostek). Perusahaan dapat dikenakan sanksi jika tidak mendaftarkan pekerjanya. Hal itu diungkapkan Kepala Jamsostek Cabang Belawan Panji Wibisana, terkait dengan hasil pertemuan dan perundingan antara karyawan PT Surya Cemerlang Meubelindo (SCM), Jl. Sampali No. 91 Percut Sei Tuan di Medan, Kamis (18/ 4). Katanya, benar bahwa PT SCM telah mendaftarkan karyawannya ke Jamsostek, namun hanya 29 orang dari 90 orang jumlah karyawan perusahaan itu. Pihaknya berharap seluruh karyawan perusahaan itu mendapat perlindungan jaminan sosial. Dia mengatakan bahwa perusahaan yang tidak mendaftarkan karyawannya dapat dikenakan sanksi berupa pidana

dan perdata dengan denda Rp50 juta sesuai dengan aturan UU No. 3 Tahun 1992 pasal 29 ayat 1 dan 2. ‘’Namun dalam hal ini kita masih melakukan persuasif bagi pengusaha yang belum mendaftarkan pekerjanya,” lanjutnya. Begitupun, lanjutnya, untuk menertibkan perusahaan yang dengan sengaja tidak mendaftarkan karyawan atau pekerjanya ke Jamsostek maka dalam waktu dekat manajemen akan melakukan kerjasama dengan pihak kejaksaan tinggi dan kejaksaan negeri. Kabid Pemasaran Jamsostek Cabang Belawan Normansyah, menyatakan hasil pertemuan antara karyawan dengan pimpinan PT SCM dihadiri oleh Pimpinan Perusahaan Herman, Wakapolsek Percut Sei Tuan AKP Suharto, Korda FSB Kikes SBSI Sumut Usaha Tarigan, Kabid Pengawasan Tenaga Kerja Delisedang Naibaho, seluruh pekerja dan aparat desa. “Dalam perundingan ters eb ut d i h a si l k a n b a h w a

kepesertaan progam jamsostek akan dilakukan secara bertahap, gaji akan dilaksanakan sesuai UMP, untuk buruh wanita dilakukan observasi terhadap situasi dan kondisi perusahaan, dan kemudian dilanjutkan hakhak normatif buruh, selanjutnya bila dilanggar oleh perusahaan maka ditingkatkan ke dinas tenaga kerja,” ujarnya. Pada dasarnya, lanjut Normansyah PT Jamsostek tidak pernah membedakan apakah karyawan, buruh harian tetap, lepas karena sama-sama memiliki resiko tinggi terjadinya kecelakaan kerja dalam hal ini pengusaha wajib mendaftarkan atau mengikutsertakan ke jaminan sosial. Jamsostek berharap agar pengusaha yang memiliki karyawannya dapat mendaftarkan segera pekerjanya. “Kita berharap jangan sampai aturan dari UU No. 3 Tahun 1992 tersebut mempersulit pengusaha atau perusahaan,” ujarnya kembali. (m38)

yang menyebabkan gubernur tidak dapat melaksanakan tugasnya hingga akhir periode. Selanjutnya, menurut FPAN, kepemimpinan yang dilanjutkan oleh wakil gubernur sebagai pelaksana tugas lebih diwarnai oleh aromo politik penguasaan infrastruktur pemerintahan untuk persiapan dan pemenangan Pilgubsu 2013. Pada waktu itu, kata Irwansyah Damanak, terjadi perombakan personal pemerintahan yang tidak berbasis merit system. Kemudian munculnya pemerintahan bayangan (shadow state) dan politisasi semua kebijakan, terutama dalam politik anggaran yang sangat menelantarkan kepentingan rakyat. ‘’Ke depan, semoga kita dapat memetik pelajaran berharga dari kesalahan ini,’’ kata Irwansyah Damanik. (m12)

Waspada / Rusli Ismail

SEJUML AH petani saat menumpuk padi mereka yang baru dipotong di areal persawahan, menunggu giliran untuk dirontokkan dengan menggunakan mesin perontok.

Panen Perdana Di Bireuen BIREUEN (Waspada): PT Pupuk Iskandar Muda (PIM) Lhokseumawe bekerjasama dengan CV Tufah Mandiri, Balai Penyuluhan Pertanian Perikanan dan Kehutanan (BP3K), dan petani Desa Pulo Lawang, melakukan panen perdana padi varitas unggul, di Bireuen, Kamis (18/4). Padi demplot swakelola mandiri yang ditanam di lahan setengah hektare tersebut berada di Desa Pulo Lawang, Kec. Jeumpa, menggunakan bibit Ceherang produksi PT Sanghiyang Sri Label Ungu merupakan program percontohan untuk petani di sana. “Padi yang kita penen hari ini adalah varitas unggul dengan pola pemupukan seimbang.Yaitu dengan sistem 5:3:2 dan hasilnya mencapai sekitar 9,6 ton per hektare, sistemnya swakelola atau Yarmen biayanya dibayar setelah panen,” kata Wakil Direktur CV Tufah Mandiri Ami, usai melakukan panen perdana. Didampingi Bagian Pengembangan Pasar PT Pupuk Iskandar Muda (PT PIM), Dun Dayang, Ami mengatakan, padi yang baru saja dipanen merupakan penanaman padi di lahan milik petani Baginda, telah terbukti hasilnya. (cb02)

Dispendasu Bantu Kendaraan Dinas Poldasu MEDAN (Waspada): Dinas Pendapatan Sumut (Dispendasu) melaksanakan acara serah terima pemakaian sementara dua unit kenderaan dinas roda empat 4 kepada Dirlantas Poldasu. Tempatnya di lapangan Merdeka, Sabtu (13/4). Kepala Unit Pelayanan Teknis (UPT) Penyuluhan Dispendasu Syahrul Irwan Nasution, melalui siaran persnya, Kamis (18/4), menyebutkan Kadispendasu Rajali, akan menyerahkan langsung dua kenderaan dinas roda empat tersebut kepada Dirlantas Poldasu Kombes M. Arkan Hamzah dan Kasubdit Regident Ditlantas Poldasu AKBP Dwi Asmor. Kendaraan yang diserahkan berupa Minibus New Avanza 1,3 E M/T tahun 2013. Dalam berita acara serah terima pemakaian sementara kenderaan dinas tersebut dijelaskan bahwa dengan ditandatanganinya berita acara tersebut, apabila terjadi kehilangan dan segala biaya perawatan dan pemeliharaan barang menjadi tanggungjawab pihak kedua. Kadispendasu H.Rajali, mengharapkan kepada Dirlantas Poldasu dan Kasubdit Regident Ditlantas Poldasu dapat mempergunakan kenderaan tersebut untuk kegiatan dinas, selain dapat menjaga dan merawat asset milik Pemprovsu. ‘’Semoga kerjasama yang baik ini dapat terus dipertahankan, bahkan ditingkatkan dimasa-masa mendatang dalam upaya pengabdian dan layanan terhadap masyarakat Sumatera Utara,’’ kata Rajali.(m24)

Investasi Asing Ke China Naik BEIJING (Antara/AFP): Investasi asing langsung (FDI) di China naik sedikit pada kuartal pertama. Pemerintah mengumumkan pada Kamis (18/4), dipimpin oleh perusahaan-perusahaan Jepang, Uni Eropa dan AS setelah turun tahun lalu. FDI yang masuk, tidak termasuk sektor keuangan, naik 1,4 persen dari Januari sampai Maret menjadi 29,9 miliar dolar AS, kata Kementerian Perdagangan. FDI juga naik 5,65 persen menjadi 12,4 miliar dolar AS pada Maret, naik untuk kedua bulan berturutturut. FDI jatuh pada 2012 untuk pertama kalinya dalam tiga tahun, karena ketidakpastian ekonomi global didorong oleh krisis utang Eropa, perlambatan dalam negeri dan ketegangan politik regional. Meskipun sengketa wilayah dengan Jepang sedang berlangsung, investasi dari negara Sakura itu naik 10,5 persen menjadi 2,29 miliar dolar AS pada tiga bulan pertama. Sementara itu, investasi dari Uni Eropa naik 45 persen menjadi 2,05 miliar dolar AS, sedangkan dari Amerika Serikat naik 18,5 persen menjadi 1,06 miliar dolar AS. “Kami pikir, secara umum, FDI telah mempertahankan tren pertumbuhan yang stabil,” kata juru bicara Kementerian Perdagangan Shen Danyang. Kementerian juga mengumumkan bahwa investasi sektor non-keuangan China di luar negeri melonjak 44 persen tahunke-tahun pada kuartal pertama menjadi 23,8 miliar dolar AS. Investasi ke AS meningkat lebih dari dua kali lipat pada kuartal pertama tahun ini, sementara ke 10 negara anggota ASEAN melonjak 99 persen, kata kementerian. Angka-angka investasi itu datang setelah data minggu ini menunjukkan ekonomi China tumbuh 7,7 persen pada JanuariMaret, lebih lambat dari tiga bulan sebelumnya. Perekonomian China tumbuh dengan kecepatan yang paling lambat dalam 13 tahun terakhir pada 2012, berkembang 7,8 persen dari tahun sebelumnya.

Buruh Mulai Konvoi Jelang May Day TANGGERANG (Antara): Melakukan sosialisasi peringatan Hari Buruh (May Day), ratusan buruh di Tangerang, Banten, melakukan konvoi menggunakan sepeda motor, Kamis (18/4). Para buruh yang berasal dari berbagai aliansi berkumpul di Kawasan Industri Bojong, Karawaci. Setelah berkumpul, para buruh selanjutnya menyisir setiap kawasan industri di Kota Tangerang dan melakukan aksi orasi. Mereka juga membagikan selebaran untuk ikut serta dalam Hari Buruh 1 Mei. Beberapa titik yang menjadi aksi konvoi buruh, yakni di Tanah Merah Batu Ceper, Jalan Yos Sudarso, Jalan Garuda, Jalan Pembangunan 1 dan 2, Jalan Lio Baru, Jalan Agus Salim, kawasan pusat Pemko Tangerang, Pintu Air 10, Kawasan Benua, Jalan M. Thoha Sangiang Jaya lalu berakhir di kantor Disnaker Kota Tangerang. Ketua Persatuan Buruh Independen Kota Tangerang Tubagus Heri, mengatakan masih banyak permasalahan buruh yang belum diselesaikan pemerintah. Seperti sistem kerja kontrak dan upah murah. Meski sudah ada aturan yang dibuat agar buruh mendapatkan hak layak, namun masih banyak pengusaha yang tidak menurutinya.

Panen Raya, Harga Gabah Turun MEUREUDU (Waspada) : Petani di Kab. Pidie Jaya dan Pidie yang pada dua pekan terakhir sedang melakukan panen raya mengeluhkan harga Gabah Kering Panen (GKP) mengalami penurunan. Harga penjualan GKP ke agen hanya Rp3.800 hingga Rp4.000 per kg. Kepada Waspada, Kamis (18/4), para petani menyebutkan harga gabah tersebut dinilai petani tidak berpihak dan tidak membantu mereka. Bahkan merugikan petani. Sebelum panen hingga awal panen harga gabah Rp4.500 hingga Rp4.700 per kg. Bahkan pernah mencapai Rp5.000 per kg. Sementara harga Gabah Kering Giling (GKG) saat ini dihargai Rp4.200 per kg. Sebelumnya GKG Rp4.800 sampai Rp5.000 per kg. ‘’Kami kurang mengerti apa penyebab merosotnya harga gabah ini. Apalagi kalau baru turun hujan, harga gabah semakin anjlok lagi,’’ kata salah seorang petani bernama Syukri. Petani lainnya M.Yusuf, mengatakan bakal tidak mendapat apa-apa dari panen kali ini. Karena harga gabah sudah tidak sesuai lagi dengan biaya produksi dikeluarkan petani sejak mulai pengolahan lahan, perawatan hingga panen dilakukan. Dikatakan Yusuf, petani menjual padinya karena terpaksa untuk menutupi biaya

kebutuhan keluarga sehari-hari. Bukan hanya itu, petani juga saat perawatan tanaman padinya sudah berutang untuk beli pupuk dan obatobatan. Ilyas, petani lainnya menambahkan, untuk sementara waktu ia tidak akan menjual padi yang baru dipanen itu, karena harga yang ditawarkan agen penampung dan para tengkulak sangat rendah. Bila dibandingkan dengan modal yang telah dikeluarkannya, mulai dari proses pengolahan lahan, penanaman bibit, pupuk sampai biaya pemotongan dan pengangkutan hasil panen telah dikeluarkan sangat besar sehingga tidak sebanding dengan hasil atau pendapatannya. “Padi untuk sementara saya simpan dulu sambil menunggu harga jualnya naik. Apabila semua petani tidak menjual hasil gabahnya, pasti nilai jualnya akan meningkat. Karena itu saya memilih menyimpannya dulu padi, “kata Ilyas. Sekretaris Koperasi Unit Desa (KUD) Meurah Jaya, di Meureudu, Pidie Jaya, Bahrum Hanafiah, yang juga mengelola kilang padi, menjelaskan pihaknya menerima harga beli gabah dengan harga Rp4.000 sampai Rp4.100 per kg. Harga itu menjadi patokan pihaknya sementara ini, karena nilai beli beras yang diterima Dolog saat ini Rp6.500 per kg.(b09)

Pemda Diminta Perkuat Lembaga PTPS MEDAN (Waspada): Pemerintah Daerah di Sumut diminta segera menggagas lahirnya Peraturan Daerah (Perda) untuk menguatkan peran lembaga Pelayanan Terpadu Satu Pintu (PTSP) di seluruh kabupaten/kota. Staf pengajar Fakultas Hukum USU DR Hasyim Purba, mengatakan itu pada acara Forum Penyelenggaraan PTSP di Hotel Toledo, Samosir, Kamis (18/4). Dari data Badan Pelayanan Perijinan Terpadu Sumut, hingga tahun 2013, telah terbentuk 33 lembaga PTSP di seluruh kabupaten/kota di Sumut. Ada daerah yang payung hukum pembentukan PTSP nya berupa Keputusan Kepala Daerah, dan ada yang telah berupa Peraturan Daerah. Kepala Badan Pelayanan Perizinan Terpadu Provinsi Sumut Ferlin Nainggolan, di acara yang sama menjelaskan hampir 40 persen PTSP di kabupaten/kota masih memerlukan peningkatan dasar hukum kelembagan PTSP. Yakni dari Keputusan Kepala Daerah harus ditingkatkan menjadi Perda. Seperti di Kab. Labuhanbatu, Serdang Bedagai, Nias Utara, dan Nias Barat. Menurut Ferlin, masalah lain yang mengemuka dalam pertemuan Forum PTSP se Sumut adalah persoalan pendelegasian kewenangan perijinan dan non perijinan di satu daerah. “Masih banyak pengurusan dokumen perijinan dan non perijinan yang dikerjakan di SKPD lain.

Padahal itu sudah sudah diamanatkan oleh Kemendagri melalui surat edaran tertanggal 9 Agustus 2012 yang ditujukan kepada kepala daerah/ provinsi dan kab/kota se Indonesia”, ujar Ferlin. Kepala Seksi Investasi Dirjen Bina Bangda Kementrian Dalam Negeri Alwin Ferry, dalam kesempatan yang sama menambahkan, pada dasarnya pembentukan PTSP adalah untuk sektor UMKM. Karena 90 persen usaha di Indonesia adalah UMKM. Sesuai Permendagri 20 tahun 2008 tentang pembentukan kantor PTSP, lembaga ini didorong untuk memajukan iklim investasi di daerah dan pemberantasan korupsi di daerah. Pernyataan Ferry juga diakui oleh guru besar Fakultas E konomi USU Prof Dr Ritha Dalimunthe, SE yang menyebut 90 persen UKM itu membutuhkan ijin usaha. Diharapkan forum PTSP ini mampu mengeluarkan rekomendasi bahwa PTSP merupakan priority pembangunan di SUMUT. Perijinan yang sulit membuat investor sulit berinvestasi di SUMUT, sehingga dengan ada nya PTSP diharapkan seluruh kab/kota berkomitmen untuk meningkatkan iklim investasi di SUMUT lewat perijinan. “Delegasikan semua perijinan ke lembaga PTSP diseluruh kabupaten/kota di SUMUT”, ujarnya disela acara Forum Pelayanan Terpadu Satu Pintu tersebut. (m14)

Kemudahan Kredit Alternatif Peningkatan Produksi JAKARTA (Antara): Direktur Eksekutif Kebijakan Moneter Bank Indonesia (BI) Dodi Budi Waluyo, mengatakan pemberian kemudahan kredit bagi petani merupakan salah satu alternatif untuk meningkatkan produksi dan mengantisipasi fluktuasi harga pangan. “Kita berikan semacam wacana kepada petani untuk memudahkan mereka mendapatkan kredit dengan mengagunkan aset yg dia punya,”kata Dodi usai menjadi pembicara dalam paparan hasil survei Komisi Sosial dan Ekonomi PBB untuk Asia Pasifik (UN ESCAP) di Jakarta, Kamis (18/4). Dodi, mengatakan salah satu bentuk kemudahan tersebut misalnya kredit resi gudang. Resi gudang adalah kredit modal kerja dengan jaminan resi gudang, sumber pengembalian kredit dari hasil penjualan barang yang ada di gudang.

Resi Gudang sendiri adalah dokumen bukti kepemilikan atas barang yang disimpan di gudang yang diterbitkan oleh pengelola gudang. Sedangkan komoditas yang disimpan di gudang adalah gabah, beras, jagung, kopi, kakao, lada, karet, rumput laut dan rotan. “Jadi itu (resi gudang) akan dieksplore sebagai bagian pemberian kemudahan bagi petani untuk mendapat kredit,” ujar Dodi. Mengenai implementasinya, Dodi mengatakan hal tersebut masih dalam pembahasan serius dengan pemerintah. Selain kemudahan kredit, lanjtu Dodi, pemberian asuransi bagi industri pertanian juga dipandang perlu untuk dilakukan. “Kita bisa juga melihat pentingnya asuransi bagi industri pertanian, ini masih terus dalam koordinasi kami dengan pemerintah,” katanya.

Biaya Pengendalian Inflasi Tinggi JAKARTA (Antara): Kamar Dagang dan Industri (Kadin) Indonesia menyoroti tingginya biaya pengendalian laju inflasi yang dilakukan oleh pihak Bank Indonesia (BI) sepanjang tahun 2012. Permasalahan dalam kebijakan moneter antara lain, tingginya biaya pengendalian laju inflasi tahun lalu yang mencapai 4,3 persen. Wakil Ketua Umum Kadin Indonesia Bidang Kebijakan Moneter, Fiskal dan Publik Haryadi B. Sukamdani, mengatakan itu dalam keterangan tertulis yang diterima di Jakarta, Kamis (18/ 4). Menurut Haryadi, hal tersebut perlu disorot karena BI dinilai diuntungkan oleh pelemahan kurs rupiah yang tajam terhadap dolar AS, sehingga membantu potensi sumbangan inflasi dari segi impor. Ia berpendapat, jika BI berkehendak men-

dorong penguatan kurs rupiah melalui intervensi, maka permintaan barang impor akan semakin membesar yang berdampak pula kepada tertekannya ekspor. ‘’Tapi bank sentral terkesan masih membiarkan kurs rupiah melemah untuk menahan laju impor,’’ ucapnya. Terkait pengendalian inflasi, Kadin mengharapkan agar inflasi dapat terkendali di bawah 5 persen untuk tahun 2013. Inflasi yang rendah, ujar dia, akan memberikan manfaat dan keuntungan lebih besar secara makroekonomi lantaran sektor perbankan dan dunia usaha akan dapat bergerak lebih cepat. Adapun permasalahan lainnya yang disorot Kadin dalam kebijakan moneter adalah terkait tingkat bunga pinjaman bank yang masih tinggi, sehingga menyulitkan pengusaha untuk mengembangkan usahanya.


B8 07.00 Dahsyat 09.00 Sinema Pagi 11.00 Intens 12.00 Seputar Indonesia 12.30 X Factor Indonesia 15.30 Cek And Ricek 16.00 Silet 16.30 Seputar Indonesia 17.00 Yang Muda Yang Bercinta 18.30 Cinta 7 Susun 19.30 Layar Drama : Tukang Bubur Naik Haji 21.15XFactorIndonesia


09:00 Liputan 6 Terkini 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 14.00 Liputan 6 Terkini 14.30 SL Eat Bulaga Indonesia 16.03 Eat Bulaga Indonesia 17.30 Liputan 6 Petang 18.00 Si Biang Kerok Cilik 19.15 Haji Medit 21.15 Ustad Fotocopy 22.30 Liputan 6 Terkini 22.30 SCTV FTV Utama 00.00 Liputan 6 Malam

07.00 Upin Ipin 07.30 Serial Pilihan 08.00 Pose 09.00 Kisah Unggulan 11.00 Kribo 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 16.00 Lintas Petang 16.30 Animasi Spesial 18.00 Sepatu Super 19.00 Tendangan Si Madun 3 20.30 Raden Kian Santang 22.00 Gara Gara Dia 23.00 Cerita Pilihan 00.00 Premier Preview 00:30 Obat Malam

07.30 Fenomania 08.00 Selebrity Punya Story 08.30 Seleb @ Seleb 09:00 Klik! 10:00 Siapa Takut 11:30 Topik Siang 12:00 Wooow 13:00 Bule Ngefans 13.30 Lulu Vroumette Aka Zipadoo 14:00 Tom & Jerry 14.30 Panda Fanfare Aka Kungfu Panda 15.00 Tom & Jerry 16.00 Mr Bean 16.30 Topik Petang 17.00 Coboy Junior 18:00 Pesbukers 19:30 Al El Dul 20:30 Sinema Malam 22:30 Dokumenter 23.30 Dokumenter

07.00 Halo Polisi 07.30 KiSS Pagi 08:00 Kuis Pagi Pagi Bagi Bagi 09.30 Sinema TV SPesial 10:30 Film TV 11:30 Patroli 12:00 Sinema Pintu Taubat 14.30 Hot KISS 15.30 Fokus 16.00 Drama Korea : Rooftop Frince 17.00 Drama Seri Indonesia : 18:00 Drama Seri Indonesia :Tebe Dan Kakak Cantik 19.00 Drama Seri Keluarga :Hati-Hati Dengan Hati 20:00 Take Me Out Season 2 22:00 Sinema Unggulan 23.00 Keteguhan Hati

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Special Program 11.00 Headline News 11.30 Metro Siang 12.05 Metro Siang 13.05 Wideshot 13.05 Wideshot 14.00 Headline News 15.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Eadle Documentary 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Jumat 19 April 2013

07:30 New Rangking 1 08.30 Bagi Bagi Berkah 09.00 Mozaik Islam 09.30 New Peppy The Explorer 10.00 Milik Indonesia 10:30 Reportase Siang 11.00 Insert Siang 12:00 Bioskop Indonesia 14:00 Sketsa 15:15 Show Imah 16:30 Reportase Sore 17:00 Insert Investigasi 18:00 Super Trap 19:00 Oh Ternyata 20.00 Bioskop TransTV Spesial 22.00 Bioskop TransTV 00.00 Bioskop TransTV

06:30 Apa Kabar Indonesia Pagi 09:30 Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Live News Kabar Pasar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 23:00 Kabar Arena

08.00 The Penguins Of Madagascar 08.30 Film TV 10:00 Obsesi 11.00 Buletin Indonesia Siang 12.00 Namaku Mentari 14:00 100 % Ampuh 15.30 Top Banget 16:00 Fokus Selebriti 16:30 Arjuna 17:00 Si Kriwil 18.00 Big Movies 20.00 Big Movies 22:00 Big Movies

07.30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09.00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang Jalan Jalan 13:30 Dunia Binatang 14.00 Wollipop 15.00 Bara Supercook 15:30 Jejak Si Gundul 16:00 Redaksi Sore 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23.30 Dua Dunia 00.00 Wisata Malam 00.30 Sport 7 Malam **m31/G

Steven Tyler Aerosmith Peroleh Anugerah Pencipta Lagu Setelah 40 tahun menjadi salah satu band rock terbesar Amerika Serikat, pentolan Aerosmith Steven Tyler dan gitarisnya Joe Perry akhirnya mendapat penghargaan untuk lagulagu yang mereka ciptakan. Duo dijuluki Toxic Twins karena gemar mengonsumsi narkoba itu menulis banyak lagu Aerosmith menjadi hit sepertiWa-

lk This Way dan Back in the Saddle yang melesatkan Aerosmith ke puncak popularitas pada pertengahan 1970-an. Setelah memenangkan banyak Grammy dan anugerah lainnya, Tyler dan Perry akan mendapat penghargaan dari American Society of Composers, Authors and Publishers (ASCAP) untuk lagu karya mereka. Mere-

ka juga akan dimasukkan ke Hall of Fame Penulis Lagu pada 13 Juni. Namun keduanya tak bisa menghadiri penghargaan ASCAP karena tengah berada di Australia dalam rangka tur musik Global Warming. Kepada Reuters, duo maut ini mengaku saling menginspirasi kendati agak berbeda antara

era 1970-an dan 1980-an mengingat keduanya tak bisa mencipta lagu-lagu hit karena berada di bawah pengaruh narkoba. “Mengonsumsi narkoba bisa menjadi jalan pintas menuju tempat kreativitas, tetapi akhirnya akan membunuhmu,” kata Perry. Sementara Steven Tyler menulis 17 lagu termasuk hit Dream On berkata, “Kami semua

bareng-bareng di satu ruangan dan saling menginspirasi.” Ditanya mengenai berubahnya metode dia dalam menulis lagu selama beberapa tahun ini, mantan juri American Idol itu mengatakan bahwa dia kini mencipta lagu dengan bantuan ponsel pintar. “Saya selalu mempunyai satu studio, namanya iPhone,” kata Perry seperti dikutip Reuters.(ant)

Pecandu Alkohol Dan Narkoba, Ozzy Osbourne Minta Maaf

Ozzy Osbourne/

Penyanyi band Black Sabbath, Ozzy Osbourne meminta maaf atas perilakunya menjadi peminum alkohol dan pecandu narkoba dalam 1,5 tahun terakhir. Dia juga menegaskan tidak bercerai dengan sang istri, Sharon. Penyanyi Inggris itu menulis permohonan maaf tersebut di Facebook menanggapi spekulasi media massa mengenai status pernikahannya dengan Sharon sudah berlangsung selama 30 tahun. Mereka sudah tak satu rumah. “Harap ingat, Sharon dan saya tidak bercerai,” tulis Osbourne,64 di halaman facebo-

oknya. “Saya hanya sedang berusaha menjadi orang yang lebih baik.” Ia mengatakan telah menjadi peminum dan pecandu narkoba selama satu setengah tahun terakhir dan berada di tempat yang sangat gelap tetapi sudah berhenti selama 44 hari ini. Osbourne terkenal sebagai penyanyi utama kelompok heavy metal Black Sabbath sudah seringkali berujar tentang perjuangannya melawan kecanduan alkohol dan narkoba serta beberapakali menghabiskan waktu di klinik rehabilitasi. “Saya ingin meminta maaf

bagus,” kata salah satu pengguna. Gangnam Style milik Psy telah ditonton lebih dari 1,5 miliar kali.Laguitumelam-bungkannama Psy dan juga tariannya da-lam video itu.

Psy/ Tahun lalu, Gangnam Style versi digital telah terjual sebanyak 3,59 juta di Amerika Serikat dan Kanada, berdasarkan angka dari Nielsen SOundScan dan Nielsen BDS. (ant)

Video Terbaru Psy Gentleman Ditonton 82 Juta Kali Video klip single terbaru penyanyi asal Korea Selatan Psy berjudul Gentleman telah ditonton sebanyak 82 juta kali di YouTube. Dalam 24 jam pertama setelah dirilis Sabtu (13/4), Gentleman telah ditonton lebih dari 20 juta kali. Video itu mengalahkan Boyfriend milik Ju-stin Bieber hanya meraih 8 juta selama 24 jam setelah dirilis. “Sebanyak 51 juta dalam 40 jam!! Ya Tuhan!!” kata Psy melalui Twitter. Selain di YouTube, lagu itu juga masuk 10 besar di tangga

lagu beberapa negara, nomor 8 di Inggris dan 7 di Australia, berdasarkan iTunes. Di negara Skandinavia bahkan Gentleman menduduki posisi puncak. “Dia bagus. Saya suka semanganya,” komentar salah seorang penggunaYouTube, seperti dikutip dari Reuters. Pengguna lainnya berkomentar penyanyi berkacamata hitam itu lucu dan tariannya lembut. Video itu juga menuai komentar miring dari para pengguna, mereka berpendapat video itu arogan dan terlalu seksi. “Meh, Gangnam Style lebih

Agar Fatin Tidak Pulang, Fans Gandeng SBY banget. Jadi kaya sudah kenal lama. Jadi kaya saudara. Ketawa

bareng, seru banget,” tandasnya.(okz)

Tilda Swinton Tidur Dalam Peti Kaca

Fatin Banyak cara dilakukan Fatinistic atau fans finalis X Factor Indonesia, Fatin Shidqia Lubis, agar idola mereka tidak dipulangkan pekan ini. Salah satunya, mereka mencoba untuk menggandeng Presiden SBY. Sejumlah akun Twitter fans Fatin mencoba melobi SBY agar mengirimkan SMS untuk mendukung Fatin. Seperti dilakukan akun Twitter, @FatinisticPulau1000 dan @FatinisticNusantara, Rabu (17/4). “FATINISTIC PULAU1000 ?@Fatinistic_PS selamat siang dn beraktivitas pak @SBYudhoyono ,jangan lupa dukung @FatinSL di @XFactor_ID ketik: FATIN kirim ke 9288 yang banyak iya pak” “FATINISTIC NUSANTARA ?@fatinisticnsntr pak @SBYudhoyno jangan lupa nge-VOTE @FatinSL agar menjadi peme-

nang di @XFactor_ID , ketik FATIN kirim ke 9288, makasih pak” Tak hanya itu, mereka terus berkicau kepada Tweeps untuk terusDalam pandangan Fatin, Rossa adalah juri yang penyayang kepada anak asuhnya. Dia selalu memberikan saran dan selalu menemani anak asuhnya dalam mempersiapkan penampilan di setiap Gala Show. “Teh Ocha itu mentor yang sangat penyayang. Dia seperti mama sendiri. Baik banget. Dia juga kasih tips, saran, biar kita nyanyinya baik, biar stage actnya bagus, performance-nya luar biasa,” ungkap Fatin baru-baru ini. Fatin tak merasa menyesal dapat mentor Rossa. Ia sangat menikmati waktu bersama sang mentor dengan canda tawa. “Kalau dimentori dia enggak bakal nyesel. Dia buat kita jadi asik

Pengunjung Museum of Modern Art (MOMA) di New York, Amerika Serikat (AS), berkesempatan menyaksikan pertunjukan ganjil, yaitu aksi tidur di dalam peti kaca tembus pandang ala aktris Tilda Swinton. Peraih Oscar itu menyebut aksi di akhir pekan lalu tersebut sebagai suatukemungkinan,yakniberbaringdikasurbersepreiputih,bercelana panjangbirugelap,berkaosoblongbirumuda,bersepatu,dankacamata tergeletak di sampingnya. “Artis hidup, kaca, besi, matras, bantal, sepresi, air dan ka-camata,” demikian teks yang tertulis pada kartu penjelasan layaknya melengkapi benda pameran di museum. Pertunjukan pertama seperti itu dilakukan di London pada 1995, dan secara berkala akan dilanjutkan sepanjang tahun ini, ujar Juru Bicara MOMA, Margaret Doyle. “Sifat konsep ini ialah tidak diumumkan sebelumnya, termasuk oleh museum,” katanya. Swinton,52 peraih Oscar sebagai pemeran pembantu terbaik pada film Michael Clayton disutradarai Tony Gilroy pada 2007. George Clooney sebagai peran utama didampingi Tom Wilkinson, Sydney Pollack dan Tilda Swinton. Ia juga bermain pada film Julia, Burn After Reading dan The Curious Case og Benjamin Button.(ant)

Tilda Swinton/

pada Sharon, keluarga, teman, rekan-rekan pemain band, atas perilakusintingsayaselamaini...juga kepadaparapenggemar,”tulisOsbourne. The Osbouner menjadi pasangan Hollywood paling terkenal sejak muncul dalam reality show bertajukThe Osbouner bersama dua buah hati mereka Jack dan kelly.ra.(ant)

Steven Tyler/


WASPADA Jumat, 19 April 2013

Petani Minta Pembangunan Bendungan Irigasi Krueng Pase

Takut Banjir Susulan, Warga Panen Lebih Awal LHOKSEUMAWE (Waspada): Kekhawatiran terjadinya banjir susulan, ratusan petani di Gampong Pulo Blang dan Beunot Kecamatan Syamtalira Bayu, Aceh Utara terpaksa bekerja ekstra pasca panen. Bahkan memotong padi lebih cepat dari seharusnya waktu panen. M Nur, 31, salah seorang petani Gampong Pulo Blang, Syamtalira Bayu mengatakan, Kamis (18/), mengingat cuaca tidak menentu paska banjir Minggu lalu yang mengepung Kecamatan Syamtalira Bayu, Syamtalira Aron dan Blang Mangat, mereka khawatir banjir susulan meluap lagi ke desanya. “Cuaca akhir-akhir ini yang tidak menentu dan sering hujan terutama pada sore hari, membuat kami takut banjir lagi. Sebab itu kami terpaksa memanen lebih awal agar terbebas dari rendaman air, meskipun padi belum waktunya panen. Selepas panen langsung kami angkat walaupun masih basah,” ujarnya. Namun kondisi seharusnya, padi setelah dipotong dikeringkan dulu di sawah, dan tidak langsung diangkat ke darat agar gabahnya lebih berkualitas, dan harga jual lebih mahal. Sementara petani disibukkan dengan berbagai aktivitas di area sawah. Sebagian dari mereka ada yang sedang memotong padi, menarik dengan perahu karet dan langsung diangkat serta dirontokkan dengan mesin perontok padi. Kemudian dibawa pulang ke rumah atau kios-kios pengumpul untuk dijual. (cmk)

PPP Usung 40 Caleg Ke DPRK Bireuen BIREUEN (Waspada): Partai Persatuan Pembangunan (PPP) mengusung 40 orang calon anggota legislatif Dewan Perwakilan Rakyat Kabupaten (DPRK) Bireuen. Dari jumlah itu, 14 di antaranya adalah perempuan yang didaftarkan ke Komisi Independen Pemilihan, Kamis (18/4). Amatan Waspada, para calon legislatif ini dengan menggunakan puluhan becak motor melintasi jalur lintas SumateraAceh menuju Kantor KIP di Paya Meuneng, Kecamatan Peusangan. Ketua DPC PPP Murdani, SE menyebutkan, jumlah calon itu tersebar dari semua daerah pemilihan (Dapil) di wilayah itu untuk berkompetisi pada Pemilu 2014 mendatang. “Kalau jumlah caleg perempuan sudah mencapai 38 persen, melebihi dari aturan yakni 30 persen,” terang Murdani. Dijelaskan, melalui Pemilu 9 April tahun depan, PPP menargetkan akan meraih 7 kursi di DPRK Bireuen. “Kami hanya target 7 kursi, seperti perolehan kursi Pemilu ketika PPP Bireuen dipimpin H Asyek,” pungkas Murdani. Ketua KIP Bireuen, Mukhtaruddin, SH.MH kepada para wartawan menjelaskan, berkas pencalonan yang disampaikan PPP ini akan diverifikasi kelengkapannya. Pada tahap ini, KIP akan memeriksa jumlah berkas calon dan jumlah daerah pemilihan, serta jumlah bakal calon legislatif yang diusung PPP dimaksud. “Masalah keterwakilan perempuan akan diteliti pada masa verfikasi,” terang Mukhtaruddin seraya menambahkan, tahapan verifikasi akan dilaksanakan 23 April6 Mei 2013. (b17)

KIP Aceh Utara Batalkan Calon Anggota KPPS Terlibat Parpol LHOKSEUMAWE (Waspada): Komisi Independen Pemilihan (KIP) Aceh Utara akan membatalkan calon anggota KPPS yang terbukti terlibat Partai Politik. Namun sampai saat ini pengaduan keterlibatan KPPS dengan Parpol belum bisa dibuktikan. “Kalau terbukti, mereka (calon KPPS-red) akan kita proses,” jelas Sekretaris KIP Aceh Utara, Abdullah Hasbullah kepada Waspada, Kamis (18/4). Pengaduan keterlibatan calon anggota Kelompok Penyelenggaran Pemungutan Suara (KPPS) dalam Parpol, tambahnya, perlu bukti. Namun karena bukti keterlibatan tidak bisa dihadirkan, sehingga masalah itu belum bisa diproses. Dijelaskan, saat ini KIP sedang melakukan proses perekrutan anggota KPPS. Mereka direkrut dari 852 desa di Kabupaten Aceh Utara. Setiap desa terdiri dari 3 anggota KPPS dan 2 sekretaris. “Kita akan segera melantik anggota KPPS,” jelas Abdullah kembali. Mereka sangat berperan dalam pelaksanaan Pemilu legislatif pada April 2014. Oleh sebab itu, menjadi anggota KPPS tidak dibenarkan terlibat dengan partai politik peserta pemilu.(b15)

Delapan Standar Pendidikan Dasar LHOKSEUMAWE (Waspada): Ketua Persatuan Istri Prajurit (Persit) Kartika Chandra Kirana Korem 011 Liwangsa Ira Hipdizah berharap delapan standar pendidikan dasar harus ada di TK dan PAUD. Hal itu untuk menguasai kompetensi pembelajaran sehingga kualitas pendidikan usia dini semakin baik. Hal itu disampaikan saat Ketua Persit KCK Korem 011 Liwangsa Ira Hipdizah melakukan kunjungan ke TK Kartika XXIV-3/ PAUD Lhokseumawe, Kamis (18/4). “Saya harap pendidikan usia dini harus memiliki delapan standar pendidikan dasar dalam meningkatkan kualitas dan kompetisi di era kemajuan ini,” ujarnya istri Danrem itu. Disebutkan, delapan standar itu meliputi standar pelayanan, standar kompetensi, standar didik, standar pendidik atau pengajar, sarana dan prasarana serta standar manajemen, organisasi dan standar pelayanan. Kalau ini dimiliki TK atau PAUD, maka lembaga pendidikan usia dini akan berkembang dan bermutu. (cmk)

Bireuen Miliki 75 Dayah BIREUEN (Waspada) : Sejak 2011, jumlah pendidikan agama dayah yang sudah terdata di Kabupaten Bireuen sebanyak 75 unit, selebihnya masih berstatus sebagai balai pengajian. Lima dayah di antaranya sudah mendapat predikat tipe A, masing-masing-masing Dayah Mudi Putera Masjid Raya Samalanga, Dayah Mudi Puteri Masjid Raya Samalanga, Dayah Babussalam putra Blang Bladeh Kecamatan Jeumpa, Dayah Ummul Aiman (terpadi) Samalanga dan Dayah Puteri Muslimat Samalanga. Kepala Badan Dayah Kabupaten Bireuen Saifullah, Kamis (18/4) menuturkan, 70 dayah dan balai pengajian yang tersebar 17 kecamatan di Bireuen, 15 dayah di antaranya berstatus tipe B, 36 dayah tipe C dan 15 dayah berstarus tipe D. Saifullah menyebutkan, dayah melaksanakan dua sistem pendidikan, ada yang mempelajari kitab kuning khusus ilmu agama saja dan pembelajaran terpadu ilmu agama dan umum. (b12)

UTD RSUD Kumpulkan 60 Kantong Darah IDI (Waspada): Guna mengantisipasi kekurangan darah di Unit Tranfusi Darah Rumah Sakit Umum Daerah (UTD-RSUD), Palang Merah Indonesia (PMI) bekerjasama dengan Sekretariat Daerah Kabupaten Aceh Timur, Kamis (18/4). Kegiatan sosial itu dipusatkan di Aula Serbaguna Idi Rayeuk. Direktur RSUD Idi, dr Munawir, SpB kepada Waspada mengatakan, kegiatan sosial rutin dilaksanakan pihak PMI Aceh Timur bersama pihak RSUD Idi dan didukung sepenuhnya Ikatan Dokter Indonesia (IDI) Aceh Timur. “Alhamdulillah donor darah yang dilaksanakan hari ini (kemarin—red) berjalan lancar dan berhasil mengumpulkan 60 kantong darah,” katanya. Munawir menyebutkan, para pendonor darah kali ini merupakan para PNS dalam lingkungan Setda Aceh Timur dan para Kepala SKPK di wilayah itu. (b24/b19) Perbaikan: dalam teks foto penangkapan bawang merah selundupan, Waspada edisi, Kamis (17/4) terdapat kesalahan yang mengganggu…Kabag Ops Polres Aceh Timur, Muhajir…seharusnya Kapolres Aceh Timur AKBP Muhajir dan Kabag Ops Polres Aceh Timur Kompol Warosidi.Demikian perbaikan ini (redaksi)


Waspada/Mustafa Kamal

PETANI memikul padi dari sawah usai dirontokkan pasca panen karena takut banjir susulan di Gampong Pulo Blang, Syamtalira Bayu, Aceh Utara, Kamis (18/4)

Kejuruan Muda-Tamiang Hulu Nyaris Lumpuh KUALASIMPANG ( Waspada ): Lantai jembatan ( Titi Glondeng) Seumadam, Kecamatan Kejuruan Muda,Kabupaten Aceh Tamiang mengalami rusak berat dan patah . Akibatnya hubungan dari dan ke Kejuruan Muda menuju Kecamatan Tamiang Hulu, Kecamatan Tenggulun dan Bandar Pusaka nyaris lumpuh. Pantauan Waspada, Kamis (18/4) pagi ,tampak antrian panjang mobil pribadi,mobil penumpang umum dan truk serta sepedamotor dari arah Kejuruan Muda dan Tamiang Hulu karena lantai jembatan yang terbuat dari papan mengalami rusak berat dan ada yang patah. Informasi diperoleh Waspa-

da dari warga setempat, lantai jembatan rusak berat karena setiap malam hari dilalui truk yang mengangkut batu dolomit yang muatannya diperkiran lebih dari 30 ton per truk. “ Pada malam hari sangat ramai truk yang angkut dolomit melintasi jembatan ini yang muatannya juga menurut kami tanya pada petugas di Pos Seumadam muatannya melebihi dari 30 ton, sedangkan kalau pada siang hari truk –truk itu mengangkut batu dolomit antara 20-25 ton,” ungkap warga. Warga juga menyatakan, selain itu, jembatan ini juga dilintasi mobil tangki pengangkut minyak CPO,truk pengangkut buah kelapa sawit untuk Pabrik Kelapa Sawit (PKS) yang ada di daerah ini ,truk pengangkut kayu olahan untuk dibawa ke Medan pada malam hari.Tetapi muatannya paling-paling hanya 20-30 Ton. Pantauan Waspada, tampak

sebahagian pihak perusahaan perkebunan kelapa sawit yang membuka usaha di Kecamatan Kejuruan Muda, Tamiang Hulu danTenggulun sangat sibuk mengerjakan perbaikan jembatan yang rusak berat itu dengan cara mengganti lantai jembatan yang rusak dan patah . Sampai Kamis sore para pekerja tampak masih memperbaiki jembatan yang rusak berat itu. H Abu Kasim dari PT Pati Sari dan Fajar dari PTP I Pulau Tiga bersama pekerja lainnya tampak bekerja keras memperbaiki jembatan yang rusak itu.Mereka mengganti lantai jembatan yang rusak berat dan lantaijembatanyangsudahpatah. Menurut Abu Kasim dan Fajar kepada Waspada kemarin, pihak perusahaan yang ikut membantu dan punya kepedulian untuk memperbaiki jembatan yang rusak ini yaitu PT Pati Sari, PTP I Pulau Tiga, PT Mopoli Raya,PTSocfindo,PTMPLI.(b23)

80 Persen PNS Aceh Timur Tersandung Kasus KDRT IDI (Waspada): Tidak kurang dari 80 persen Pegawai Negeri Sipil (PNS) di Kabupaten Aceh Timur tersandung kasus kekerasan dalam rumah tangga (KDRT), baik pejabat teras ataupun bawahan. “Ini persoalan yang mamalukan kita di Aceh Timur, kita harap kedepan kondisi ini bisa berkurang dan bila perlu kedepan tidak ada PNS atau tenaga kontrak/honorer di Aceh Timur yang terdandung kasus KDRT hingga sampai ke Pengadilan Syariah,” kata Bupati Aceh Timur Hasballah M. Thaib atau akrab disapa Rocky saat bertindak Penceramah Maulid Nabi Muhammad SAW 2013 Kab. Aceh Timur di Pusat Perkantoran Aceh Timur di Idi, Kamis (18/4). Dia mengharapkan, para PNS dalam jajaran Pemkab Aceh Timur untuk saling menjaga hati dan menjaga mata saat berada di kantor atau dalam kedianasan. “Artinya keimanan dan ketaqwaan kita kepada Allah SWT perlu kita jaga, sehingga suami di rumah atau istri di rumah tidak curiga dengan para PNS yang bekerja untuk pembangunan Aceh Timur ke

depan ke arah yang lebih baik,” kata Rocky. Dia juga meminta, para Kepala SKPK dan pejabat teras untuk menjaga bawahaannya masing-masing agar bekerja serius di Aceh Timur. “Kita ini adalah pelayan rakyat yang harus bekerja serius untuk takyat. Jadi jangan main-main dengan pelayanan, karena kita sedang membangkitkan marwah Aceh Timur,” kata Rocky lagi. Dalam bekerja, lanjutnya, sudah seharusnya para PNS

meneladani dan mencontohi perilaku rasul sebagai suri teladan umat Islam dan umat yang hidup diakhir zaman. “Rasulullah adalah sosok manusia yang sempurna dan wajar kita contoh, sehingga perilaku kita juga sesuai dengan misi rasul dalam mengembangkan Islam yakni mengubah akhlakul karimah saat itu,” kata Rocky seraya menandaskan, jika Rasulullah yang kita teladani maka angka kasus KDRT bakal berkurang khususnya di kalanganPemkabsetempat.(b24)

Insentif Petugas Agama Naik LANGSA (Waspada): Kadis Syariat Islam Langsa Ibrahim Latif menegaskan, insentif petugas agama di Langsa naik antara 25 sampai 50 persen. Hal itu disampaikannya, Kamis (18/4) di ruang kerjanya. Dikatakan, tahun anggaran 2013 Pemko Langsa telah menaikkan insentif para petugas agama, yaitu khatib masjid/imam gampong sebelumnya mereka terima (tahun 2012-red) Rp375 ribu sekarang mereka menerima Rp450 ribu (naik 35 persen), imam dusun sebelumnya diterima Rp300 ribu sekarang mereka terima Rp400 ribu (naik 35 persen) pemandi mayat sebelumnya mereka terima Rp200 ribu, sekarang mereka terima Rp300 ribu (naik 50 persen). “Mulai hari ini insentif para petugas agama sudah keluar tiga bulan sudah dicairkan semua. Selain petugas agama perangkat gampong juga mendapat kenaikan insentif di tahun anggaran 2013 ini,” katanya. (m43)

Danrem 011/LW Kunjungi Kodim 0104 LANGSA (Waspada): Danrem 011/Lilawangsa Kolonel Inf Hipdizah melakukan kunjungan kerja ke Makodim 0104/ Aceh Timur untuk melakukan silaturahmi sekaligus memberikan pengarahan kepada personil menyangkut situasi keamanan di daerah teritorial setempat, Kamis (18/4). Kedatangannya disambut Kasdim 0104/Aceh Timur Mayor Inf. Nasrun Nasution, dan seluruh jajaran Koramil dalam wilayah Kodim 0104 setempat. Selanjutnya danrem melakukan tatap muka di aula Makodim 0104/Aceh Timur. Kolonel Inf. Hipdizah dalam arahannya mengingatkan agar personil TNI di wilayah Kodim 0104/Aceh Timur harus mampu mendengar permasalahan apa yang timbul di wilayah Kodim, yang merupakan tugas pokok anggota TNI. “Kita juga harus siap dengan situasi yang berkembang dan jangan lupa tetap menjalin hubungan kompak dan harmonis, baik sesama aparat di Kodim, Pemda, kepolisian, Kejari, Pengadilan, dan masyarakat

lainnya. Dengan kita kompak dan kuat, dengan harapan jika terjadi apapun kita bisa mengantisipasinya,” katanya. Kepada seluruh anggota TNI di jajaran Kodim 0104/Aceh Timur, Hipdizah meminta untuk tidak sekali-kali berbuat kesalahan kriminal seperti nar-

koba, merampok, asusila, judi dan kasus-kasus kejahatan lainnya. Hindari sekecil apapun permasalahan itu. Sebelumnya Danrem juga melakukan kunjungan ke Batalyon 111 Kharma Bhakti (KB) Tualang Cut dan Kompi Senapan A, Aceh Tamiang.(m43)


DANREM 011/Lilawangsa Kolonel Inf Hipdizah saat bertatap muka dengan personil Makodim 0104/Aceh Timur di aula setempat, Kamis (18/4)

LHOKSEUMAWE (Waspada): Ratusan petani dari sembilan kecamatan di Kabupaten Aceh Utara dan Lhokseumawe berunjuk rasa menuntut pembangunan bendungan irigasi Krueng Pase yang terlantar. Selain mendatangi gedung DPRK setempat, mereka juga menyampaikan tuntutan di halaman Kantor Bupati Aceh Utara, Rabu (17/4). Petani yang menuntut pembangunan bendungan irigasi yaitu, dari Kecamatan Meurah Meulia, Samudera, Syamtalira Bayu, Syamtalira Aron, Nibong, Matangkuli, Tanah Luas, dan Kecamatan Tanah Pasir. Sedangkan dari Lhokseumawe, Kecamatan Blang Mangat. Mereka mendesak Pemkab pempercepat pembangunan bendungan irigasi Krueng Pase di Kecamatan Murah Mulia. Kondisi bendungan irigasi tersebut tidak layak sehingga mengancam suplai air ke sawah di sembilan kecamatan itu. Koordinator aksi, Terpiyadi menegaskan, tanpa bendungan Krueng Pase masyarakat dari sembilan kecamatan terancam gagal panen. “Kondisi bendungan Krueng Pase yang dibangun sekitar 1932 kini sudah tidak mampu mengairi persawahan di sejumlah kecamatan, sehingga menyebabkan masyarakat tidak dapat menggarap sawahnya dengan maksimal. Bahkan sebagian besar dilanda kekeringan di musim kemarau dan banjir saat musim penghujan,” ungkapnya. Dikatakan, usia bendungan mencapai 100 tahun. Pada 2008 bendungan ini jebol, sehingga dibangun bendungan darurat yang kini dalam kondisi kritis.

Ratusan warga kemudian berdelegasi dengan anggota dewan. Yaitu dengan Wakil Ketua DPRK Abdul Mutalib, Abdul Hadi Zainal, Fauzi dan Munir Syamsuddin. Sementara dari eksekutif hadir Kadis Sumber Daya Air dan Mineral Aceh Utara Mawardi. Setelah menyampaikan aspirasi, petani mendatangi kantor bupati. Dalam orasinya mereka meminta pemerintah daerah memprioritaskan pembanguan sektor pertanian untuk mencapai kemakmuran rakyat. Wakil Bupati Aceh Utara, Muhammad Jamil menjumpai mereka dan mengakomodir aspirasi masyarakat yang menginginkan percepatan pembangunan bendungan. “Permasalahan ini akan kita tuntaskan, dan saya akan menyampaikan ini kepada bapak bupati,” ungkapnya. Para pengunjuk rasa juga menyerahkan petisi untuk ditangani wakil bupati. Isi petisi tersebut, pertama mempercepat pembangunan waduk irigasi Krueng Pase. Kedua Pemerintah Aceh dan Aceh Utara harus memfokuskan pembangunan dan pengembangan pertanian karena mayoritas masyarakat hidup dari sektor pertanian, bukan hasil industri minyak dan gas bumi. Muhammad Jamil didampingi Sekdakab Syahbuddin Usman, Kabag pemerintahan Murtala mengungkapkan, pembangunan bendungan Krueng Pase mengalami kendala. Pembangunan terhambat karena masih adanya sengketa pembebasan lahan dengan pemilik tanah. (b15)

Pengumuman Tim Penjaringan Calon KIP Langsa Dibuka LANGSA (Waspada): Tim Penjaringan dan Penyaringan calon anggota Komisi Independen Pemilihan (KIP) Kota Langsa periode 2013-2018, mulai Kamis (18/4) membuka pendaftaran bakal calon hingga, Rabu (24/4). Ketua Tim Penjaringan dan Penyaringan calon anggota KIP Kota Langsa Dedek Juliadi Rendra, Kamis (18/4) mengatakan, tim ad hoc telah mengagendakan menerima berkas pendaftaran bakal calon anggota KIP Kota Langsa di sekretariat panitia di Kantor DPRK Langsa,” katanya. Dedek mengatakan, setelah ditetapkan DPRK Langsa, pihaknya langsung membuat rapat internal menyusun jadwal menyangkut tahapan penjaringan dan penyaringan calon anggota KIP. “Tim ini akan melakukan penjaringan dan penyaringan dan menetapkan 15 calon anggota KIP Kota Langsa untuk diserakan ke lembaga dewan. Dari 15 calon itu akan ditetapkan lima anggota KIP Kota Langsa oleh DPRK

Langsa,” katanya. Dirinya memperkirakan peminat menjadi anggota KIP Kota Langsa kali ini tergolong banyak. Hal itu ditandai dengan banyaknya pertanyaan dari kalangan masyarakat yang antusias menghubungi tim terkait jadwal penerimaan berkas calon. Tim ini, menurut Dedek, berharap peran serta masyarakat untuk turut memantau dan menanggapi latar belakang calon-calon anggota KIP nantinya. “Masyarakat bisa membuat laporan tentang calon anggota KIP Kota Langsa,” katanya. Disebutkan, tim itu terbentuk setelah ditetapkan DPRK Kota Langsa. Lima anggota tim terpilih adalah Dedek Juliadi Rendra (Ketua), Mukhsin (Sekretaris), M Syafrizal (anggota), Zulfahmi (anggota) dan Tasnim Lubis (anggota). “Hingga pukul 14:00, jumlah calon anggota KIP Kota Langsa yang mendaftar sejumlah 17 orang,” papar Dedek. (b21)

SMA Al-Azhar Medan Sosialisasi Di SMPN 5 Langsa LANGSA (Waspada): Belasan siswa SMA Al Azhar Medan melakukan sosialisasi memperkenalkan sekolahnya kepada para pelajar SMP Negeri 5 Langsa di mushala sekolah itu di Jalan A.Yani Kota Langsa, Rabu (17/4). Para siswa SMA Al Azhar Medan secara bergantian memberikan penjelasan, baik kehadiran unit-unit sekolahnya mulai dari tingkat Waspada/Dede Juliadi TK, SD, SMP, SMA yang ma- SISWA SMA Al Azhar Medan ketika melakukan sosialisasi ke SMP na untuk SD, SMP dan SMA Negeri 5 Langsa, Rabu (17/4) dibagi dalam tiga kelompok yakni kelas reguler, plus dan akselerasi dan ke- ingin tahu dengan bertanya satu persatu. Koordinator Alwafi Afizhan dan Cut Putri mudian perguruan tinggi. Pada kesempatan itu mereka menceritakan sejarah berdirinya Almunadya mengatakan, kehadiran rombongan pelajar SMA Al-Azhar ke SMPN 5 Langsa hingga fasilitas di Al-Azhar. Ketika mendengarkan tentang SMA dengan untuk memperkenalkan sekolahnya agar siswa Model Kelas Akselerasi di sekolah itu ý yang ý yang tamat di SMPN 5 Langsa bisa memilih bisa 2 tahun tamat, wajah pelajar SMPN 5 Lang- untuk bisa melanjutkan studinya ke SMA Al sa terlihat tertarik dan rasa penaasaran dan rasa Azhar. (m43)

Kasus CJH Plus Mulai Disidangkan Hakim Usulkan Mediasi LHOKSEUMAWE (Waspada): Hakim mulai menyidangkan kasus gugatan terhadap Muzakir Didoh yang melapor PT Iskandaria Tour dan Travel Cabang Lhokseumawe terkait persoalan Calon Jamaah Haji (CJH) Plus ke Polres Lhokseumawe pada 2011 lalu. Sidang digelar di Pengadilan Negeri setempat, Kamis (18/4). Sidang perdana ini berjalan cepat, usai memeriksa berkas surat kuasa hukum tergugat dan pengggugat, Ketua Hakim Inrawaldi didampingi anggotanya Zulfikar dan Nasri menanyakan kepada kedua pengacara apakah sepakat jika persoalan itu bisa diselesaikan melalui mediasi untuk tahap pertama. “Sampai sekarang belum ada pembicaraan terkait mediasi dari tergugat. Tapi pada prinsipnya kami setuju, dan mediator kami serahkan kepada hakim untuk menentukan,” kata


Sementara kuasa hukum tergugat Effendi menyebutkan, jika persoalan tak selesai dengan tahap mediasi dalam dua pekan, dirinya meminta hakim supaya melanjutkan pemeriksaan perkara gugatan. Namun, kemudian disepakati mediator dalam kasus gugatan itu M Jamil, hakim pengadilan setempat. Pertemuan mediasi antara penggugat dan tergugat akan dilangsungkan pada 25 April di PN setempat, kemudian hakim menunda sidang itu pada 7 Mei 2013. Sebagaimana diketahui, kasus ini digugat oleh Direktur Utama PT Lintas Iskandaria Jakarta, Luqman Nyak Neh melalui kuasa hukumnya Sopian Adami, 26 Maret 2013 ke PN Lhokseumawe dengan nilai gugatan Rp10 miliar lebih. (cmk)

850 Mahasiswa Unimal Ikuti KKN – PPM LHOKSEUMAWE, (Waspada): 850 Mahasiswa Universitas Malikussaleh (Unimal) Lhokseumawe, mengikuti Kuliah Kerja Nyata (KKN) Program Pemberdayaan Masyarakat (PPM) angkatan XIII/2012 – 2013. Mareka akan disebarkan ke 80 desa (gampong) di wilayah ujung timur Aceh Utara, yaitu di Kec Tanah Jambo Aye (47 desa) dan Kec Seunuddon (33 desa). Kamis (18/4), dilepas di Pendopo Bupati Aceh Utara, Jl Merdeka Lhokseumawe, kendati kegiatan KKN – PPM tim II angkatan XIII/2012 – 2013 itu terhitung sejak, 15 April – 10 Juni 2013, jelas ketua KKN Muhammad Ali, Kamis (18/4). Para mahasiswa Unimal Lhokseumawe, sebelum dilepaskan, Kamis kemarin, terlebih dahulu sudah diberi pembekalan (coaching) di Kampus Unimal, Senin (15/4) dan Selasa (16/4) atau dalam dua hari durasi, dengan agenda pencanangan KKN yang dilakukan oleh Rektor Unimal, DR Apridar, SE. Rektor mengharapkan, mahasiswa dapat melaksanakan KKN dengan baik, menjaga nama almamater dan dapat menyatu dengan masyarakat di mana ia ditempatkan. Rektor menekankan, “keberhasilan mahasiswa dalam

kegiatan ini bukanlah terletak pada IQ mahasiswa, tetapi sangat bergantung kepada bagaimana mengaplikasikan ilmu pengetahuannya di dalam masyarakat,” ujarnya. Ketua KKN Muhammad Ali, melaporkan. Kegiatan coaching ini diikuti oleh 850 orang mahasiswadenganDosenPembimbingLapangan (DPL), 27 orang. Program disesuaikan dengan kondisi masyarakat berdasarkan hasil survey yang dilakukan oleh mahasiswa sendiri. Programprogram yang dilaksanakan, disesuaikan juga dengan kemampuan mahasiswa dalam pelaksanaannya. Khusus untuk mahasiswa non reguler ditempatkandilingkungankampusReuleutdalam program Goes Green Kampus, sebut ketua KKN. Pada kegiatan coaching di kampus, sebagai moderator Ibrahim Qomarius, pemateri coaching Damanhur dengan topik manajemen masjid dan meunasah, teknik pendekatan dengan masyarakat dilanjutkan oleh Andre Zulva dengan topik mahasiswa sebagai agent of development, Hadi Iskandar dengan tema motivasi dan pemberdayaan masyarakat tentang kewirausahaan, Nanda dengan topik teknik pelaporan KKN dan Yulius Darma dengan topik mekanisme KKN - PPM. (cmk/b13)


C2 BANDAACEH(Waspada):DPRK Sabang, provinsi Aceh meminta Dinas Perhubungan mengevaluasi jadwal pelayaran kapal cepat rute Banda Aceh-Sabang, sehubungan dengan bertambahnya armada pelayaran yang melayani rute tersebut. “Ini agar wisatawan maupun masyarakat terlayani dengan baik,” Kata EMK Munthadir, ketua Komisi A DPRK Sabang kepada wartawan di Banda Aceh, Rabu (17/4). Ia menyatakan, usulan perubahan sesuai aspirasi masyarakat Sabang,menyusul bertambahnya armada kapal cepat yang melayani rute Banda Aceh-Sabang dan sebaliknya. Dijelaskannya, sarana transportasi laut yang melayani rute tersebut telah bertambah menjadi 3 kapal dengan kehadiran kapal Expres Bahari-9 dari sebelumnya yang hanya dilayani dua kapal cepat, yakni Expres Bahari C3 dan Exspres Pulo Rondo (cb06)

Alfada Desak Pemerintah Blokir Pornografi BANDA ACEH (Waspada): Forum Alumni Fakultas Dakwah IAIN Ar-Raniry Banda Aceh menyebutkan maraknya kasus pelanggaran seksual terjadi di wilayah Hukum Syariat Islam Aceh kurangnya pendidikan agama yang benar dan pengaruh pornografi kian merambah di tengah masyarakat. Hal itu diungkapkan Ketua Forum Alumni Fakultas Dakwah (ALFADA Aceh) Drs Ibnu Sa’dan, M.Pd, di sela-sela diskusi maraknya pemberitaan tentang kasus pemerkosaan terjadi di tengah masyarakat Aceh saat ini, Rabu (17/4) di kampus IAIN Ar-Raniry. (b07)

BANDA ACEH (Waspada) : Pemerintah Kota (Pemko) Banda Aceh akan terus berupaya dan bertekad keras menjadikan jalur Sungai (Krueng) Aceh sebagai salah satu pusat objek wisata air yang megah di Provinsi Aceh. Dekat menjadikan Krueng Aceh sebagai objek wisata air itu disampaikan Wali Kota Banda Aceh, Ir H Mawardy Nurdin, M. Eng. Untuk mewujudkan cita-cita itu Pemko Banda Aceh membutuhkan dana senilai Rp200 miliar, kata Mawardy, Rabu (17/4).(b02)

Juang Kencana Percepat Program KB Di Aceh BANDA ACEH (Waspada) : Kehadiran organisasi Paguyuban Juang Kencana (PJK) sebagai tempat bernaungnya mantan pegawai BKKBN adalah dimaksudkan untuk mempercepat pelaksanaan program Keluarga Berencana di Aceh. “PJK harus bisa meningkatkan pembangunan Kependudukan Keluarga Berencana (KKB), taraf ekonomi masyarakat dan memberikan kontribusi untuk pembangunan daerah, “kata Wakil Ketua PJK Aceh, Drs. H Luthfi A Aziz kepada Waspada, Rabu (17/4. Untuk itu sebanyak 36 personil pengurus Juang Kencana Provinsi Aceh dilantik untuk menjalankan roda organisasi Kependudukan Keluarga Berencana di Aceh. Pelantikan pengurus PJK perdana di Provinsi Aceh dilakukan Wakil Ketua PJK Pusat, H Lufti Sabri, yang dihadiri dan saksikan Kepala BKKBN Aceh, di Aula Diklat BKKBN Aceh.(cb01)

Sensus Pertanian Penting Bagi Aceh BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah mengatakan, Sensus Pertanian (ST) 2013 sangat penting bagi Aceh, karena sektor pertanian merupakan pendorong kebangkitan ekonomi yang utama di bumi Serambi Mekkah. Demikian disampaikan Gubernur Aceh Zaini Abdullah dalam sambutan yang dibacakan Sekda Aceh T Setia Budi pada sosialisasi ST 2013 untuk SKPA, Panglima Laot, LSM, pimpinan media serta tokoh masyarakat, Selasa (16/4) di aula Bappeda, Banda Aceh. Kepala Badan Pusat Statistik (BPS) Aceh Hermanto bin Ashari Prawito menyebutkan, sensus pertanian dilaksanakan 10 tahun sekali. ST2013 menerjunkan 5.768 petugas sensus di 23 kabupaten/kota, untuk mencacah 13.842 blok sensus di 6.450 gampong di Aceh. (b06)

Asisten Staf Khusus Presiden Kunker Ke Banda Aceh BANDA ACEH(Waspada): Asisten Staf Khu-sus Presiden RI bidang komunikasi sosial, Fajar Ilham didampingi stafnya Sahat Yogiantoro melakukan kunjungan kerja ke Kota Banda Aceh. Kedatangan Staf Khusus SBY ini diterima Wakil Wali Kota Banda Aceh Hj Illiza Sa’aduddin Djamal dan didampingi Sekdakota T Saifuddin TA, para Asisten serta sejumlah Kepala SKPD jarajan Pemko, di ruang rapat Wali kota, Banda Aceh, Senin (15/4). Fajar Ilham mengatakan maksud kedata-ngan dirinya ke Banda Aceh adalah untuk mela-kukan peninjauan sejauh mana realisasi sejum-lah program pemerintah di Kota Banda Aceh. “Kita datang ke sini untuk melakukan penin-jauan realisasi pembangunan poros jalan Banda Aceh-Meulaboh, pelayanan Jamkesmas dan Jaminan Kesehatan Aceh, pendidikan gratis SD/SMA, KUR, PNPM Mandiri, Raskin dan ber-bagai pembangunan infrastruktur di Kota Ban-da Aceh” Jelas Ilham (b02)

Hujan Terus, Warga Dekat DAS Khawatir Banjir MEUREUDU (Waspada) : Musim hujan yang masih berlangsung panjang di Kabupaten Pidie Jaya dan Kabupaten Pidie, semakin membuat warga setempat khawatir terhadap banjir bandang. Akibatnya, banyak warga yang berdiam di dekat Daerah Aliran Sungai (DAS) makin khawatir terhadap datangnya banjir secara tiba-tiba. Dalam tiga pekan terakhir hujan masih terus mengguyur sebagian besar wilayah Kabupaten Pidie Jaya dan Pidie. Warga yang tinggal di dekat DAS Krueng Meureudu, Beuracan, Ulim, Kiran, Putu (Pidie Jaya), Krueng Baro, Tiro (Pidie) mulai bersiapsiap mengamankan berbagai perabot dan alat rumah tangga serta harta benda lainnya. Karena khawatir disapu banjir. “Bila air sungai meluap, rumah kami dipastikan akan terendam atau bahkan akan terancam rubuh diterjang air bah, “kata Ibrahim, salah seorang warga Ulee Gle kepada Waspada, Minggu (14/4), yang mengaku rumahnya sudah sangat dekat dengan bibir sungai.(b09)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu)

Garuda Indonesia

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

10:40 16:00

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:20 16:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:00

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:30


FY 3400 Penang*


Jumat 19 April 2013

Peraturan KIP Membingungkan

Evaluasi Jadwal Pelayaran Kapal Cepat

Penataan Krueng Aceh Butuh Rp200 M



PRASASTI: Bupati Aceh Besar Mukhlis Basyah sedang menandatangani prasasti peresmian pemakaian Kantor Camat Montasik,Kamis (18/4).Gedung permanen itu dibangun dengan dana sebesar Rp1,7miliar bersumber dari APBN melalui Pembantuan Kementerian Dalam Negeri (Kemendagri) Tahun Anggaran 2012.

Permasalahan UUPA Dan UU Tak Ada Habisnya BANDA ACEH (Waspada): Permasalahan tentang aturan antara UUPA dan Undang-undang RI tak ada habisnya, mulai dari kontroversi pencalonan independen pada pilkada tahun lalu, kemudian disusul tentang permasalahan pembuatan bendera dan lambang serta kini permasalahan jumlah kuota kursi caleg pileg 2014. Komisi Independen Pemilihan (KIP) Aceh berharap Komisi Pemilihan Umum (KPU) pusat untuk segera menjawab surat dari KIP Aceh terkait dengan

kuota caleg dalam pemilu Legislatif 2014 di Provinsi Aceh. Pasalnya ada dua aturan dalam hal penetapan kuota caleg dalam pemilu di Aceh, berdasarkan Undang-undang pemilu nomor 8 tahun 2012, kuota caleg yang didaftarkan partai politik adalah 100 persen dari jumlah kursi yang tersedia di DPR. Sedangkan dalam qanun nomor 3 tentang partai lokal mengatur jumlah caleg yang didaftarkan mencapai 120 persen. Komisioner KIP Aceh Yarwin Adi Darma mengatakan, jika aturan dari KPU sudah turun, pihaknya berharap aturan itu juga berlaku untuk partai nasional, sehingga tidak terjadi kecemburuan sosial yang berakibat munculnya masalah baru.

Menurut Yarwin, KIP Aceh hanya menjalankan aturan sesuai petunjuk KPU pusat, mengingat pemilu 2014 merupakan pemilu yang bersifat nasional. “Sudah kita surati KPU, nah kalau KPU setuju menggunakan 120 persen, maka kita harap itu berlaku semua, karena kita mau semua partai mendapatkan hak yang sama dalam pemilu ini,” terangnya. Anggota Komisi A DPRA Mansyur Nur Hakim mengatakan, DPR Aceh akan menolak pelaksanaan Pemilu 2014 mendatang, jika KPU pusat tidak menetapkan aturan kuota calon legislatif (caleg) setiap daerah pemilihan (dapil) 120 persen sesuai Qanun Aceh. (cb01)

Tetapkan Tersangka Korupsi, Polisi Dihadiahi Sertifikat GeRAK BANDAACEH(Waspada): Puluhan aktivis tergabung dalam Elemen Masyarakat Anti Korupsi Aceh, mengapresiasi Kepolisian Resort Kota Banda Aceh yang menetapkan mantan Kepala Badan Penanggulangan Bencana Aceh (BPBA) sebagai tersangka kasus dugaan korupsi. Apresiasi disampaikan dengan berorasi di Bundaran Simpang Lima dan konvoi ke Markas kepolisian kota Banda Aceh di Jalan Cut Mutia. Pantauan Waspada, puluhan massa merupakan aktifis antikorupsi GeRAK Aceh, Sekolah Anti Korupsi dan Komunitas Anti korupsi itu memulai aksi sekira pukul 10:00, Kamis (18/ 4), di Bundaran Simpang Lima. Massa berorasi dan membawa sejumlah spanduk dan karton bertuliskan pujian atas keberhasilan korps “baju coklat” itu.

“Polisi hebat sudah berani berantas korupsi, serta “Polresta Banda Aceh sudah yang lain mana aksimu,” tulis peserta aksi. Dalam aksinya, massa juga menggalang tanda tangan dari pengguna jalan yang melintas di kawasan Simpang Lima, sebagai bentuk apresiasi kepada Polresta Banda Aceh. Mahmuddin, kordinator aksi mengatakan penetapan AS sebagai tersangka kasus dugaan korupsi atas pengelolaan dana bencana oleh BPBA dengan total Rp3,4 miliar merupakan sebuah sejarah baru. “Pengungkapan kasus besar dengan jumlah dana di atas Rp. 1 miliar oleh kepolisian setingkat Polres merupakan keberhasilan luar biasa dalam penyelesaian kasus pidana korupsi di Aceh,” kata Mahmuddin. Menurut Mahmudi, keber-

hasilan dalam membuka tabir kasus tersebut patut diapresiasikan karena itu merupakan langkah maju yang dilakukan polisi ditengah melemahnya pengungkapan kasus korupsi di Aceh. “Kami mendorong kepolisian baik Polda maupun Polres yang ada di Aceh untuk terus melakukan pengungkapan kasus korupsi di Aceh,” ungkapnya. Puas berorasi di simpang lima, puluhan massa kemudian menuju Markas Kepolisian Kota Banda Aceh dikawasan Jalan Cut Mutia. Massa kemudian menyerahkan sertifikat kepada Wakapolresta Banda Aceh, AKBP Sugeng HS yang menemui peserta aksi di depan gerbang Polresta Banda Aceh. (cb06)

Disdik Fokus Peningkatan Mutu Pendidikan BANDA ACEH (Waspada): Kadis Pendidikan Aceh Anas M Adam mengatakan, upaya peningkatan mutu pendidikan di bumi Serambi Mekkah saat ini merupakan fokus pekerjaan Disdik. Karena itu, pihaknya berharap fasilitator daerah yang dilatih USAID PRIORITAS untuk jenjang pendidikan SD/MI menjadi aset daerah dalam memajukan dan meningkatkan kualitas pendidikan di Aceh. “Para guru yang dilatih sebagai pelatih daerah menjadi motor penggerak dalam pe-

ningkatan mutu pendidikan,” ujar Anas M Adam, pada pelatihan fasilitator daerah (Fasda) SD/MI, Kamis (18/4) di Banda Aceh. Kadisdik Aceh ini meminta fasilitator yang sudah dilatih sebagai pelatih berkomitmen dan terus belajar, terutama sebagai motivator penggerak aktifnya kelompok kerja guru (KKG) di wilayah masing-masing. Koordinator USAID PRIORITAS Aceh, Ridwan Ibrahim mengatakan, pelatihan untuk pelatih fasda itu diikuti 98 orang dari Aceh Jaya, Aceh Besar, Pidie,

Bireuen, Bener Meriah, Aceh Tengah dan kota Banda Aceh. Termasuk kepala sekolah dan pengawas sekolah serta delapan fasilitator dari LPTK Unsyiah dan IAIN Ar-Raniry. “Sebagian fasda itu kepala sekolah dan pengawas terbaik yang direkrut dari tujuh kabupaten/kota di Aceh,” ungkapnya. Sebelumnya USAID PRIORITAS yang membantu pemerintah Aceh dalam meningkatkan kualitas pengajaran dan pembelajaran telah melatih 117 fasda SMP/MTs untuk kabupaten/kota yang sama. (b06)

Fatayan NU Gelar Pelatihan Guru PAUD BANDA ACEH (Waspada): Se-tiap guru Pendidikan Anak Usia Dini atau PAUD harus mempunyai kapasitas dalam mendidik anak-anak, karena gurulah yang akan membentuk karakter bagi siswanya. Begitu disampaikan Kepala Dinas Pendidikan Provinsi Aceh Drs. Anas M. Adam, ketika pembukaan pelatihan peningkatan kapasitas tenaga pendidik PAUD/ TK yang digelar Fatayat Nahdlatul Ulama (PW Fatayat NU) Provinsi Aceh, Kamis (18/4). Anas menyebutkan, Pendidikan Anak Usia Dini dan Taman Kanak-kanak ini sangat penting, namum sampai saat ini masih banyak guru yang belum memiliki kapasitas untuk mengelola PAUD. “Banyak yang belum memiliki konsep tentang apa yang ingin diraih, guru yang membentuk karakter anak, di PAUD

juga diajarkan bagaimana cara berinteraksi, ini hal kecil namun jika tidak memiliki kemampuan, akan berakibat fatal bagi anak,” ujar Anas Menurutnya, usia anakanak cenderung meniru apa yang dilihat dan didengar, otak mereka harus dirangsang, maka penting hal ini diketahui oleh para pendidik di PAUD dan TK, maka sebelumnya guru harus benar-benar mampu. “Pelatihan ini diharapkan akan melahirkan trainer-trainer baru yang mampu mentransfer ilmunya kepada guru-guru lain daerah, sehingga pendidikan di Aceh akan lebih baik dimasa mendatang,” harapnya. Ketua Pimpinan Wilayah Fatayat Nahdlatul Ulama (PW Fatayat NU) Provinsi Aceh Hj Abriati Yusuf, SE mengatakan, pelatihan kapasitas tenaga pendidik ini dilaksanakan untuk 12

kabupaten/kota se-Aceh. “Ini merupakan program yang terakhir PW Fatayat NU Aceh kerjasama dengan The Global Fund for Children, yang sebelumnya sejak 2006 juga telah dilaksanakan4kalidiBandaAceh, Aceh Utara, Aceh Tengah”. Pelatihan ini menghadirkan beberapa pemateri, di antaranya Denny Kadarusman dari Yayasan Anak Bangsa Indonesia (YABI) Jakarta, Agus Fatah, Budi, Nurul Azmi dari Fatayat NU dan dari instansi Pemerintah. Menurut Abriati, training ini dilaksanakan selama empat hari empat malam, peserta diberi pendidikan kurikulum pendidikan PAUD, praktik lapangan pada Sabtu esok, serta diberikan makanan tambahan susu, kacang hijau, kedelai, sabun, agar dapat dijadikan sebagai contoh yang akan diberikan di sekolah nantinya. (b07)

REDELONG (Waspada): Diduga akibat peraturan KIP belum jelas tentang menggunakan perahu berbeda (partai lain) pada Pemilihan Umum (Pileg) 2014, kini melahirkan persoalan serius bagi anggota dewan yang ingin mencalonkan diri kembali sebagai Caleg. Ridwansyah, Ketua Komisi A DPRK Bener Meriah kepada Waspada, Kamis (18/4) di ruang kerjanya menyebutkan, salah satu penyebab bingungnya anggota dewan untuk jadi Caleg dengan menggunakan perahu berbeda yakni yang bersangkutan harus undur diri dari keanggotaannya di DPRK. “Bila partai tidak lulus verifikasi nasional, dengan sendirinya seorang kader tidak dapat mendaftarkan diri untuk mengikuti Pileg. Dari itu, sebagian Caleg berupaya mencari perahu lain. Namun sulitnya persyaratan, seperti diharuskannya seorang anggota dewan untuk undur diri, ini yang jadi kendala dalam persoalan ini,” jelas Ridwan. Dicontohkan, sebelumnya di tahun 2008 suatu partai lokal yakni Partai Daulat Aceh, melakukan perubahan nama menjadi Partai Damai Aceh. Namun anehnya, bila berpatokan ke aturan itu, maka perwakilannya di dewan harusnya mengundurkan diri (PAW). Namun aturan itu tidak diberlakukan KPU. “Artinya, jika merujuk ke aturan KIP yang ditetapkan saat ini, bila terjadi perubahan nama partai, harusnya perwakilannya di dewan juga harus mengundurkan diri dari jabatannya. Namun kenapa hal ini tidak berlaku?,” terangnya.

Selain itu lanjutnya, contoh lain-nya, Peraturan Komisi Pemilihan Umum (PKPU) N. 7 yang tela diubah menjadi PKPU no 13. 2013 menyatakan mantan Narapidana (Napi) tidak bisa mengikuti Pileg. Namun, realitanya di Partai Aceh (PA) rata-rata Calegnya merupakan mantan tahanan politik (Tapol). “ Saya berharap, karena Aceh sudang memiliki UUPA maka pakailah peraturan Aceh yang sudah sah. Tidak perlu menggunakan aturan lain sehingga membingungkan para Caleg ,” ungkap Ketua Komisi A ini dan menambahkan dia juga tidak akan menandatangani form BB 5 pernyataan pengunduran diri dari dewan, karena akan maju menjadi pileg dengan partai lain. Di tempat terpisah, Ahmadi, SE, Ketua KIP Bener Meriah kepada wartawan mengatakan peraturan untuk terpidana minimal 5 tahun, jika di bawah lima tahun tidak jadi masalah. “ Terpidana 5 tahun ke atas sampai keluarnya surat remisi, setelah itu mereka juga harus membuat SKCK dari pihak kepolisian serta mengumumkan dalam media massa serta pengumuman dilampirkan ke data caleg. Sedangkan persoalan Partai Daulat Aceh yang saat ini menjadi Partai Damai Aceh mereka hanya berganti nama ,” menurut KIP Propinsi yang sudah kami tanyakan bahwa mereka juga sudah memiliki surat klarifikasi dari Departemen Hukum Dan HAM,” pungkas Ahmadi, Ketua KIP Bener Meriah.(b33)

Baru PKS Sampaikan Berkas Ke KIP Agara KUTACANE (Waspada) : Kendati batas akhir pendaftaran calon legislatif praktis hanya tinggal empat hari lagi, yakni tanggal 22 April 2013, untuk partai yang akan mengikuti Pemilihan Umum tahun 2014, hingga Kamis (18/4) baru partai PKS yang mendaftar ke KIP Aceh Tenggara, sementara Golkar Agara menyatakan sudah menyiapkan berkas, hanya menunggu saat tepat menuju kantor KIP Agara. Menurut komisioner KIP Agara, Fitriana, bersama ketua KIP Dedy Muliadi Selian, Kamis (18/4), pendaftaran telah dibuka sejak 1 April 2013, namun baru satu partai yang menyampaikan berkasyakniPKS,padahalbataswaktupenyerahan berkas hanya tinggal menghitung hari. Ketua DPRK Agara yang menjabat sekretaris DPD II Golkar Agara menyampaikan, secara

administrasi Golkar Agara siap menyampaikan persyaratan pencalegan sebagai peserta pemilu 2014, namun saat ini Golkar agara belum menyampaikan kelengkapan persyaratan tersebut ke KIP Agara, semata untuk menunggu waktu yang tepat saja. Terkait, informasi tentang masuknya kader partai lain yang saat ini duduk di kursi dewan, bergabung di dalam gerbong partai Golkar maju sebagai caleg 2014, yakni Irwandi Desky, Gabe , Rasidin, ketiganya kader PKPI dan Samsiar sebelumnya di partai Patriot, terkait konsekwensi pergantian antar waktu di kursi dewan, Salim Fakhri mengatakan, sesuai komitmen bila demikian yang ditetapkan peraturan, maka semua caleg yang maju dari Golkar, siap patuh pada mekanisme aturan yang berlaku. (b25)

Wabup Agara Lepas 40 Da’i Ke Perbatasan KUTACANE (Waspada) : Ali Basrah, Wakil Bupati Aceh Tenggara, Kamis (18/4) melepas 40 da’i untuk melaksanakan tugas syiar agama di seluruh desa di daerah perbatasan dan daerah terpencil di Agara. Acara pelepasan dilaksanakan di aula gedung Dinas Syariat Islam Kutacane dihadiri Ketua DPRK Agara M Salim Fakhri, Kadis Syariat Islam Hamidin, Ketua MPU Agara Hasanuddin Mendabe dan unsur Muspika. Ali Basrah dalam sambutannya menyampaikan agar seorang da’i benar-benar memahami tupoksi ketika berada di masyarakat nan-

tinya. Dan diharapkan harus bisa menjalin koordinasi, komunikasi yang baik dengan para aparatur desa. Dikatakan, keberadaan da’i di masyarakat ini antara lain untuk membantu masyarakat memahami arti pentingnya penegakan Syariat Islam, dalam rangka membentengi moral umat agar tidak terjerumus dekadensi moral oleh budaya barat yang buruk. Hamidin, Kadis Syariat Islam Agara menyampaikan harapan agar kiranya da’i ini nantinya mampu berkiprah menjadi ujung tombak dalam penegakan Syariat Islam. (b25)

DPW Ittihadul Muballighin Sumut Silaturahmi Ke Agara MEDAN (Waspada): Dewan PimpinanWilayah Ittihadul Muballighin Provinsi Sumatera Utara melakukan kunjungan silaturahmi sekaligus melaksanakan dakwah (Muhibbah) bersama masyarakat Desa, Cingkem I, Kecamatan Lawe Alas, Kutacane, Senin (15/4). Rombongan Muhibbah Ittihadul Mubalighin Sumatera Utara yang diketuai Kamidin Selian dan Sekretaris Sabirin dalam kunjungan itu diterima masyarakat Desa Cingkem I, Kecamatan Lawe Alas. Nazir Masjid Attahirin Samsudin didampingi Imam Desa Sahbuddin yang menyambut kedatangan rombongan menyatakan rasa bahagianya atas kunjungan silaturahmi yang dilakukan Ittihadul Muballighin ke desa mereka. Dia berharap kiranya ke depan pengurus Ittihadul Muballighin Aceh Tenggara juga bisa dibentuk, sehingga dengan demikian dakwah dan pengajian yang disampaikan dapat terus berjalan. Ketua Ittihadul Muballighin Sumatera Utara Ibrahim Isa dalam sambutannya mengaku gembira bisa bersilaturahmi dengan masyarakat Alas Kutacane khususnya masyarakat Aceh Tenggara. Ibrahim Isa menjelaskan Ittihadul

Muballighin bukan merupakan organisasi politik, tetapi merupakan organisasi yang berhaluan Ahlussunah Waljamaah yang telah berdiri di Medan sejak 1985. Ustadz M Zuhri Pulungan dalam dakwahnya pada kegiatan itu mengatakan, kalau mau memperoleh rezeki yang berlimpah maka harus mau memberikan sebagian dari rezeki yang dimiliki untuk berinfaq terlebih dahulu, dan itu merupakan syarat mutlak bagi insan yang menerima keuntungan dari Allah SWT yang berlimpah ruah. Kegiatan Muhibbah itu dihadiri mualimah dan muballigh di antaranya Hj Zahara Darhuli, Hj Nurhaida Damanik, Seri Defi, Derhana Siregar, Sulimah, Ibrahim Isa, H Kamidin Selian, Sabirin, Farida Milawaty dan M Zuhri Pulungan. Selanjutnya Ittihad juga berkesempatan berdakwah di Kecamatan Deleng Pakeson yang dihadiri 100 warga. Di sini ketua rombongan Kamidin Selian yang bertindak sebagai pendakwah mengatakan bahwa kita harus saling harga menghargai karena muslim itu bersaudara. Muhibbah jangan terkesan saling menyalahkan yang salah, tetapi sebaliknya saling mendukung yang benar. (ckos)

Tagore Tak Masuk Daftar Caleg DPR RI TAKENGEN (Waspada): Ketua Dewan Perwakilan Daerah (DPD) Partai Golkar, Aceh Tengah Nasaruddin mengharapkan DPP Partai Golkar, untuk dapat mempertimbangkan kembali soal tidak adanya figur maupun sosok keterwakilan dari wilayah tengah Aceh, dalam daftar Calon Legislatif (caleg) DPR-RI dari partai berlambang pohon beringin itu. Harapan itu dinyatakan Nasaruddin, menanggapi adanya ancaman dari DPD Partai Golkar, Aceh Tengah dan Bener Meriah yang tidak akan mendaftarkan calegnya untuk kabupaten/ kota ke Komisi Independen Pemilihan (KIP), lantaran tidak masuknya Tagore Abubakar, dalam daftar Caleg DPR-RI dari Partai Golkar. “Soal adanya rencana untuk tidak mendaftar, sikap tersebut merupakan manifestasi dari para kader maupun simpatisan Partai Golkar dari dua kabupaten ini,” ungkap Nasaruddin ketika ditanyai wartawan, Selasa (16/4). Untuk itu, katanya, diharapkan adanya pertimbangan dari DPP Partai Golkar. Apa yang menjadi tuntutan kader dan simpatisan Partai Golkar, merupakan suatu kewajaran, melihat elektabilitas Tagore Abubakar, merupakan kader Partai Golkar yang militansinnya tidak perlu diragukan lagi. “Sisi lain dari sosok Tagore, pengalamannya di legislatif dan eksekutif sudah sangat dikenal. Apalagi yang bersangkutan

merupakan pimpinan Partai Golkar di Kabupaten Bener Meriah,” kata Nasaruddin yang juga Bupati Aceh Tengah ini. Ketika disinggung soal sikap DPD Partai Golkar Aceh Tengah soal rencana tidak akan mendaftar apabila H Tagore Abubakar tetap tidak masuk dalam daftar Caleg DPR-RI, Nasaruddin menyatakan, akan menempuh jalur musyawarah dengan pihak DPP dan DPD I Partai Golkar Aceh. “Sekarang kami sudah melakukan warning ke DPP maupun ke DPD I dan nanti kita lihat hasilnya bagaimana. Ini merupakan dinamika intern partai,” ungkap Nasaruddin. Disampaikan, munculnya reaksi dari pengurus DPD Partai Golkar Aceh Tengah dan Bener Meriah merupakan bagian dari keinginan masyarakat di wilayah tengah yang menginginkan adanya keterwakilan dari daerah tersebut untuk duduk di DPR-RI. Tidak masuknya Tagore Abubakar dalam daftar bursa Calon Legislatif (caleg) DPR-RI dari Partai Golkar, membuat sejumlah kader partai berlambang pohon beringin di dua kabupaten di dataran tinggi Gayo bereaksi. Awalnya, kader Golkar di dua kabupaten sepakat tidak akan mendaftar ke Komisi Independen Pemilihan (KIP), apabila dedengkot partai Golkar asal Bener Meriah itu tidak masuk ke dalam daftar DPR-RI. (b33/b32)


WASPADA Jumat 19 April 2013

Tiga Gampong Persiapan Di Pidie Tak Dapat Dana BKPG

Ratusan Bacaleg DPRK Ikuti Tes Kesehatan GUNUNG MERIAH (Waspada ) : Seratusan lebih bakal calon anggota DPRK Aceh Singkil mengikuti tes kesehatan di Rumah Sakit Umum Daerah Kabupaten Aceh Singkil Jl Singkil – Subulussalam Klaser, Kecamatan Gunung Meriah Tes kesehatan bagi seluruh bacaleg merupakan salah satu syarat untuk bisa menjadi kontestan pada pemilu yang akan digelar tahun depan, kata Ketua KIP Aceh Singkil Abdul Muhri melalui Zakirun Pohan komisioner KIP yang dihubungi Waspada melalui ponselnya Kamis (18/4) . Selain tes kesehatan seluruh bacaleg juga akan mengikuti tes uji baca Alquran yang akan dilakukan sesuai dengan tahapan yang sudah diumumkan serta melengakapi administasi lainnya setelah melewati semua tahapan baru ditetapkan menjadi caleg dan sah untuk mengikuti Pemilu, ujarnya. (cdin)

SIGLI (Waspada): Tiga gampong (desa-red) dalam Kabupaten Pidie dilaporkan tidak memperoleh dana Bantuan Kesejahteraan Peumakmue Gampong (BKPG) 2013. karena masih berstatus persiapan dan belum definitif. Tiga gampong itu adalah, Simpang Beutong, Kecamatan Muara Tiga, Gampong Blang Pandak, Kecamatan Tangse dan Gampong Pasi Beurandeh, Kecamatan Batee. “ Meski tiga desa ini mendapat dana BKPG. Kami membantu melalui APBK Perubahan 2013, itupun bila dananya mendukung kita akan usaha plotkan” kata Kepala Badan Pemberdayaan Masyarakat Desa (BPMD) Pidie T Anwar, MSi kepada Waspada, Kamis (18/4). Diungkapkan, Kabupaten Pidie memperoleh total dana BKPG sebnayak Rp 36,35 miliar

PKS Aceh Timur Serahkan Berkas Caleg IDI (Waspada): DPD Partai Keadilan Sejahtera (PKS) Kabupaten Aceh Timur menyerahkan berkas Calon Legislatif (Caleg) keKantor Komisi Pemilihan Umum (KPU) setempat, Rabu (17/ 4) sekira pukul 15:00. Berkas yang diserahkan yakni dalam bentuk CAD oleh Sekretaris DPD PKS Aceh TImur, Tgk Muliadi M.Yusuf didampingi staf dan Caleg PKS. “PKS menyerahkan 40 Caleg DPRK Aceh Timur yang terdiri dari 21 laki-laki dan 19 perempuan. Alhamdulillah dapat memenuhi lebih dari 30 persen keterwakilan perempuan, bahkan lebih,” katanya. Ke-40 CAD tersebut berasal dari 5 Daerah Pemilihan (Dapil) yang ada di Aceh Timur yakni 7 Caleg Dapil I, 8 Caleg Dapil II, 8 Caleg Dapil III, 11 Caleg Dapil IV, dan 6 Caleg dari Dapil V. “PKS juga merupakan partai pertama yang mendaftar ke KPU Aceh Timur. Ini juga bagian dari tugas PKS,” kata Muliadi. (b24)

Hanya 28 Calon KIP Sabang Kembalikan Berkas SABANG (Waspada): Hanya 28 orang yang mengembalikan berkas permohonan sebagai calon KIP Sabang sampai hari terakhir Selasa (16/4) siang. Yang mengambil formulir di sekretariat Tim Seleksi Calon KIP Sabang seluruhnya 38 orang, namun yang sudah mengembalikan berkas hanya 28 orang. Kita tidak tahu mengapa 10 orang lagi tidak mengembalikan formulir, ujar Zainuddin salah seorang anggota Tim seleksi calon KIP Sabang, Kamis (18/4). Kata dia, tanggal 22 April, semua calon yang sudah mengembalikan berkas akan mengambil nomor ujian yang akan berlangsung pada hari Selasa (23/4) di Aula Dishubkominfo Sabang. (b31)

Calon Anggota KIP Ikuti Tes Baca Alquran SUBULUSSALAM (Waspada): 15 orang calon anggota Komisi Independen Pemilihan (KIP) Subulussalam hasil penjaringan tim ad hock, diterima DPRK melalui Komisi A, mengikuti tes baca Alquran di ruang tim ad hock, Kamis (18/4). Ketua komisi A, Saripudin Padang di sela-sela tes baca quran kepada Waspada mengatakan, menjelang pengumuman lima orang calon anggota KIP, Kamis (2/5) pihaknya melakukan tiga item seleksi yakni baca Alquran, tes psikologi tim dari Medan dan wawancara. Sementara hasil seleksi, lima orang calon akan diantarkan ke KPU Pusat dua hari pasca pengumuman untuk di SK-kan sebelum dilantik wali kota. Dikatakan, berdasarkan aturan, peringkat satu hingga lima akan ditetapkan sebagai anggota depenitif, sementara ranking 6 hingga 10 menjadi cadangan (persiapan PAW). “Tanggal 18-19/4 tes baca quran, 23-25/4 tes psikologi tim psikolog dari Medan dan 26-27/4 wawancara. Empat hari setelah itu di SK-kan KPU, lalu dilantik Wali Kota,” terang Saripudin. (b28)

Dr. Mohd Andalas, Ketua Komite Medik RSUZA BANDA ACEH (Waspada): Dr Mohd. Andalas, terpilih secara aklamasi menjadi Ketua Komite Medik RSUZA menggantikan dr Maimun Syukri, pada pemilihan yang berlangsung di Banda Aceh, Rabu (17/4). Pemilihan yang disaksikan Direktur RSUZA, dr Syahrul diikuti 13 dari 15 Kepala SMF/UPF yang berada di lingkungan RSUZA/ FK Unsyiah, kecuali bagian ilmu mata dan anak. (b04)

FT Unhuma Yudisium 27 Lulusan BANDA ACEH (Waspada): Sebanyak 27 lulusan Fakultas Teknik Unuiversitas Muhammadiyah Aceh (FT-Unmuha) tahun 2013 diwisuda lokal (yudisium) di Aula S-2 Unmuha di kawsan Batoh, Rabu (17/4). Ke-27 orang yang diyudisium Dekan FT Unmuha HM Zardan Araby ini merupakan lulusan angkatan XXI. Mereka terdiri dari tujuh orang jurusan teknik arsitektur dan 20 orang jurusan teknik sipil. Dalam sambutannya, Dekan FT Unmuha menyatakan bangga dengan jumlah kelulusan yang terus meningkat setiap tahun dengan bobot yang semakin baik pula. Zardan juga mengingatkan agar pendidikan para alumni jangan terhenti sampai di tingkat S-1 saja. Namun, teruslah belajar dan tetap berusaha meningkatkan pendidikannya hingga ke jenjang tertinggi. (b04)

Tak Cakap, Sekda Singkil Minta Diganti SINGKIL (Waspada) : Dinilai kurang mampu dan tidak capak dalam melaksanakan tugas nya sebagai orang nomor satu di jajaran Pegawai Negeri Sipil (PNS) M.Yakub KS diminta diganti dari jabatannya sebagai Sekda Kabupaten Aceh Singkil . Demikian disampaikan Jirin Capah Ketua Himpunan Mahasiswa Aceh Singkil (Himapas) yang menghubungi Waspada, Kamis (18/4) dari Banda Aceh melalui ponselnya . Menurut Jirin, jabatan Sekda dalam sebuah pemerintahan merupakan jabatan penentu baik buruknya roda pemerintahan dan pembangunan di daerah Sehingga Sekda tidak hanya mampu memenej permasalahan internal saja tetapi juga harus mampu menjadi penghubung Pemerintah baik antara Bupati – DPRK maupun Bupati – Muspida . Menanggapi hal itu Sekda Aceh Singkil M.Yakub KS yang coba dikonfirmasi belum berhasil . (tim)

Waspada/Muhammad Hanafiah

JEMBATAN Glondeng Seumadam ,Kecamatan Kejuruan Muda ,Kab.Aceh Tamiang rusak berat akibat lantainya patah sedang diperbaiki H Abu Kasim bersama pekerja lainnya supaya arus transportasi jalan tidak terancam putus di daerah tersebut,Kamis (18/4).

Warga Korban Penipuan Oknum Camat

Kerugian Ratusan Juta Rupiah KUALASIMPANG (Waspada) : Tiga oknum pegawai kantor Camat Tamiang Hulu di Kabupaten Aceh Tamiang yang bekerjasama dengan dua oknum camat setempat yang berinisial, Hid dan Raf diduga telah menipu puluhan warga di kecamatan tersebut sehingga pegawai dan camat Tamiang Hulu meraup uang dari warga setempat mencapai ratusan juta rupiah. Hal itu terungkap dari hasil pertemuan Tim Pansus Komisi A dan D dengan Camat Tamiang Hulu, Raf, Kabag Pemerintahan Setdakab Aceh Tamiang, Supriyanto, Manager Kebun PTP I Pulau Tiga Idris dan warga yang diduga telah menjadi korban aksi penipuan tersebut di kantor Camat Tamiang Hulu, Kamis (18/4). Sejumlah warga yang diduga telah menjadi korban aksi penipuan di kantor Camat Tamiang Hulu, Kamis (18/4) mengungkapkan, semasa Kecama-

tan Tamiang Hulu dipimpin Camat Tamiang Hulu yang berinisial, Hid dan diteruskan Camat Tamiang Hulu berikutnya Raf memang ada tiga oknum yang bertugas di kantor camat ini yang menjumpai warga Desa Kaloy dan Desa Bandar Khalifah meminta uang kepada warga yang ingin mendirikan bangunan kios dan rumah di tanah milik HGU PTP Pulau Tiga, Tamiang Hulu. Menurut warga, petugas kantor camat mengatakan tanah areal milik PTP itu HGUnya sudah dilepaskan kepada Pemkab Aceh Tamiang dan jika warga yang berminat untuk menduduki tanah tersebut dengan cara pinjam pakai harus bayar uang setoran yang jumlahnya sangat bervariasi tergantung luas tanah yang dibutuhkan warga dan warga juga harus membayar Pajak Bumi dan Bangunan (PBB). Warga Tamiang Hulu itu menjelaskan adapun oknum dari kantor camat yang memungut uang setoran dari warga yaitu Des, Man dan Gus. Mereka memungut uang dari warga yang butuh tanah ukuran 5 X 10 meter dikenakan biaya Rp1,3 juta, ukuran luas tanah 6 M X 8 meter dipungut biaya sebesar

Rp2,5 juta, ada juga tanah ukuran luas 5 X10 meter dikenakan uang setoran Rp3 juta, ukuran 10 X10 meter harus setor Rp3 juta dan ukuran 10 X10 meter ada juga yang dilalap uangnya oleh oknum-oknum tersebut Rp5 juta, ukuran 6 X 8 meter ada juga dikenakan biaya Rp4.500.000,- dan berbagai ukuran lainnya dan uang setoran juga bervariasi jumlahnya yang harus disetor . Ketua Komisi A Jafar Ketong bersama anggotanya Fadlon, Juanda, Usman, Bukhari, T Ifsyadul Afkar menyatakan pihaknya meminta kepada Camat Tamiang Hulu segera menuntaskan kasus ini secepatnya. Manager PTP I Kebun Pulau Tiga, Idris menyatakan tanah tersebut memang belum dilepas HGUnya oleh PTP, sebab hal yang menyangkut pelepasan HGU adalah wewenang dewan komisaris di PTP pusat di Jakarta dan tidak ada kewenangan Manager PTP Kebun Pulau Tiga. Camat Tamiang Hulu, Raf, ketika ingin dimintai komentarnya terkait mencuatnya kasus ini menyatakan nanti pihaknya akan memberikan komentar. “Nanti sajalah wawancaranya,” ujar Raf, di kantor Camat Tamiang Hulu itu. (b23)

Akademisi Bentuk Forum Dosen Komunikasi BANDA ACEH (Waspada): Dalam meningkatkan prestasi di bidang ilmu dakwah dan komunikasi, sejumlah dosen membentuk Forum Dosen Dakwah dan Komunikasi Aceh, pada Rabu (17/4) di ruang sidang Fakultas Dakwah IAIN ArRaniry. Dekan Fakultas Dakwah IAIN Ar-Raniry Abdul Rani Usman mengatakan, pembentukan Forum Dosen Dakwah dan Komunikasi ini telah lama diwacanakan, namun baru terlaksana hari ini, setelah terlak-

sana pelatihan bagi dosen ilmu komunikasi di Aceh. “Ini berkat kerjasama yang baik dilakukan para dosen komunikasi yang ada di Aceh, dengan harapan dapat meningkatkan prestasi di masa mendatang,” ujar dia. Menurut Abdul Rani, forum ini sangat bermanfaat jika dikelola dengan baik, di samping dapat menghimpun informasiinformasi, juga dapat menjadi wadah dalam melaksanakan kegiatan-kegiatan lainnya. Ketua panitia kegiatan Jasa-

fat mengatakan, Forum Dosen Dakwah dan Komunikasi Aceh ini terbentuk pada pelatihan Dosen Komunikasi se-Aceh yang dilaksanakan Fakultas Dakwah IAIN Ar-Raniry dari tanggal 15-16 April kemarin. “Setelah forum ini terbentuk, diharapkan akan meningkatkan mutu keilmuan para dosen, melakukan penelitian ilmiah, seminar dakwah dan komunikasi, serta lahir karya-karya baru tentang perkembangan ilmu komunikasi,” papar Jasafat. (b07)

untuk 727 desa definitif. Dana ini bersumber dari Anggaran Pendapatan Belanja Aceh (APBA) 2013. Masing-masing desa mendapatkan dana senilai Rp 50 juta, jumlah ini lebih sedikit dari tahun 2012 yang masing-masing desa memperoleh Rp 69 juta. T Anwar menjelaskan, mekanismen penggunaan dana BKPG tetap menganut pada Program Nasional Pemberdayaan Masyarakat (PNPM) dengan sistem bottom up. Artinya program yang dibangun di gampong harus memprioritaskan usulan masyarakat dari bawah ke atas. Selain untuk bangunan infrastruktur, kata T Anwar, dana itu diplotkan pada program Simpan Pinjam Perempuan (SPP), demikian T.Anwar. (b10)

Ismail Tolak PAW Versi Rouchin BLANGKEJEREN (Waspada) : Ismail Muse menolak SK pemberhentian dirinya yang dikeluarkan DPP PPRN versi Rouchin dengan Surat Keputusan Nomor :0111/SK/DPP-PPRN/III/ 2013 tentang pemberhentian Ismail Muse. “Keputusan versi Rouchin adalah illegal dan tidak sah secara hukum,” kata Ismail Muse, anggota DPRK Gayo Lues dari PPRN, Rabu (17/4). Dikatakan, kepengurusan DPD-PPRN pusat hingga saat ini masih dalam perseteruan, tentu saja pada masa sekarang masih mengacu kepada keputusan lama sebelum adanya hasil putusan dari Kementerian Hukum dan Hak Asasi Manusia. “Karena, kubu kepengurusan mereka tidak ada hubungannya dengan saya, hal ini sesuai dan dipertegas laporan MenkumhAM Amir Saymsuddin kepada Presiden tanggal 27 November 2012 dan tembusan kepada DPP PPRN usat 30 November 2012,” jelasnya. Pada point 17 hal 27 dalam surat jelas Menkumham menyatakan bahwa dengan putusan Kasasi No 652/ K/PDT.SUS/2011 tanggal 11 November 2011, maka SK Menteri Hukum dan HAM RI

No.M.HH.17.AH.11.01, tanggal 15 November 2010, tentang pengesahan perubahan AD/ART kepengurusan DPP PPRN hasil Munas –I PPRN di Bandung versi Amelia AYani, tetap sah berlaku sampai saat ini. Ia menilai keputusan yang dikeluarkan DPPPPRN versi Rouchin tidak logis di luar koridor hukum yang berlaku. Sehingga tetap mengacu kepada keputusan lama sebelum keluar keputusan yang baru. Hal ini berdasarkan, tujuh kali keputusan dari Majelis Hakim baik di PTUN, PTTUN Jakarta, PN Jakarta Selatan dan Mahkamah Agung, dari sekian keputusan itu, Amelia A. Yani tetap sebagai ketua umum DPP-PPRN yang telah memenangkan enam dari tujuh keputusan majelis hakim. Arwin, Ketua DPD–PPRN Kabupaten Gayo Lues meminta agar tidak menghiraukan SK Pemberhentian Antar Waktu yang dikeluarkan DPP-PPRN versi Rouchin. Pasalnya, Ismail Muse adalah anggota PPRN di bawah kepengurusan DPP PPRN Amelia A Yani selaku ketua umum, dan bukan anggota dari DPP PPRN versi Rouchin. (cjs)

Pemkab Aceh Selatan Gelar Jumat Bersih TAPAKTUAN (Waspada) : Menjelang pelantikan Bupati Aceh Selatan periode 2013-2018 TSamaIndra-KamarsyahyangdijadwalkanSenin, 22 April mendatang, Pemkab Aceh Selatan, Jumat (19/4) menggelar kegiatan Jumat Bersih. Jumat Bersih berupa gotong royong massal di masing-masing SKPK itu, merupakan instruksi Plh Bupati Harmaini dalam rangka menyambut dan memeriahkan pelantikan bupati terpilih, hasil Pilkada Januari lalu. “Kegiatan ini kembali kita gelorakan dan kita minta semua SKPK, melaksanakan gotong royong massal di lingkungan perkantoran mereka masing-masing,” ungkap Plt Sekdakab

Aceh Selatan Said Azhar, Kamis (18/4), sembari mengatakan instruksi tersebut telah disampaikan melalui surat ke setiap SKPK. Menyangkut dengan persiapan pelantikan bupati, Said menyebutkan tidak ada kendala, termasuk pengiriman undangan kepada pihak terkait, terutama Unsur Muspida plus Provinsi Aceh. “Kita harapkan pelantikan bupati ini dilakukan semeriah mungkin,” paparnya seraya menyebutkan pihaknya telah berkoordinasi dengan DPRK, termasuk kegiatan gladi resik yang dilakukan di gedung dewan, Minggu (21/4) mendatang. (b30)

Pengurus IPHI Bireuen Dilantik BIREUEN (Waspada): Pengurus Ikatan. Persaudaraan Haji Indonesia (IPHI) Bireuen, periode 2012-2017, dilantik Ketua IPHI Provinsi Aceh, Sulaiman Abda, di Masjid Agung kabupaten setempat, Kamis (18/4). Acara yang dirangkai dengan pembukaan manasik haji dan tausyiah yang disampaikan Imam Besar Masjid Agung, Tgk H Muhammad Ishak yang akrab disapa Abon Cot Tarom atau Imum Syiek Masjid Agung, dihadiri, para pengurus IPHI Bireuen yang baru terbentuk, Bupati Bireuen yang diwakili Asisten III, Zulkifli dan sejumlah pejabat Pemkab setempat lainnya, diawali dengan pembacaan SK pengurus dan pidato pengurus lama. Adapun pengurus IPHI Bireuen yang dilantik adalah, Ketua Penasehat, Tgk H M.Amin Mahmud, wakilnya, Tgk H Hasanoel Basri, Sekretaris Tgk H Muh Yusuf A Wahab, Lc dan anggotanya adalah, Tgk H Nuruzzahri Yahya, Tgk

H Muhammad Ishaq. Kemudian, ketua pembina, yaitu, H Ruslan HM Daud, wakilnya, Ir H Mukhtar Abda, MSi, sekretarisnya, Drs H Zulhelmi Arahman, MAg dan anggotanya, Drs H Ismail Sarong, H Syamun Arifin. Selanjutnya, pengurus hariannya, ketuanya adalah, H.Ahmad B Namploh,S.Sos, wakil ketua I Drs H Abdullah Amin,MM, II H Yusri Abdullah ,S.Sos, III H Zainuddin Daud. Sekretarisnya, H Jufliwan M,AB, SH.MM, Wakil Sekretaris 1 adalah, Drs H Mukhtar AR, H Lahmuddin Ismail,SAg, H Abdullah Kasem,SE. Selain itu, Bendahara H Mukhtar Yusuf, wakil I H.Basri AR, II H Baharni A,Rany SH. Sekretaris III IPHI Bireuen, H Abu Bakar Kasem, SE kepada Waspada di sela-sela acara pelantikan mengatakan. “Setelah acara pelantikan dilanjutkan dengan tausyiah dan ditutup dengan acara munasik haji,” katanya. (cb02)

Dapat Dukungan Dayah

Abdurrahman BTM Kembali Daftar Jadi Anggota DPD BANDA ACEH (Waspada): Abdurrahman BTM, anggota Dewan Perwakilan Daerah (DPD) Asal Aceh periode 2009/2014 kembali mencalonkan diri sebagai calon anggota DPD Asal Aceh periode 2014-2019 mendatang di kantor KIP Aceh, Kamis (18/4). Pendaftaran Abdurrahman BTM, yang juga pimpinan Dayah Fathurrahman di Aceh Timur ini turut didampingi para pimpinan dayah dan sejumlah ulama, santri dan juga mahasiswa. Senator asal Aceh ini langsung mendaftarkan diri ke sekretariat pendaftaran dengan membawa berkas persyaratan yaitu fotocopy KTP. Abdurrahman BTM menga-

ku maju kembali setelah adanya dukungan dari pimpinan-pimpinan dayah di Aceh, diakui BTM, pada periode mendatang kewenangan DPD RI akan jauh lebih besar dibandingkan dengan periode sebelumnya, hal itu bedasarkan putusan dari Mahkamah Konstitusi (MK). Selain itu, menurut BTM, selama ini pihaknya aktif menjembatani kepentingan pemerintah daerah dengan pemerintah pusat. “Kita maju karena ada dukungan dari dayah dan masyarakat serta mahasiswa, dan kita siap menjembatani antara daerah dan pusat dalam segala bidang, dan membangun Aceh

menjadi lebih baik,” terangnya. Abdurrahman BTM dengan khas sorban di kepalanya meski telah menjadi anggota DPD RI di Senayan, Abdurahman BTM masih sering mengunjungi dayah-dayah di Aceh untuk melihat perkembangan. Ia menambahkan saat mendaftar ke KIP Aceh menyerahkan 4.162 lembar fotokopy KTP sebagai persyaratan pendaftaran calon anggota DPD. KTP tersebut berasal dari 19 kabupaten/kota di seluruh Aceh. Pendaftaran calon anggota DPDAsalAceh,hinggahariKamis (18/4) sudah ada delapan orang yang mendaftarkan diri sebagai calon anggota DPD RI. (cb01)

Kotak Amal Dicuri OTK NAGAN RAYA (Waspada) : Kotak amal Masjid Nurul Ihsan Desa Serbajadi, Kecamatan Darul Makmur jadi sasaran pencuri, Kamis (18/4) pukul 01:30 oleh dua OTK. Muhono pang Ulu Masjid Nurul Ihsan, Desa Serbajadi, yang dihubungi Waspada mengatakan, peristiwa terjadi sekira pukul 01:30 saat pihaknya sudah tidur. ‘’Saat itu saya sudah tidur, istri saya mendengar ada suara sepedamotor berhenti di depan masjid. Lalu saya dibangunkan istri langsung menuju pintu terlihat depan masjid ada dua orang tak dikenal sedang mengangkat celengan terus dibawa kabur,’’katanya. Dua OTK itu datang ke masjid dengan menggunakan sepedamotor. Menurut Muhono, tabungan sudah lama tidak pernah dibuka dan diperkirakan ada sekira Rp 700 ribu yang berhasil dibawa kabur OTK. .(cb07)


Waspada/Abdul Mukthi Hasan

KETUA IPHI Aceh, H Sulaiman Abda melantik pengurus IPHI Bireuen di Masjid Agung Bireuen, Kamis (18/4).

Polisi Buru Agen Ganja PEUREULAK (Waspada): Satuan Narkoba Polres Aceh Timur meringkus seorang agen ganja di Desa Alue Nibong, Kecamatan Peureulak Kota, Aceh Timur, Kamis (18/4) sekira pukul 00:30. YP, 50, warga Gampong Alue Nibong, Kecamatan Peureulak Kota, Aceh Timur, selama ini telah meresahkan masyarakat setempat dan sekitarnya, bahkan warga sekitar mengecap tersangka selama ini berprofesi sebagai pedagang ganja.

Kapolres Aceh Timur AKBP Muhajir melalui Kasat Narkoba AKP Adi Sofyan kepada Waspada menjelaskan, penangkapan tersangka berawal dari pengerebekan rumah tersangka di desa dan kecamatan setempat. “Dalam penggerebekan berhasil diamankan seorang pengedar daun ganja kering bersama ganja kering sebanyak 21 amplop kecil dan 1 bungkus paket ganja amplop besar senilai Rp50.000 dengan berat seluruhnya lebih kurang 1,2 on,” kata AKP Adi Sofyan. (b24)

Gajah Liar Tak Bisa Dibiarkan

Waspada/Gito Rolies

ABDURRAHMAN BTM, anggota Dewan Perwakilan daerah (DPD) foto bersama ulama dan pimpinan dayah, santri di Kantor KIP Aceh saat mendaftar menjadi calon DPD RI, Kamis (18/4)

IDI (Waspada): Sekdakab Aceh Timur Bahrumsyah menegaskan, amukan gajah liar yang merusak areal perkebunan milik masyarakat di kawasan pedalaman Kecamatan Ranto Peureulak tidak bisa dibiarkan terus. “Persoalan ini akan segera kita sampaikan kepada Bupati AcehTimur dan langkah pertama melakukan koordinasi dengan instansi terkait termasuk BKSDA Aceh, Muspika dan TNI/Polri,” ungkap Bahrumsyah, Rabu(17/4). Menurutnya, koordinasi dengan unsur terkait sangat penting karena proses pengusiran

gajah liar dari hutan perkampungan masyarakat untuk dikembalikan kehabitatnya memungkinkan juga harus menggunakan suara letusan baik itu secara tradisional maupun dengan suara tembakan. Belasan hektare areal perkebunan kelapa sawit dan karet milik warga Gampong Seumanah Jaya, Kecamatan Ranto Peureulak, Kabupaten Aceh Timur beberapa hari lalu kembali dimakan dan dirusak kawanan gajah liar yang berdiam di kawasan hutan setempat. (cri)


Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Matsum II Ar-Rahim Ranting Halat Kota Matsum Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arja Gg. Jawa No. 46 Lingk. III Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Mukhlishin Jl. Sutrisno Gg. Sehati No. 8 Al-Manar Jl. Laksana No. 47 Al-Makmur Gg. Langgar/Bahagia No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Darul Ikhlas Jl. Batu No. 13 Kel. Sei Rengas Permata Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 36 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Sukaramai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Khalid Ibnul Walid Jl. Rahmadsyah No. 366 Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Gedung Arca No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Nurul Huda Jl. Denai Gg. Pinang No. 12 Tegal Sari-I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gg. I No. 2 Kel. Tegal Sari I Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah No. 181 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Salam No. 26 Taqwa Jl. A.R. Hakim Gg. Langgar No.8-A. Tegal Sari III Taqwa Jl. Puri No. 183 Kompleks Mesjid Taqwa Taqwa Lalang Jl. Gedung Arca Gg. Sehat No. 8

MEDAN HELVETIA Drs. Tarmizi Lubis Robi Fanreza, S.Pd.I Heri Siswan, S.Ag Mohd. Soleh, S.Pd.I H. Syamsuddin Panarik Ibnu Hajar Harahap Drs. Zabir Drs. H.M. Kasim Yusuf Drs. H. Legimin Syukri Drs. H. Agus Taher Nasution Kustanto Drs. Ade Mustahdi Ali Drs. H. Fandi Filham Lubis M. Nurdin Muhammad, BA Ruslaedy Nur Al-Hafizh Drs. H. Abidin Azhar H. Darwin Zainudin, MA Drs. H.Mashudi Hajar H.M. Yusri Indra, Lc Drs. Syaridin Tanjung H. Zulkifli Damanik Drs. H. Armen Tanjung Alang Siddiq, MA Ihsan Jawadi, Lc M. Kholiq Nasution, S.Pd.I Drs. Mar’i Batubara Drs. H. Kamidin Selian Drs. Amri Susanto Drs. H. Azizi, S.Pd.I Drs. Ali Nurdin Guci, MA Ir. Erwandi Drs. Sartoni Drs. H. Masyaluddin Berutu Drs. Umar Khatib Deflizar Nasution, S.Pd

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Harjosari II Al-Huda Jl. Bajak I No. 2 Kel. Harjosari II Al-Hidayah Mapolda Sumut Jl.S.M.Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hikmah Jl. Garu II B Kel. Harjosari I Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu I No. 69 Kol. Harjosari I Jami’Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Kompl. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Bali Ramadhan Jl. Garu VI Kel. Harjosari I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Gg. Pulau Harahapan No. 1-B

Drs. H. Khairuddin Siregar A. Kosim Daulay, BA H. Azanus Shauty, SHI Ahmad Fauzi Lubis, S.Ag M. Arsyad Roni Irwanto, S.Sos Drs. Basyruz Zaman Hasibuan Drs. Ramli, AT. Drs. H.M. Yahya Tambunan Said Ismail Drs. K. Muhyiddin Masykur Drs. Ismail Yahya Drs. Syawaluddin Harahap Hasbi Al Mawardi Lubis, S.Pd.I Drs. Pangeran Harahap, MA Drs. Askolan Lubis, MA Drs. H. Ahdar Bunaiya Hrp. Drs. H. Syahroni Husin Rafdinal, S.Sos, M.Ap.

MEDAN BARU Agung Jl. P. Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Ikhwanul Ikhlas Jl. Batu Gingging No. 12 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. Pardede No. 42

Prof. Dr. H. Hasan Bakti Nst., MA Muhammad Amin, S.Ag, S.Pd.I Dr. H. Ardiansyah, MA Drs. Lsiman Lubis Azwil Man, S.Ag Drs. Mukhtar, MA H. Syafii Umar Burhanuddin Harahap, S.Ag

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 19 At-Taqwa Jl. Puteri Hijau No. 14 Al-Ikhlas PT. Kereta Api Indonesia Jl. Prof.HM Yamin 14 Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Massawa Jl. Temenggung (Arab) No. 2-4-6 Al-Wiraji Jl. Karya Ujung Gg. Sosro Lingk. XVI Kel. K.B. Baitusy Syifa Jl. Putri Hijau No. 15 Jami’ Jl. Merdeka No. 3 P. Brayan Kota Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Maraset Jl. Sei Deli No. 139 Kel. Silalas Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Rabithatul Muslimin Jl. K.L. Yos Sudarso Lorong 14-A Syuhada Jl. Danau Toba No. 2 Kel. Sei Agul Taqwa Jl. Karya Gg. Madrasah No. 24

Drs. H. Bahrum Hsb., MA Musohur, S.Ag H.M. Fahmi Amal J.P. Pasaribu H. Syamsul Anwar Prof. DR. H. Hasan Bakti Nst., MA Drs. Indra Suheiry H. Wahyudi, Lc H. Zulfikar Hajar, Lc H. Ismail Malik Drs. Fuji Rahmadi P, MA Drs. Nuhyaman Lubis Rahmad Siregar, S.Pd.I H. Surianda Lubis, S.Ag Drs. Syamsuri Matondang Fuji Rahmadi, M.Ag Drs. Abdul Kadir Jaelani

MEDAN BELAWAN As-Sa’adah Kel. Belawan Bahagia Jamik Belawan Jl. Selebes Belawan Taqwa Jl. Veteran Belawan Raya Taqwa Belawan

H. Ilham Maulana, S.HI H. Zakaria Rasidi Gunawan, S.Pd.I Drs. Sunaryo

MEDAN DELI Amaliyah Jl. Pancing Pasar IV Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Rahim Jl. Simpang Tanjung No. 1-A Ar-Ridha Komp. TNI-AL Jl. Alumunium Raya Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Abu Qosyim Jl. Mangaan VIII Lingk. I Mabar Hilir Al-Amin Jl. R.P. Hewan Lingk. III Kel. Mabar Hilir Al-Amanah Jl. K.L. Yos Sudarso No. 638 Kel. Tg. Mulia Al-Qurqaan Jl. Alfaka Raya/Sp. Alfaka VIII Lingk. VI Al-Fithriyah Jl. Kawat II Kel. Tg. Mulia Hilir Al-Ikhlas Jl. Alumunium III Lingk. XII Kel. Tg. Mulia Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Darussalam Jl. Suasa Selatan Lingk.IX Kel. Mabar Hilir Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jam’iyyatush Shoolihiin Kel. Tg. Mulia Nurul Iman Lingk. 27 Tg. Mulia Nurul Ikhsan Jl. Mangaan I Lingk. VIII Mabar

A. Yani Drs. Paino Drs. Musdar Syahban As’ad Marlan, MA Drs. H. Dharma Bakti H. Zaenal Arifin Edi Syaputra H. Ahmad Hasan, SE Drs. Yusril Fuad, MA Drs. H.M. Soleh Adri Drs. H. Ibrahim Drs. H. Nurman, S. Abd. Kadi Hasibuan, S.Pd.I H. Sairin Irwanto Susilso, S.Pd Drs. Zakaria Batubara Bahaudin, S.Ag H. Abdul Majid

MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala At-Thoharah Jl. Raya Medan Tenggara Kel. Binjai Al-Anshor Jl. Raya Medan Tenggara Gg. Anshor Al-Falah Jl. Rawa Ujung No. 298 Lingk. XIII Tegal Sari Al-Hidayah Jl. Bromo Gg.Masjid Al-Hidayah Kel. Binjai Al-Hasanah Perumnas Mandala Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Muhajirin Jl. Garuda II Perumnas Mandla Al-Muqorrobin Jl. Raya Menteng Kel. Binjai Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahim Jl. Pelajar Timur Gg. Darno No. 5 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl.Selamat Ujung Gg. Subrah S. Limun Jannatul ‘Alim/Musholla Al-Muttaqim Jl. Pancasila Muslimin Jl. Selam II No. 47 Tegal Sari Mandala I Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lr. Sedar Nur Hidayah Jl. Datuk Kabu No.17BGg.Masjid No.11-C Nurul Hidayah Jl. Tangguk Bongkar 2 Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Seksama Gg. Rela No. 10

Aminuddin Siregar Drs. Ade Mustahdi Al Hafiz Husni, S.Pd.I H. Abdullah Sani, Lc, S.Pd.I Drs. Supardi Lubis Drs. H. Aslam Umar Drs. H. Sakira Zandi, M.SI Irham Taufik, S.Pd.I Drs. Helmi Walid, MA Drs. H. Agus Salim Pardede Drs. H. Muslim Lubis, SH, MA H. Hamid Rangkuti, BA Drs. H. Basyirun Yahya Drs. H.Waldemar Chazali Pasaribu Drs. Usman Batubara Drs. Amri Susanto H.M. Silahuddin, S.Pd.I Sahrul Nasution, MA Astra Wahyudi, SH Drs. H.A. Taufik Lubis Drs. Syahrun Purba Drs. Ahmad Suhaimi, M.Pd H. Rahmad Asril Pohan, Lc, MA Prof. Dr. Ir. Rafiki Tanwomi, Msc DR. Sudirman, Lc, MA Drs. Sapri Chan, MA Drs. Tanwir Siagian Husni Mubarok Nasution, MA

Ar-Raudhah Jl. Persatuan No. 22 Helvetia Timur Asmuri Hafiz, S.Pd.I Ar-Ridho Jl. Pembangunan No. 128 Helvetia Timur Abdul Mutolib, S.Ag As-Syakirin Jl. Gaperta I Kompl. TNI-AD Gaperta Drs. H. Hamid Mashudi As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Drs. Faisal Lubis At-Taubah Jl. Pasar II Kel. Cinta Damai H. Alhuddan Nasution, S.Sos.I Aththolibin Husni Jl. Veteran Gg. Utama Desa Helvetia H. Syamsul Bahri Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. H. Mukhlis Lubis Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Drs. Idris Ginting Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Drs. H. Hazarat Ibrahim Al-Hasanah Jl. Setia No. 41 Tg. Gusta Drs. H. Irham Hasibuan Al-Hasanah Jl. Istiqomah Helvetia Timur Saparmin Al-Ikhlas Jl. Bakti Luhur No. 13 Drs. Idrus Uteh Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Drs. Hasanul Arifin Al-Ikhlas Jl. Jongkong Kompl. Dolog SU Lingk.I, II, III Drs. H.M. Ridwan Siregar Al-Mustaqim Jl. Kapten Muslim No. 226 Drs. H. Syahron Sulaiman Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 H. Sarwo Edy, S.Ag Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Wildan Harahap Bahrul Ulum P4TK Jl. Setia Budi No. 75 Drs. Ahmad Kamil Darussalam Jl. Asrama No. 11 H. Maskam Elba, BA Istiqomah Jl. Amal Luhur No. 65 Kel. Dwikora Drs. H. Abdul Hadi Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Drs. Najamuddin Lubis Khasyiim Jl. Karya Ujung Pasar III Drs. Syamsul Bahri Nurul Iman Jl. Sumarsono Dusun V Jumarik Shilaturrahmi Jl. Perkutut Lingk. XXII Kel. Helv. Tengah Drs. H. Muchtar Baijuri Tjut Nyak Dhien Jl. Gatoat Subroto/Jl. Rasmi No. 28 Drs. Ahmad Jais, MA Taqwa Jl. Kamboja Raya No.319 Blok 4 Perum. Helvetia Drs. Suprapto Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Syahrul, AS Taqwa Jl. Setia No. 30 Tanjung Gusta Drs. A. Tanjung Taqwa Jl. Kapten Sumarsono Gg. Safar Pasar II Drs. H. Budiman Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah M. Ali, S.Ag, MA Umar Bin Khattab Jl. Kalpataru Kel. Helvetia Timur Rajuddin Sagala, S.Pd.I MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Annazhirin Jl. Karyawisata, Gedung Johor Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Ar-Raudhah Kompl. Rispa I Blok V Kel. Gedung Johor Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Al-Amin Jl. Eka Surya Gg.Kencana Lingk. XI Kel.Gd.J. Al-Badar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. STM Suka Ikhlas Kel. Gedung Johor Al-Ikhlas Jl. Eka Suka Raya No. 18-A Kel. Ged. Johor Al-Ikhlas Jl. Karya Tani Lingk. VII Kel. Pkl. Masyhur Al-Ihsan Jl. Suka Tabah No. 15 Al-Muslimin Jl. STM Suka Luhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlishin Jl. Karya Sehati No. 14 Kel.Pkl. Masyhur Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanus P. Masyhur Daurun Nur Jl. Suka Eka No.221 Lingk.XI Kel. S.Maju Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. V Kel. P. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Kel. P. Masyhur Sholihin Jl. Karya Jaya No. 160-C Taqwa Jl. Brigjen Zein Hamid Gg. Sado Titi Kuning

Drs. H. Syarifuddin Hasan Drs. H. Nasrun Zakaria Drs. H. Khairuman Arsyad, M.Hum Sofyan Daulay, S.Pd.I Drs. Ahmad Saukan Drs. Marjan, A.N. Azman, S.HI Abdullah Baihaqi, S.Fil.I Bukhori, S.Pd M. Nasir Anshori, S.HI Drs. Abd. Rahman, M.Pd Drs. H. Imami Isa Najib Drs. Abd. Amir Dalimunte Drs. H. Khaidir Lubis Ridwan, S.Pd.I Drs. H. Ade Fifan H. Bambang Irawan, S.Ag Arifin, S.Ag Drs. Mauddin Nasution H.M. Rasyid Ridho Siregar Defrizal Lubis, S.Pd.I Drs. H. Sueb Saragih Indra Laksamana Muda, S.Pd.I Drs. Usman Hasibuan, SH A. Faisal Drs. H. Syamsul Basri Tamar H. Kamil Harahap, S.HI, MA Drs. H. Muniruddin, MA T.M. Hasbi Drs. Ishaq Ahmad Ahmad Ridwan Rangkuty Nazri Nasution, S.Ag Pamonoran Siregar, S.Pd.I M. Rojali H.M. Tuah Sirait, mA Drs. Ali Imran Rokan H.M. Rajikin

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Muttaqin Jl. Amaliun/Paduan Tenaga Gg. Tengah Al-Muhajirin Jl. Bajak II H. Gg. Nasional Lingk. IX Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Jami’ Teladan Jl. Gembira No. 2 Teladan Barat Mu’allimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Turi Gg. Sepakat No. 5 Kel. Teladan Timur Thawalib Jl. S.M. Raja Gg. Thawalib No. 11 Yayasan Zending Islam Indonesia Jl.S.M.Raja No. 11

K.H. Khaidir AW, Lc, MA H.M. Nur Abduh, MA Drs. M. Syafi’i Nasution Drs. Zulkifli Drs. Suid Alam Drs. M. Alwi Batubara M. Irsyad Khairul Insan, S.Ag Drs. Mustafa, E. Fakhrul Rozi, M.Pd Drs. A. Dairobi Batubara H. Ruskhan Nawawi, SM, MA Prof. DR. Nawir Youslem, MA Drs. H. Jalaluddin Hasibuan Drs. H. Chaidir Tanjung Drs. H. Khudri Lubis Barmawi, S.HI Dariun Harahap, BA Dr. M. Qorib, MA Sudirman, Lc Drs. H. Abdul Razak Edi Lazuardi Harahap, S.Pd.I

MEDAN LABUHAN Al-Husain Jl. Raya Griya Martubung Kel. Besar Al-Istiqomah Blok IV Griya Martubung Kel. Besar Al-Mukarramah Kampung Besar Darat Kel. Martubung Baitul Ikhwan Jl. T.Lestari 12/198 Blok V Gr. Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No.27-A Psr. V Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Silaturrahmi Jl. Tangguk Damai Blok III Gr. Martubung

Drs. Wajdi Khair Drs. H. Sugiman, S. Drs. M. Syafi’i, M.S. H. Amaluddin Syatria Wiraprana, S.Pd.I Drs. H. Ahmad Nasution, M.Pd Drs. Adlansyah

MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Al-Mukhlish Jl. Bahagia No. 14 Kel. Sukaraja Al-Mujtahidin Gg. Lori Kampung Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Nurul Huda Jl. Birgjen Katamso Gg. Netral Nurul Muslimin Jl. Juanda (Bundaran) Kel. Jati Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Kampung Baru Jl. B. Katamso Gg.Masjid No. 53 Jami’ Aur Jl. Brigjen Katamso No. 32-D Kel. Aur

Bukhari Muslim Ahmad Fauzi Lubis, S.Ag Ahmad Ilyas, S.Ag Drs. H.M. Joyo Dr. H.M. Musnan Lubis, MA Drs. M. Syahrawi Muhamjist Hariyanto, M.S. Drs. Hasan Muin Mukhlis Muaz, S.HI Drs. H. Hafiz Ismail H. Jami Assyuti Idris, Lc

MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Barokah Jl. Kapt. Rahmad Buddin Gg. Mangga Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Marelan Jami’atul Khairiyah Jl. Marelan VII Kel. Tanah 600 Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Kampung Tengah Lingk. IX Terjun Taqwa Pasar 3 Timur Regas Pulau Marelan

Syahruddin, S.Pd.I Drs. Bambang Sugianto Drs. Junaidi Nurjaya, S.Ag Hasanuddin, S.Pd.I Abd. Rosyid, S.Pd.I M. Iqbal, S.Pd.I Drs. Dalail Achmad, MA

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahmah Jl. Gurilla Gg.Melati No.5 Kel. S.Kerah Hilir Ar-Ramlah Jl. Sejati No. 16 Kel. Sidorame Barat Ar-Ridho Jl. Rakyat No. 33 Kel. Sidorame Timur Al-Amin Jl. Prof. H.M. Yamin SH, No. 482 Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 3 Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Huda Jl. Malaka No. 117 Al-Hidayah Jl. Pahlawan Gg. Anom No. 12 Lingk. III Al-Hikmah Jl. Malaka Gg. Saudara Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Al-Mukhlishin Jl. G.B. Josua No. 8 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5

Drs. Syahlul Amri Harahap H. Fachrurrozi Pulungan, SE Drs. Mansur Situmorang H.M. Daud Sagita Putra, S.Ag Drs. Musdarsyahban Prof. DR.H.Ramli Abdul Wahid H. Bustami H. Burhanuddin Noor, Lc H.A. Sori Monang, Lc, MTH Nazir Hidayat, S.Ag Dr. H. Nikmet Nst., M. Kes Hasburrahman, S.Pd.I Drs. Ali Imran Siregar Drs. Mansyur Drs. Ibrahim Nor

Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Ikhwaniyah Jl. M. Yacub No. 3 Istiqomah Jl. Bambu Runcing/Pahlawan Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Jamik Al-Ikhwan Jl. HOS Cokroaminoto Kel. S.K. Hulu Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat I Taqwa Asrama TNI-AD Glugur Hong Kel. S. Barat I

WASPADA Jumat 19 April 2013 M. Fahmi Marzuqi Hsb., S.Pd.I Ir. H. Sahrul Fauzi, S.MSC Drs. H. Hayat Harahap Jainul Imran, S.Ag Azwan Khaidir Nasution Drs. Ikhsan Asri, MA Drs. H. Syamsul Tamar Drs. H.M. Sinambela Drs. H.M. Efendi Batubara Drs. Abu Bakar Siregar

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. SPT II Annas Jl. Ibus Raya/Jl. Rotan Kompleks Diskes Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 18 Kel. Sei Putih Timur Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Mukhlisin Jl. Sei Rokan No. 2 Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Al-Yasamin Jl. PWS Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Petisah Tengah Tagarrub Jl. Darussalam No. 24 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Drs. M. Idris Ritonga, M.Pd Drs. H.M. Samin Pane Dr. H. Harun Ar-Rasyid, ME Khairul Saleh, S.Sos H. Najib Sanusi Husin Lubis H. Usman Lubis Drs. H. Mahmuddin Sirait Drs. H. Darwansyah Simanjuntak H. Safriandi, MA Dr. Achyar Zein Gea, MA Drs. H. Azhar Anwar H. Jamaluddin Juned, Lc Drs. Abd. Majid H. Sutan Syahrir Dalimunthe, MA Drs. Irwan Sulaiman Drs. M. Yusuf Tanjung

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Al-Hidayah Jl. Starban Kel. Polonia Al-Hidayah Jl. Komodor Udara Adi Sucipto Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Al-Ikhlas Jl. Sejati No. 08 Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No. 11 Kel. Anggrung Dirgantara Jl. Imam Bonjol No. 52 P. TNI AU Soewono Hidayatullah Jl. Dc. Musi Lingk. I Kel. Sukadamai Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Sabilillah Komp. TNI-AU Karang Sari-I Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

M. Amin, S.Ag, S.Pd.I Ali Hamzah, S.Sos Ahmad Suhardi, S.Pd.I Ahmad Bardan Ahmad Ilyas, S.Ag H. Effendy Sadli, SE, MA Drs. H. Khairuman Arsyad, M.Hum Drs. Muntaqo Drs. Nasib Selmi Drs. H. Zahiruddin Nst., MA Drs. Syahrul Harahap

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Arifinsyah Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Mahluddin Hasibuan Al-Ghufron Jl. Suka Baru No. 21 Kel. PB Selayang I Drs. Mahyuddin Daulay Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Rustam Harahap, S.Pd.I Al-Ikhlas Pasar V Tg. Sari H. Nazaruddin Hasibuan Al-Ikhlas Pasar 7, Padang Bulan Muhammad Arifin Nst., S.Pd.I Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 M. Sopan Hasibuan, S.Pd.I Jami’ Jl. Pasar I Lingk. VIII Tg. Sari H. Salman Alfarisi, Lc, MA Muslimin Jl. Setia Budi Kel. Tg. Sari Heri Fitrian, S.Sos.I Nabawi Jl. Bunga Mawar XIV Son Haji Harahap, S.Ag Nurussalam Jl. Bunga Cempaka Pasar III Drs. H. Basyaruddin Dja’far Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Ridwan Abbas, SH Nurul Iman Jl. Penerbangan No.77 Komp.Perhubungan H.M. Rajab A. Masweil Nst., Lc Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. P. Bulan Ramli Kardi Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Arifin Nasution, S.Pd.I Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Abdul Roni, S.Ag Taqwa Jl. Bunga Wijaya Kesuma Gg. Masjid No. 1 H.M. Yahya Taqwa Jl. Abdu Hakim No. 2 Pasar I Tg. Sari Drs. Nizar Idris Taqwa UMA Kampus II Jl. Setia Budi No. 79 79-B Drs. H. Supardi, MA MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei. S. At-Taqwa Makodam I/Bukit Barisan Jl. Binjai Km. 7 Al-Badar Jl. Binjai Km. 6,8 Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Ikhlas Jl. Binjai Km. 16,5 Dusun I Aman Damai Al-Islamiah Jl. Binjai Km. 14,5 Gg.Gembira DS. V Diski Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Istimomah Dusun I Desa Pujimulio Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Tanjung Rejo Al-Mujahirin BBLKI Medan Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Dermawan Jl. Rajawali No. 19 Sei Sikambing-B Ikhwanul Muslim Dusun VII Gg. Damai Desa Paya Geli Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Utama No. 20 Kampung Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg Rejo Jami’ Jl. Masjid No. 6 Tg. Rejo No. 6 Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik M. Jayak Jl. Jend. Gatot Subroto Km.5,5 No.184 Lama Raudhatussuffah Jl. TB. Simatupang (P. Baris) Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir Lima No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km.13,7 P.Besar Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Sugengrejo Jl. Merpati Gg.Mushola Sei. S-B

Drs. Ali Suti Nasution Asman Ali Nur, Lc Mayor Caj Drs. H. Wendrizal Drs. H. Romsil Harahap H. Fajar Hasan Mursyid, Lc, MA Mar’an Sabuki Siregar, S.Fil.I Drs. Makshum Harahap Drs. M. Yusuf AR, M.Ag Arman Nasution Mhd. Nazib Syafi’i Drs. H. Poniman, S. Drs. Lili Suheiri Prof. Dr. H. Amroini Dradjad, MA Drs. H. Syarifuddin, D. Sodiqin, S.Ag Drs. Ardiansyah Dr. H. Abdullah, AS. Radiaman Saragih, S.Pd.I Drs. H. Mahmuddin Sirait Drs. H. H. Rafli Hasan H. Fuad Husein, Lc, MA M. Natsir DR. H. Akhyar Zein, MA H. R.M. Syafi’i, SH, M.Hum Drs. Zulkarnain Drs. Nazamuddin Syafruddin, H. Affan Suaidi, MA Drs. Saleh Rambe Ardiansyah, S.Ag Ahmad Nasir Daulay, S.Ag H. Misto, AR Drs. H. Samin Pane, MA H.M. Rokib Mas Drs. Khalidin Musa Drs. Asqaelani Pulungan

MEDAN TIMUR Arrahim Jl. Purwosari Gg. Masjid/Puskesmas P. Brayan Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara, Puro Brayan Bengkel As-Sholah Jl. Pendidikan No. 39 Glugur Darat-I Al-Barkah Jl. Setia Jadi Kel. Glugur Darat I Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Hidayah Jl. Karantina Gg. Pasaman No. 2 Kel.Durian Al-Iman Jl. Sidang Raya, Kompl. DPRD Tk.I P.B.Bengkel Al-Ikhlas Jl. Muara Sipongi Kel. Gaharu Al-Ikhlas Jl. Madiosantoto No. 197 Lingk. 14 P.B. Darat Al-Ikhwan Jl. Prajurit No. 28 Lingk. XI Gg. Bali Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Simpang 6 P. Brayan Bengkel Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Baitul Mukminin Lingk. VIII Pulo Brayan Darat I Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Syuhada Jl. Budi Pengabdian No. 2 P. Brayan Kota Taqwa Jl. Bilal Gg.Keluarga No.74 Kel. P.Brayan Darat I Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian

Wan Abdullah H.M. Syahnun, MS Drs. Dasuki Simangunsong Drs. Ajran Tanjung, S.Pd.I Drs. Zainal Arifin Purba, MA Drs. Abd. Halim Efendi Siregar Drs. Sudirman Drs. H. Sokon Saragih Drs. Hamdan Manurung Drs. H. Lahmuddin Ritonga Prof.Dr. Lahmuddin Lubis, Med. Drs. Syamsuddin Bahri Panjaitan Hamzah Syarwan Nasution, S.Ag Drs. H. Dahron Hasibuan H. Khoirul Djamil M.Yaman, Lc, MA M. Yusuf, S.HI Drs. H. Nurman Almi Drs. Nazamuddin H.M. Nurwahabi, S.Pd.I Ahmad Harahap, BA H. Hasrat Effendi Samosir, MA Drs. Nasiruddin Drs. H. Azwardin Nasution H. Akhyar Nasution, Lc, MA Drs. H. Burhanuddin, MA DR. Ali Imran Sinaga, MA Winda Kustiawqan, S.Ag, MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Maragading Hakim Siregar, S.Ag Ar-Rahman Jl. Durung Gg. Aspin H. Naharman, S.Ag Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. H.T. Yusuf Ar-Ridho Jl. Jati Psr VIII Dusun X Gambir Desa B.Klippa Drs. Maragading Nasution Ash-Shobirin Jl. Pukat Banting II (Mestika) No. 45 Drs. Yusuf Siregar An-Nurul Hakimiyah Tembung Jl. M. Ya’kub No. 51 Reza Nauli, A.Md At-Tawwabin Jl. Pimpinan No. 1 Drs.H. Abdullah, M.SI Attholab Man-1Jl. Willem Iskandar No. 7-B M. Arsyad Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Drs. H. Taharuddin, AG Al-Bayan Jl. Gurilla No. 10 Drs. Burhanuddin Hrp., M.Pd (Bersambung ke hal.C8 )

Mimbar Jumat

WASPADA Jumat 19 April 2013


Wanita Dalam Islam Tatkala Islam datang, dihapuslah penindasan terhadap wanita. Islam datang untuk memanusiakan wanita. SETIAP tanggal 21 April bangsa Indonesia memperingati hari Kartini. Keberadaan Kartini menjadi simbol kebangkitan wanita Indonesia dari keterpurukan, kebodohan dan kemiskinan. Sekarang ini Kartini menjadi simbol eman sipasi wanita diberbagai bidang baik sosial, politik dan ekonomi. Wanita menjadi mitra sejajar kaum lelaki di berbagai bidang kehidupan. Agama Islam sangat memuliakan wanita. Sebelum datangnya Islam, nasib wanita sangat menyedihkan. Bangsa Yunani dan Romawi memperdagangkan wanita di pasar-pasar. Wanita dinyatakan sebagai hasil kotoran perbuatan setan. Pada waktu itu para pemikir Yunani banyak berselisih paham tentang pandangan mereka terhadap wanita.Mereka mempertanyakan apakah benar wanita merupakan mahluk yang mempunyai ruh dan nafsu sebagaimana halnya kaum pria. Para pemikir di Roma yang dijadikan panutan oleh masyarakatnya menetapkan bahwa sebenarnya wanita adalah binatang najis yang tidak mempunyai ruh dan tidak diperkenankan bertapa. Tetapi wanita wajib beribadat dan berbakti dengan syarat harus menutup mulutnya. Mereka dilarang berbicara dan tertawa karena hal itu merupakan perangkap setan. Pada tahun 586, Prancis menyatakan bahwa pada hakikatnya kaum wanita adalah manusia yang khusus diciptakan untuk melayani kaum laki-laki. Maka pada abad pertengahan, kaum wanita berada pada puncak kondisi paling buruk. Mereka tidak dapat berbuat banyak terhadap hak-

Nyai Ahmad Dahlan penggagas kelompok pengajian yang sekarang terkenal dengan Aisyiyah. haknya. Hal ini berlangsung sampai revolusi Prancis. Kendati demikian, wanita tetap saja dalam kondisi yang menyedihkan. Pada masa jahiliyah, wanita hidup dalam keadaan sulit. Masyarakat jahiliyah tidak meng-

hendaki kelahiran wanita. Diantara mereka ada yang mengubur bayi perempuan hidup-hidup. Sementara yang lain ada yang membiarkan wanita hidup, namun dalam kehidupan yang nista dan

Pendidikan Sebagai Silent Revolution Oleh Yose Rizal, S.Ag, MM Kepala MAPN 4 Martubung Medan, Wakil Direktur PPMDH TPI Medan Pemerhati Khusus Bidang Pendidikan Sumatera Utara


agi –lagi penulis tidak bosannya membahas Inggris, Perancis termasuk juga Indonesia. Tidak lependidikan yang ada di Negara kita ini, karena bih dari 30 tahun, Malaysia sudah bisa mencicipi hapenulis sangat kecewa dengan apa yang terjadi sil kebijakannya. Hari ini, suara Malaysia sudah mulai terkait pelaksana pendidikan kita ini, sebelum kita diperhitungkan dalam percaturan politik internamenelaah jauh kebelakang, kita fahami dahulu tional. Inilah yang penulis maksudkan sebagai Silent bahwa revolusi selalu di identikkan dengan pertum- Revolution ( Revolusi Diam). Melalui pendidikan, bapahan darah, meski tidak sedikit negara yang berhasil nyak perubahan yang bisa dilakukan. Bayangkan saja merevolusi masyarakatnya tanpa melalui jalur militer jika setiap tahun kita menghasilkan tamatan SMA dan pertumpahan darah. Turki misalnya, abad ke 21 sebesar 7 juta orang, maka dalam 30 tahun kita bisa adalah contoh kasus yang sangat jelas. Semua tahu menghasilkan 21 juta jiwa. Jika ke 21 juta jiwa ini bisa bahwa Turki adalah sebuah Negara sekuler murni. Hal kita ubah cara berfikirnya, tentu saja kita bisa mengitu tercantum dalam konstitusi Negara mereka. Saking hasilkan perubahan besar hanya dalam kurun waktu sekulernya, wanita muslimah tidak dibenarkan tampil 30 tahun. Itu baru tingkat SMA. Kita bicara SMP, Diberjilbab di ruang publik. Namun hanya kurang dari ploma, atau tingkat pendidikan universitas S-1. Arti100, nilai sekulerisme Turki sepertinya mulai rontok. nya kalau kita berhasil membenahi dunia pendiTurki hari ini mengalami perubahan yang cukup dras- dikan kita dengan orientasi yang tepat dan kena tis. Negara yang dulunya melarang wanita untuk berjil- sasaran, maka dalam waktu singkat Indonesia akan bab diruang publik, hari ini malah memperton- bisa bangkit menjadi Negara adi kuasa. tonkan isteri para pejabat ne-garanya tampil dengan Mungkin atas kesadaran inilah, be-berapa berpakaian la-yaknya elit politik kitapun seorang muslimah. mulai mengorek Inilah revolusi luar langkah. Pada tahun Bayangkan saja jika setiap tahun biasa yang terjadi di2002 dilakukan abad modern. kita menghasilkan tamatan SMA amandemen atas Menurut hemat UUD 1945 yang sasebesar 7 juta orang, maka dalam 30 lah satunya adalah penulis, revolusi Turki ini jauh lebih berhasil dengan pasal tahun kita bisa menghasilkan 21 juta terkait dari revolusi yang saat 31. Versi amandeini sedang melanda jiwa. Jika ke 21 juta jiwa ini bisa kita men ini, pasal 31 dunia Arab dan Afrika ayat (4) UUD 1945 ubah cara berfikirnya, tentu saja kita mengamanatkan Utara, mulai dari Tunis, Mesir, Libya, hingNegara mengbisa menghasilkan perubahan besar. agar ga ke Yaman dan Syria. alokasikan anggaran Perubahan ini tentu pendidikan sekusaja tidak terjadi darang-kurangnya dua lam hitungan hari atau bulan. Ini terjadi sebagiannya puluh persen (20%) dari anggaran pendapatan dan dari gerakan pendidikan yang dilakukan oleh beberapa belanja Negara (APBN) serta dari anggaran penkelompok orang yang concern terhadap masyarakatnya dapatan dan belanja daerah (APBD). Baru kali ini daseperti Fathullah Gulen, perlu diketahui bahwa lam sejarahnya, amandemen UUD 1945 ditujukan Fathullah Gulen adalah seorang ulama kharismatik dan untuk penetapan lokasi anggaran. Seiring dengan orang yang paling berpengaruh di turki. Beliaulah yang amandemen ini, tidak bisa tidak kebijakan terkait merubah sistem pendidikan yang ada di Negara Turki. dengan bidang pendidikan pun juga mengalami Lihat juga Jepang, Korea, dan Malaysia, Negara ini perubahan. Pendidikan tingkat SD dan SMP menjadi juga bisa dijadikan rujukan dalam konteks revolusi. gratis karena sudah dibiayai Negara melalui dana BOS, Jepang dan Korea adalah Negara yang kalah dalam pe- guru dan dosen diberi tunjangan gaji melalui sertirang dunia ke II. Jepang bahkan sempat menyaksikan fikasi, Evaluasi Belajar Tahap Akhir Nasional (EBTAkehancuran Negaranya akibat bom Nagasaki dan Hi- NAS) dihapus dan diganti menjadi Ujian Akhir Narosima. Sejak merdeka, nama Malaysia belum banyak sional (UAN), sekolah dibenarkan membuat rintisan disebut dalam pergaulan international. Namun dalam sekolah bertaraf International dengan bahasa pengankurun waktu yang tidak begitu lama, Negara yang dise- tar yaitu bahasa Inggris, pemerintah juga memperkebutkan diatas bisa bangkit dan bahkan bisa duduk seja- nalkan paket A, B, dan C untuk memudahkan masyarakat memperoleh ijazah formal, masyarakat juga dijar dengan Negara yang pernah menghancurkannya. Beberapa tahun lalu, Malaysia banyak belajar dari benarkan mengadakan home schooling serta beberapa Republik Indonesia, tenaga pengajarnya banyak di im- kebijakan lain seperti perubahan kurikulum dan pengpor dari Indonesia. Akan tetapi hari ini, Negara tetang- hapusan jurusan di tingkat SMA yang dalam dua tiga ga itu bisa sedikit mendongakkan kepalanya, karena minggu atau sebulan terakhir ini marak dibicarakan. kondisi hidup di Negara ini dalam beberapa hal jauh lebih baik dari Negara yang pernah menjadi gurunya. Dan itu semua berkat sistem pendidikan yang baik. Setelah sempat jatuh dalam konflik sekitar tahun 1969, pemerintah Malaysia melalui New Economic Policy (NEP) nya mulai menata kehidupan ekonomi, sosial, dan politiknya. Pendidikan dibenahi, rakyatnya disekolahkan, mereka dikirim keberbagai perguruan tinggi bergengsi diberbagai belahan dunia seperti Amerika,

Penutup. Dari tulisan yang sederhana ini, penulis ingin mengajak kita semua, mari kita rubah sudut pandang kita terkait proses pendidikan yang kita jalani, banyak contoh sebuah Negara yang awalnya terpuruk, selanjutnya bangkit menjadi sebuah Negara yang maju dikarenakan proses pendidikan nya yang baik, lalu ada apa sebenarnya dengan pendidikan kita?. Mudah-mudahan ini menjadi PR buat kita bersama. Wallahu a’lam

hina. Dalam Alquran surat An Nahl 58, Allah berfirman: “Dan apabila seseorang diantara mereka dikaruniai (kelahiran) anak perempuan, murunglah wajahnya dan ia sangat jengkel penuh kemarahan. Ia menyembunyikan

dirinya dari orang banyak, lantaran buruknya apa yang diterimnya . Adakah ia akan memeliharanya dengan menanggung kenistaan ataukah akan menguburkannya (hidup-hidup) di kalang tanah? Ketahuilah, betapa buruknya apa yang mereka tetapkan itu.” Sementara dalam ayat lain dinyatakan, “ Apabila bayi-bayi perempuan yang dikubur hidup-hidup ditanya, karena dosa apakah ia dibunuh.” (QS At Takwir 9). Sebaliknya jika wanita itu selamat dari penguburan terhadap dirinya hidup-hidup, wanita hidup tanpa dihargai eksistensinya. Wanita sedikitpun tidak mendapatkan harta pusaka dari keluarganya meskipun keluarganya kaya sedang ia dililit kefakiran. Karena mereka hanya memberi harta waris kepada laki-laki bukan kepada perempuan. Bahkan jika suaminya meninggal, wanita itu dianggap sebagai harta yang dapat diwarisi sebagaimana harta suaminya. Tatkala Islam datang, dihapuslah penindasan terhadap wanita. Islam datang untuk memanusiakan wanita. Allah berfirman dalam surat Al Hujurat 13: “Hai segenap manusia, sesungguhnya Kami menciptakan kamu dari seorang lelaki dan seorang perempuan.” Allah juga menyebutkan bahwa pada prinsip kemanusiaan, wanita adalah mitra laki-laki dalam hal perolehan pahala dan siksa atas suatu perbuatan. Allah berfirman: Barangsiapa yang melakukan amal shaleh, baik lakilaki maupun perempuan, sedang ia beriman, maka sesungguhnya Kami akan mengaruniakan kepadanya kehidupan yang baik dan Kami pun benar-benar akan menganugrahi mereka balasan dengan yang terbaik dari apa yang telah mereka lakukan. “ (QS An Nahl 97). Allah mengharamkan menjadikan wanita sebagai harta benda milik suami yang jika suami meninggal dunia dapat

diwarisi sebagaimana halnya harta benda yang lain. Allah berfirman dalam surat An-Nisa 19: “Wahai orang-orang beriman tidak halal bagi kamu, dengan paksa mempusakai wanita.” Dalam adat jahiliyah , jika seorang lelaki meninggal dunia, maka anak lelaki sulungnya dapat mewarisi janda ayahnya itu yang bukan ibu kandungnya. Ia bebas menentukan untuk mengawininya sendiri atau untuk mengawinkannya dengan orang lain yang maharnya menjadi milik anak lelaki sulung itu atau membiarkannya dan melarangnya kawin lagi. Allah menjamin independensi wanita sebagai pribadi. Dijadikan-Nya wanita pewaris, bukan benda diwarisi. Allah menentukan untuk wanita bagian tertentu dalam mewarisi harta kerabatnya seperti tersebut dalam dalam surat An Nisa 7, “Bagi laki-laki ada hak bagian dari peninggalan ibu-bapa dan kerabatnya, dan bagi wanita ada hak bagian (pula) dari peninggalan ibu-bapa dan kerabatnya, baik sedikit atau banyak menurut hak bagian yang telah ditetapkan.” Dalam ayat lain disebutkan, “Allah mensya-riatkan bagi kamu tentang (pembagian harta waris untuk) anak-anakmu. Yaitu: hak bagian seorang anak lelaki sama dengan hak bagian dua orang anak perempuan. Jika anak itu semuanya perempuan lebih da-ri dua, maka bagi mereka dua pertiga dari harta yang ditinggalkan. Dan jika anak perem-puan itu seorang saja, maka ia memperoleh separo harta.” (QS An Nisa 11) Allah juga memerintahkan para suami memperlakukan istrinya secara baik-baik seperti tersebut dalam surat An Nisa 19: “Dan pergaulilah mereka (istri-istrimu) secara ma’ruf ( baik menurut agama).” Allah menjadikan mahar (mas kawin) sebagai hak istri dan memerintahkan untuk diberikan kepadanya secara penuh, kecuali wanita dengan lapang dada merelakan sebahagiannya.

“Berilah mahar ( mas kawin) kepada wanita (yang kamu nikahi) sebagai pemberian wajib. Lalu, Jika mereka, dengan senang hati, merelakan untuk kamu sebahagian dari mahar itu, maka makanlah dari pemberian itu yang ia adalah makanan yang enak lagi baik.” (QS An Nisa 4). Allah juga menjadikan wanita di rumah suaminya sebagai orang yang memiliki hak memimpin, memerintah, melarang dan sekaligus sebagai ratu yang harus ditaati anakanaknya. Rasulullah Saw bersabda: “Wanita adalah pemimpin di rumah suaminya dan akan dimintai pertanggung jawabannya tentang yang dipimpinnya.” Allah juga mewajibkan atas suami agar memberi nafkah dan pakaian untuk istrinya secara ma’ruf (baik menurut agama). Dalam konteks kekinian, emansipasi wanita jadi kebablasan. Wanita yang seharusnya menjadi contoh dan suri tauladan yang baik dalam keluarga dan masyarakatnya kini malah berprilaku sebalikya. Kita sering menyaksikan berita-berita di media massa tidak sedikit wanita menjadi koruptor, pembunuh bahkan yang sangat memprihatinkan yaitu membunuh anak dan suaminya sendiri, pengedar narkoba, mucikari, menjadi bagian sindikat penjualan bayi ke luar negeri, penjaja seks komersial dan melakukan kejahatan lainnya. Para artis dan selebritis juga tidak jarang membuka auratnya untuk dipertontonkan kepada seluruh pemirsa televisi. Meskipun banyak pula wanita baik-baik dan berhasil, namun Kondisi wanita semacam ini sekarang sangat jauh dari cita-cita Kartini apalagi dari ajaran agama. Jika Kartini masih hidup, tentu ia sangat sedih melihat kondisi wanita saat ini. Kondisi seperti zaman jahiliyah, tapi terjadi di era modern. Nurhayati Baheramsyah

Belajar Dari China Oleh H. Hasan Bakti Nasution Sekretaris MUI Sumatera Utara


alah satu hadis yang cukup populer di kalangan masyarakat Muslim Indonesia ialah: “Tuntutlah ilmu walaupun ke negeri China”. Teks aslinya ialah uthlubul ‘ilma walau bish-shin. Mengenai status hadis ini memang masih diperdebatkan, di antara shahih atau bukan. Namun jika dikaji secara rasional, apa yang yang menjadi misi hadis ini sangatlah rasional. Paling tidak karena dua pertimbangan, yaitu historis dan ekonomis. Pertama, secara historis, China memiliki sejarah panjang yang sudah barang tentu dapat dijadikan sebagai pengacaan diri. Sejarah China telah melewati dua ribuan tahun lebih dengan beberapa dinasti, seperti dinasti Ming, dinasti Cing, dan sebagainya. Kejayaan, kemunduran, dan kejatuhan tentu menjadi bagian dari sejarah tersebut, yang sangat penting dijadikan sebagai bahan renungan. Kedua, sebelum Islam lahir, kontak pedagang Arab dengan China sudah berlangsung cukup lama. Hal ini dapat tergambar dalam sejarah pra-Islam dan secara langsung dapat dilihat pada film-film Islam, seperti Arrisalah. Apa Yang Harus Dipelajari Sebagai agama terakhir, Islam memang mendorong umatnya untuk mengambil kearifan darimana saja. “Ambillah kearifan dari karung mana saja ia keluar” (khuzil hikimata min ayyi wi’ain kharaja), begitu perintah Nabi Muhammad. Dalam kesempatan lain beliau berucap: “kebenaran adalah baranghilang umat Islam, ambillah ia dimanapun diperoleh (alhaqqu dhallatul muslim fakhuzuhu min ayyi wi’ain kharaja)”.Jika dikaitkan dengan sejarah panjang China, paling tidak ada empat hal yang harus dijadikan bahan pembelajaran. 1.Kegigihan; Secara umum daerah China melewati empat musim, yaitu musim panas, musim dingin, musim gugur, dan musim semi. Ketika musim panas suhu bisa mencapai 40-an derjat dan ketika musim dingin bisa mencapai minus 30 derjat. Ketika musim dingin yang mencapai empat bulan tersebut tanaman akan mengalami kematian, sehingga menutup beberapa jenis mata pencaharian. Namun karena kegigihan masyarakat China, mereka dapat melewatinya, walaupun mereka termasuk daerah pertanian. 2.Ekonomi dan perdagangan; Seperti tercatat sejarah dan terekam dalam beberapa film, termasuk film Arrisalah seperti tersebut di atas, para

pedagang China telah memasuki kota Makkah sebagai pusat perdagangan ketika itu. Begitu juga dengan daerah Indonesia, para pedagang China beserta pedagang dari belahan dunia lainnya, terasuk Arab, India dan Persia, telah menapakkan kaki di kepulauan ini. Bayangkan betapa jauhnya jarak China dengan Indonesia, namun ditempuh untuk kepentingan berdagang. Mereka datang ke negeri ini bukanlah dengan kekayaan melimpah, melainkan apa adanya, jika tidak disebut miskin, sehingga muncul istilah “China tukang sayur”. Tetapi karena semangat berdagang tinggi, semuanya berubah 180 derjat. Berbeda halnya dengan anak negeri yang telah menguasai asetaset kekayaan, tetapi karena semangat ekonomi dan perdagangan yang minimalis ditambah dengan kegigihan yang pas-pasan, semuanya hilang satu persatu, sehingga muncullah perumpamaan yang cukup ironis “dari naik mobil kemudian naik honda, honda tergadai lalu naik sepeda, dan sepedapun terbang akhirnya jalan kaki”. 3. Penerapan hukum; Sisi lain yang harus dijadikan contoh dari China sana ialah dalam hal supremasi hukum, bahwa hukum diterapkan kepada siapa saja dan kapan saja. Banyak kasus yang dapat dijadikan sebagai contoh, mulai dari Hakim Bao, Mao Ze Thung, dan sebagainya. Tercatat salah seorang Wali kota Peking menerapkan hukuman mati kepada kemanakannya yang korupsi hanya 8.000 Yuan, padahal ketentuan hukumnya minimal 10.000 Yuan. Apa yang menarik di sini ialah bahwa justru karena dia mempunyai hubungan dengan walikota hukumannya diperberat dari hukuman 20 tahun menjadi hukuman mati. Mungkin halnya akan terbalik jika di Indonesia, karena di negeri ini hukuman orang yang dekat dengan pejabat akan diringankan, bahkan dibebaskan. Ini tidak terjadi di China sana, karena justru diperberat, seharusnya 10.000 untuk hukuman mati, tetapi cukup 8.000 Yuan karena dia dekat dengan walikota. Hukuman mati diterapkan kepada siapa saja jika memenuhi persyaratan hukuman mati. Apa yang terjadi kemudian; korupsi menampakkan tren penurunan drastis. Yang muncul kemudian

Hukum diterapkan kepada siapa saja dan kapan saja. Banyak kasus yang dapat dijadikan sebagai contoh, mulai dari Hakim Bao, Mao Ze Thung. Tercatat salah seorang Wali kota Peking menerapkan hukuman mati kepada kemanakannya yang korupsi hanya 8.000 Yuan, padahal ketentuan hukumnya minimal 10.000 Yuan. ialah terjadinya perkembangan ekonomi yang fantastis, jika mungkin disebut sebagai nomor satu dunia. Itulah sebabnya, China menjadi negara kekuatan ekonomi baru yang kini hampir-hampir pada Negara dengan kelebihan modal. Pada era belakangan, hukuman memang sudah mulai dirubah menjadi 20 tahun, namun jangan lupa bahwa hukuman 20 tahun tidak bisa memperoleh keringanan maupun pemotongan. Hal yang sama juga dilakukan terhadap pengedar Narkoba dengan hukuman matinya. Tentu berbeda di Indonesia yang, seberapa banyakpun korupsi yang dilakukan seolah sudah ada hukuman standarnya, yaitu empat tahunan, seperti dapat dilihat di awal tahun 2013 yang korupsi puluhan milyar tetapi hukumannya 4 tahun 6 bulan. Itupun masih memperoleh peluang pemotongan tahanan. Begitu juga Bandar Narkoba yang sudah divonis mati, tetapi dengan senyum-senyum kepala Negara memberi keampunan. Betapa rendahnya keberpihakan terhadap masyarakat yang korban Narkoba. Akibatnya, mayarakat atau pejabat tidak jera berkorupsi ria dengan prinsip biarlah menderita dua tahunan tetapi akan memperoleh biaya hidup yang wah untuk beberapa keturunan. Akibat lanjutan ialah bahwa pembangunan yang dicanangkan tahun demi tahun, hanyalah sebagai ladang korupsi. Hal ini diperparah lagi dengan visi pembangunan bagi sekelompok orang yang mengartikan sebagai lahan korupsi atau berapa yang bisa dikorupsi, bukan sebagai media perubahan masyarakat ke arah yang lebih baik. Jadi pembangunan dirumuskan bukan bagaimana kondisi idealnya, tetapi berapa idealnya yang akan saya peroleh. Luar biasa! 4. Semangat penguasaan wilayah; Penguasaan terhadap suatu teritorial menjadi salah satu yang menjadi i’tibar, karena dari teritori ini akan dikuasai teritori-teritori lain.

Singapura pada awalnya adalah kota-kota khusus China sehingga muncul ungkapan China Town, tapi kemudian semuanya menjadi tritori China, maka hilanglah sebutan China Town. Medan mungkin akan mendapat giliran, karena banyak tritori sudah dimiliki. Semangat inilah yang tidak dimiliki umat Islam. Jangankan penguasaan teritori baru yang adapun terbang entah ke mana, digadaikan, dijual atau apalah namanya. Jangan heran jika mendengar berita rumah, mesjid dijual. Parahnya penyakit kronis ini tidak hanya dimiliki oleh rakyat karena katanya tidak memiliki visi hidup, pejabatnya sama saja atau lebih parah, karena rakyat menjual asetnya untuk hidup sementara pejabat untuk kemewahan hidup. Tidak heran jika pejabatnya merelakan saja pembongkaran mesjid, pembogkaran tempattempat bersejarah, symbol-simbol lama, dan sebagainya, maka kini yang tinggal hanya nama, karena sudah berganti dengan rumah ibadah atau simbol-simbol penguasa teritori baru. Jangan-jangan kata Medanpun suatu saat akan hilang kecuali hanya sebatas pantun dan pepatah petitih, seperti hilangnya kata Pulau Pinang yang enak dibaca dan didengar, digantikan oleh Penang, entah dari mana asal katanya. Mungkin Medan hanyalah persoalan waktu. Penutup Yang terpenting ialah bagaimana agar semua kebaikan dapat dijadikan i’tibar bagi kemajuan masyarakat dan bangsa ini, agar tidak menjadi budak di negeri sendiri. Sekedar contoh, tanah-tanah yang seharusnya dimiliki anak negeri tetapi sudah diambilalih bangsa lain. Yang tentu terkait kesadaran kita, termasuk penguasa negeri yang kurang memberi keberpihakan kepada anak bangsanya. Entahlah! Mungkin bangsa ini terlalu bodoh untuk mempertahankan kehormatannya. Wallahu a’lam.

Mimbar Jumat


WASPADA Jumat 12 April 2013

Sentuhan Islam Terhadap Kartini (Catatan Kecil Hari Kartini 2013 )

Hubungan Suami Istri Sebagai Ibadah Dan Besar Pahalanya (3)

Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.


iapa yang tidak mengenal RA. Kartini, seorang tokoh dari Jawa yang ditetapkan sebagai pahlawan nasional Indonesia dan dikenal sebagai pelopor kebangkitan perempuan pribumi. Kartini memang berbeda dengan perempuan lain semasanya dalam hal transformasi pengetahuan dan isu global yang berkembang. Buah pikirannya dapat dilihat dari dokumentasi surat-surat yang dikumpulkan oleh J.H. Abendanon, Menteri Kebudayaan, Agama dan Kerajinan Hindia Belanda, pada sebuah buku yang diterbitkan pada tahun 1911. Memang ada kalangan yang meragukan kebenaran surat-surat Kartini dokumentasi Abendanon karena buku tersebut terbit saat pemerintahan kolonial Belanda menjalankan politik etis di Hindia Belanda, apalagi Abendanon termasuk yang berkepentingan dan mendukung politik etis. Pemikirannya yang dianggap modern pada masanya itu menimbulkan serangkaian pertanyaan, seperti darimanakah sumber inspirasi gagasannya itu. Apakah bersumber dari agamanya, adat istiadat dan filsafat Jawa, ataukah Eropa Barat. Sisi keislaman Kartini Dalam buku “Api Sejarah”, Prof. Ahmad Mansyur Suryanegara mengisahkan bagaimana kekaguman Kartini kepada Alquran. Dalam suratnya kepada Ny. Abendanon tertanggal 15 Agustus 1902 ia menulis “Alangkah bebal dan bodohnya kami. Kami tidak melihat, tidak tahu bahwa sepanjang hidup ada gunung kekayaan di samping kami.” Ahmad Mansyur menyatakan bahwa Kartini menilai Alquran sebagai gunung kekayaan yang telah lama ada di sampingnya. Setelah Tafsir Alquran dibacanya, Kartini melihat Alquran sebagai gunung hakikat kehidupan. Melalui surat-suratnya, Kartini juga memberikan gambaran kegagalan agama kolonial Belanda. Ia juga mengkritik Belanda agar tidak membawa panji-panji agama dalam bekerja. Kartini juga secara halus menolak ajakan Ny. Van Kol untuk berpindah agama; “yakinlah Nyonya, kami akan tetap memeluk agama kami yang sekarang ini.” Ada beberapa data yang menurut Ahmad Mansyur

bisa dikatakan bahwa Kartini sebagai orang yang alim dalam Islam. Sekalipun fakta-fakta kekaguman Kartini akan Islam dan nilai dalam Alquran tidak terelakkan, fakta lain tentang pengaruh theosofi dalam pemikirannya juga menjadi catatan tersendiri yang mesti diungkap. Hal ini karena banyak surat

pertinya ada transformasi spiritual yang terjadi pasca pertemuan Kartini dan Kiai Soleh Darat. Pandangan Kartini tentang Barat berubah. Kartini mengirim surat tertanggal 27 Oktober 1902 kepada Ny. Abendanon “Sudah lewat masanya, semula kami mengira masyarakat Eropa itu benar-benar yang terbaik, tiada tara. Maafkan ka-

Pertanyaannya adalah benarkah Kartini memperjuangkan emansipasi? Jika benar, apakah yang diperjuangkan Kartini sama dengan apa yang diperjuangkan kaum feminis hari ini? Kartini yang kontradiksi atau tidak sejalan terhadap pembelaannya kepada agama Islam. Menariknya, ucapan Kartini itu disampaikan dalam surat pada tanggal yang sama pula di saat kekagumannya mengalir kepada Islam. jadi, sisi theosofi Kartini juga adalah fakta sejarah yang tidak bisa kita pungkiri. Pertanyaan kita adalah bagaimana posisi Kartini? Ada beberapa hal yang mesti kita lihat untuk menengahkan masalah dua jati diri Kartini yang terlihat saling kontradiksi. Pertama, kita meletakkan Kartini sebagai orang awam. Kartini sejak umur 12 tahun banyak berdiam diri di rumah dan harus tinggal di rumah karena sudah biasa dipingit. Fundamentasi islamnya juga kurang kuat. Lingkungan di sekitar Kartini cenderung merujuk kepada Islam kejawen yang menyampurkan agama tauhid dengan sinkretisme. Kedua, pengaruh Belanda. Ayah Kartini terkenal memiliki jaringan luas terhadap Belanda. Hal ini kemudian didukung suasana tempat belajar di Europese Lagere School dimana hampir semua gurunya orang Belanda. Ketiga, hubungan Kartini dengan Kiai Soleh Darat di Semarang yang merupakan sosok ulama yang memiliki andil besar terhadap Kartini di akhir-akhir hidupnya. Pertemuan Kartini dengan Kiai Soleh Darat tidak berlangsung lama karena kiai wafat setahun sebelum Kartini wafat. Memang tidak ada klarifikasi Kartini sebagai bantahan pikiran sebelumnya yang telah dicurhatkan kepada para sahabatnya. Namun se-

mi, apakah ibu menganggap masyarakat Eropa itu sempurna? Dapatkah ibu menyangkal bahwa di balik yang indah dalam masyarakat ibu terdapat banyak yal yang sama sekali tidak patut disebut peradaban. Tidak sekali-kali kami hendak menjadikan murid-murid kami sebagai orang setengah Eropa, atau orang Jawa kebarat-baratan.” Dalam suratnya kepada Ny. Van Kol, tanggal 21 Juli 1902, Kartini juga menulis: “Saya bertekad dan berupaya memperbaiki citra Islam, yang selama ini kerap menjadi sasaran fitnah. Semoga kami mendapat rahmat, dapat bekerja membuat agama lain memandang Islam sebagai agama disukai.” Lalu dalam surat ke Ny. Abendanon bertanggal 1 Agustus 1903, Kartini menulis: “Ingin benar saya menggunakan gelar tertinggi, yaitu Hamba Allah”. Terlihat bahwa Kartini sebelumnya bertemu Kiai Soleh mengalami salah paham terhadap Islam, dan hal itulah yang dikeluh kesahkannya pada teman-teman Eropanya. Kartini sedari dulu memang sekedar membaca dan menghapal Alquran tanpa mengetahui maknanya. Para guru ngajinya juga tidak peduli dengan makna Alquran. Hingga datanglah saat pertemuan dengan Kiai Soleh Darat yang menyampaikan pengajian tafsir di wilayah kekuasaan suami Kartini. Kartini sangat tertarik dengan penjelasan tafsir Al-Fatihah yang disampaikan sang Kiai dan menggugah spiritualitas yang selama ini belum diraihnya. Ibrah Kartini

Kartini telah wafat dengan meninggalkan semangat “kesetaraan”. Kartini dengan segala latar belakangnya memiliki persepsi tersendiri mengenai apa itu kesetaraan. Pertanyaannya adalah benarkah Kartini memperjuangkan emansipasi? Jika benar, apakah yang diperjuangkan Kartini sama dengan apa yang diperjuangkan kaum feminis hari ini? Kartini memang mengkritisi sosial kemasyarakatan lingkungannya saat itu, tapi tidak terlibat secara reaktif. Keluh kesahnya dipublikasi setelah Kartini meninggal dunia. Masyarakat baru mengetahui pikiran Kartini setelah publikasi surat-suratnya. Inilah sebab kemunculan perbedaan persepsi yang muncul oleh masyarakat, apakah ini murni sebagai publikasi semata atau ada agenda yang direncanakan oleh Abendanon. Bahwa kolonial Belanda memiliki agenda propaganda sekuler liberal adalah sesuatu yang tidak rahasia lagi. Dengan demikian, wajar jika ada yang menduga Kartini dijadikan sebagai “orang internal” untuk mengkritisi tradisi sosialnya, meliputi agama dan adat. Kritik oleh “orang internal” adalah senjata ampuh yang bisa menghantam institusi besar dimana ia ada di dalamnya. Kritik “orang internal” pada satu sisi dapat diterjemahkan sebagai kegelisahan atas ketidaksesuaian kebaikan antara normatifitas agama, nurani dan lingkungannya, sehingga bisa dijadikan dalil kelemahan institusi suatu agama yang dianut dalam merespon kegelisahan. Usia Kartini memang pendek, tapi buah pikirannya mampu merubah tradisi yang mungkin saat itu dianggap telah mapan. Perjuangan Kartini telah menjadi inspirasi kaum wanita Indonesia dalam kancah kehidupan berbangsa. Untuk menyelaraskan dengan persepsi keislaman, kita berharap kiprah Kartini dapat diinterpretasikan sebagai motivasi berharga bahwa wanita bisa mengambil peran dalam pembentukan sebuah peradaban sebagaimana Islam memberikan perhatian yang serius terhadap kaum wanita agar tetap bermartabat. Mereka diposisikan sebagai tiang negara.

Produktivitas Zakat Perspektif Hukum Islam “Relevansi Terhadap UU Zakat No. 23 Tahun 2011” Oleh Imam Pratomo, S.HI Staf Pengajar Pon-Pes Modren Darul Hikmah TPI Medan, Mahasiswa Kandidat Magister Hukum Islam IAIN-SU


alam ajaran Islam terdapat lima hal yang harus dikerjakan oleh umat Islam, yaitu yang disebut dengan Rukun Islam. Rukun Islam itu terdiri dari syahadat, sholat, zakat, puasa dan haji, yang menjadi topik inti dalam pembahasan ini adalah zakat, di Syariatkannya zakat karena hal ini agar mengurangi jumlah kemiskinan di dalam masyarakat. Kemiskinan merupakan bahaya besar bagi umat manusia dan tidak sedikit umat yang jatuh peradabannya hanya karena kefakiran. Salah satu cara menanggulangi kemiskinan adalah dukungan orang yang mampu untuk mengeluarkan harta kekayaan mereka berupa dana zakat kepada mereka yang

kekurangan. Zakat merupakan salah satu dari lima nilai instrumental yang strategis dan sangat berpengaruh pada tingkah laku ekonomi manusia dan masyarakat serta pembangunan ekonomi umumnya. Zakat merupakan kewajiban bagi umat Islam yang dikaitkan dengan harta yang di miliki oleh seseorang dan tergolong dalam ibadah maliyah (ibadah harta). Tujuan zakat tidak sekedar menyantuni orang miskin secara konsumtif, tetapi mempunyai tujuan yang lebih permanen yaitu mengentaskan kemiskinan. Zakat adalah ibadah yang mengandung dua dimensi, yaitu dimensi hablum minallah atau dimensi vertikal yang mengatur hubungan an-

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustadz, apa yang dimaksud dengan lauh mahfuz, ini selalu disebut-sebut orang tapi bagaimana pengertian sebenarnya. Mohon penjelasan. Dari Hamba Allah. Jawab : Terima Kasih atas pertanyaannya. Menurut Ensikklopedi Alquran kata Lauh mahfuz terdiri dari kata lauh yang berarti tampak dan berkilau, dinamakan lauh mahfuz karena terlihat dan tampak oleh para malaikat apa yang tertulis padanya berupa perintahperintah yang harus dijalankan. Lihat Ensikklopedi Alqur’an, lentera hati, Jakarta, jilid 2 hal 511). Kata lauh dalam bentuk tunggal hanya sekali disebut Alquran dalam surat Al-buruj ayat 22. Dalam tafsir Ibnu Katsir beliau menukil riwayat yang menyatakan bahwa “Tiada sesutupun yang telah ditetapkan Allah, baik berupa Alquran dan yang sebelumnya dan sesudahnya melainkan berada di Lauh Mahfuz (lembaran yang terpelihara). Ibnu Katsir juga menukil dari Imam Thabrani sebuah hadis yang menyatakan bahwa: “Sesungguhnya Allah menciptakan Lauh Mahfuz dari mutiara yang putih, lembaranlembarannya dari yaqut merah dan qalamnya dari nur dan tintanya juga dari nur, tiga ratus enam puluh perintah untuk menciptakan, memberi rezeki, mamatikan, menghidupkan, memuliakan, menghinakan dan berbuat menurut apa yang dikehendaki-Nya. Menurut Tafsir Qurthubi, semua takdir makhluk Allah telah ditulis-Nya di Lauh Mahfuz, bisa saja dihapus/ diubah oleh Allah atau Allah menetapkan sesuai dengan kehendak-Nya. Kemudian yang dapat mengubah takdir yang tertulis dalam Lauh Mahfuz itu hanya do’a dan perbuatan baik/ usaha. Nabi Muhammad bersabda: “Tiada yang bisa mengubah takdir selain doa dan tiada yang bisa memanjangkan umur kecuali perbuatan baik”.Lauh Mahfuzh akan kekal selamanya karena ia termasuk makhluk yang abadi, selain Lauh Mahfuzh makhluk abadi ada’arasy, surga dan neraka dan lain-lain. Wallahu A’lam. Al-ustadz H. Ismail Hasyim. MA.

Hambatan yang masih terasa saat ini adalah pemahaman tentang zakat yang sering bersifat tekstual oleh sebagian ulama dan masyarakat. tar manusia dan penciptanya dan hablum minannas atau dimensi horizontal atau yang mengatur hubungan antara manusia dengan manusia. Ibadah zakat bila ditunaikan dengan baik akan meningkatkan keimanan, membersihkan dan mensucikan jiwa dan harta yang dimiliki. Jika dikelola dengan baik akan mampu meningkatkan kesejahteraan umat, mampu meningkatkan etos dan etika kerja umat, serta sebagai institusi pemerataan ekonomi. Menurut Undang-undang Nomor 23 Tahun 2011 tentang pengelolaan zakat dalam pasal 3 disebutkan bahwa pengelolaan zakat bertujuan untuk: meningkatkan efektivitas dan efisiensi pelayanan dalam pengelolaan zakat dan meningkatkan manfaat zakat untuk mewujudkan kesejahteraan masyarakat dan penanggulangan kemiskinan. Ini artinya bahwa pemerintah telah memfasilitasi terciptanya pengelolaan zakat yang dapat memberikan aspek ekonomi, syari’ah dan bertanggung jawab bagi pengelola dan wajib zakat serta pihak yang menerimanya. Dalam sejarah perzakatan di Indonesia, Pengelolaan zakat secara konvensional dilakukan dari tangan ke tangan. Maksudnya wajib zakat atau muzakki mengeluarkan zakatnya dengan memberikan secara langsung kepada pihak yang berhak menerimanya. Dengan demikian, maka penyerahan berlangsung secara sederhana, cepat dan langsung. Keberhasilan tujuan zakat sangat bergantung pada pendayagunaan dan pemanfaatannya. Hal ini dipengaruhi oleh beberapa faktor terkait, hadirnya institusi zakat yang dikelola secara profesional bersih dan amanat adalah sebuah solusi yang fundamental. Zakat akan menjadi sumber dana tetap yang potensial untuk kesejahteraan ummat dan fakir miskin serta untuk kemajuan agama dan syi’arnya. Kehadiran Undang-Undang Nomor 23 Tahun 2011 tentang Pengelolaan Zakat merupakan revisi dari Undang-Undang Nomor 38 Tahun 1999 Tentang Pengelolaan Zakat,

revisi ini menuntut BAZ dan LAZ untuk bekerja lebih profesional, transparan dan amanah dalam manajemen ZIS, sesuai tuntutan syari’ah. Hambatan yang masih terasa saat ini adalah pemahaman tentang zakat yang sering bersifat tekstual oleh sebagian ulama dan masyarakat. Sebagian ulama seperti DR. Lahmuddin Nasution, Al-ustadz Oka Mas’ud dan ulama-ulama yang lainnya tidak sepakat dengan konsep produktifitas zakat. Alasannya karena hasil zakat harus diberikan kepada mustahiq. Jika diproduktifkan, penyaluran zakat seakan-akan ditunda. Betapa pun, pemahaman yang tekstual itu hendaknya harus dihargai sebagai sikap kehati-hatian. Di antara dalil yang menyebutkan bahwa pengelolaan zakat adalah hak negara adalah hadis Mu’adz bin Jabal ketika Rasulullah mengutusnya keYaman: “Dari Ibnu Abbas, “….. diambil dari orang kaya di antara mereka, lalu dikembalikan kepada fakir di antara mereka.” (H.R. Jamaah). Mengomentari hadis tersebut, Ibnu Hajar al-Asqalani mengatakan bahwa kepala negara adalah orang yang melaksanakan pemungutan dan pendayagunaan zakat, baik langsung maupun melalui wakilnya. Bagi muzaki yang membangkang, maka zakat dapat diambil secara paksa. Ini artinya bahwa Negara/ pemerintah ikut andil dalam mewujudkan kesejahteraan ummat yang tidak mampu. Dalam hal ini BAZ/ LAZ baik tingkat kabupaten maupun tingkat propinsi mempunyai inisiatif untuk mempro-duktifitaskan dana zakat agar selalu berkembang sehingga terciptanya kemakmuran dan tidak ada lagi kemiskinan, jika di konsumtifkan, dikhawatirkan dana tersebut langsung habis tidak tersisa, maka tujuan dari zakat tersebut untuk mengentaskan kemiskinan tidak tercapai. Ini berdasarkan pada kaidah Hukum Islam “Suatu tindakan (peraturan) pemerintah, berintikan terjaminnya kepentingan dan kemaslahatan rakyatnya”. Wallahu Muafiq Ila Aqwami Thariq.

Rasulullah SAW bersabda, “Bukankah Allah telah menjadikan untukmu sesuatu yang dapat disedekahkan? Yaitu, setiap kali tasbih adalah sedekah, setiap tahmid adalah sedekah, setiap tahlil adalah sedekah, menyuruh pada kebaikan adalah sedekah, melarang kemungkaran adalah sedekah, dan hubungan intim kalian (dengan isteri) adalah sedekah.” Para sahabat bertanya, “Wahai Rasulullah, apakah salah seorang di antara kami melampiaskan syahwatnya dan dia mendapatkan pahala?” Rasulullah SAW menjawab, “Bagaimana pendapat kalian jika ia melampiaskan syahwatnya pada yang haram, apakah ia berdosa? Demikian juga jika melampiaskannya pada yang halal, maka ia mendapatkan pahala.” (HR. Muslim). Oleh karena itu, satu dari beberapa hal yang wajib disegerakan adalah menikahkan anak yang sudah cukup umur dan mampu menikah. Dengan demikian hidupnya akan teratur, dan yang halal dalam Islam itu bukan hanya membawa kesenangan dunia, namun juga akan menjadi pahala yang diperhitungkan sebagai kesenangan di akhirat kelak karena menikah itu sunnah Nabi SAW dan menjalani kehidupan dengan baik. Menjadikan pernikahan sebagai sebuah ibadah dapat melanggengkan perkawinan. Artinya, setiap pasangan berpeluang mendapatkan pahala setiap harinya dengan bekerja untuk keluarga, menafkahi keluarga guna membentuk keluarga sakinah, mawaddah, warohmah. Dalam keluarga seperti itu akan lahir putra-putri yang shalih dan shalilah, kelak menjadi generasi muda yang memahami dan menjalankan amar makruf nahi munkar, kelak menjadi pemimpin yang amanah guna mensejahterakan masyarakat, berguna bagi masyarakat, nusa, bangsa, setidaknya untuk keluarga dan jiran tetangga. Sungguh besar pahalanya bila mampu menjalani kehidupan suami istri yang islami.(Sumber hadis shahih).

Selebriti Langit Oleh Junaidi Dosen UMSU Dan IAIN


alam kamus besar bahasa Indonesia, selebriti diartikan dengan “orang yang terkenal atau masyhur”. Menjadi selebriti merupakan idaman banyak orang, Di antara bukti yang bisa dilihat adalah begitu banyaknya orang yang mengikuti berbagai audisi yang digelar di stasiun televisi swasta yang pada intinya untuk merekrut selebriti-selebriti baru. Banyaknya orang yang ingin menjadi selebriti merupakan sesuatu yang wajar. Hal ini karena dengan menjadi selebriti, seseorang bisa dikagumi dan ditunggu-tunggu serta dirindukan kehadirannya banyak orang. Di samping itu, yang tak kalah pentingnya adalah seseorang bisa memenuhi kebutuhannya untuk mengaktualisasikan diri yang merupakan sebuah kebutuhan puncak— sebagaimana teori hirarki kebutuhan manusia dari Abraham Maslow yaitu kebutuhan untuk mengaktualisasikan diri sehingga ia bisa bertindak sesuka hati sesuai minat dan bakatnya. Selebriti Langit Keinginan seseorang untuk menjadi selebriti di bumi bukanlah sebuah kesalahan. Namun ada yang lebih penting daripada sekedar menjadi selebriti bumi, yaitu menjadi selebriti di langit. Selebriti langit yang saya maksudkan adalah terkenal atau masyhur di kalangan penduduk langit seperti Allah dan para Malaikat. Ada beberapa perbuatan yang dapat mengantarkan kita menjadi selebriti langit, diantaranya yaitu: Pertama: Menyayangi ibu. Perbuatan tersebut dapat mengantarkan kita menjadi tenar, terkenal dan dinantikan serta dikagumi oleh penduduk langit. Rasulullah SAW pernah mengatakan ada se-orang pemuda yang majhulun fil ardh masyhurun fissama (tidak populer di bumi, tapi sangat dikenal penghuni langit). Ungkapan tersebut diungkapkan Rasul ketika beliau meminta Ali bin Abi Thalib, mengecek keberadaan seorang pemuda yang bernama Uwais al-Qarny karena namanya sangat harum di kalangan “penghuni langit”. Satu kelebihan Uwais yang membuat seluruh penghuni langit mencintainya dan menyebabkan Rasul memerintahkan Ali untuk mencari dan minta doa darinya adalah kecintaan Uwais kepada ibunya. Dia mengorbankan masa remajanya untuk mencurahkan kasih dan sayang kepada ibunya. Ia mengorbankan begitu banyak kesempatan yang mestinya dia kecap lantaran begitu baktinya kepada ibu yang telah mengandungnya. Bagi yang masih punya orang tua (khususnya ibu) marilah kita sayangi dan berbakti kepadanya, insya Allah kita akan menjadi selebriti di langit. Kedua: Istiqamah mengerjakan shalat berjamaah di masjid. Orang yang istiqamah mengerjakan shalat berjamaah, akan membuat kagum penduduk langit. Hal ini karena wajahnya akan memancarkan cahaya di hari kiamat. Sebagaimana Hadis Rasulullah SAW yang diriwayatkan oleh Abu Daud, Turmudzi dan Hakim, yang artinya “Berikanlah kabar gembira pada orang-orang yang rajin berjalan ke masjid dengan cahaya yang sempurna di hari kiamat”. Kelak di hari kiamat ada sekelompok orang yang ketika dibangkitkan wajah-wajah mereka bersinar seperti bintang gemerlapan. Malaikat akan bertanya kepada mereka “Apa gerangan amal-amal kalian?” Mereka menjawab, “Kami dahulu apabila mendengar azan maka segera bangkit dan berwudhu dn tak satu pekerjaanpun yang menyibukkan kami”. Kemudian akan dibangkitkan sekelompok orang lainnya,

Orang yang istiqamah mengerjakan shalat berjamaah, akan membuat kagum penduduk langit. Hal ini karena wajahnya akan memancarkan cahaya di hari kiamat. Sebagaimana Hadis Rasulullah SAW yang diriwayatkan oleh Abu Daud, Turmudzi dan Hakim. dengan wajah yang bercahaya seperti bulan purnama. Setelah ditanya mereka menjawab “Kami selalu berwudhu sebelum masuk waktu shalat”. Dan terakhir akan dibangkitkan sekelompok lainnya dengan wajah bercahaya seperti matahari. Setelah ditanya mereka menjawab “Kami selalu mendengarkan azan dari dalam masjid”. Ketiga: Membaca Alquran dengan istiqamah. Seseroang yang istiqamah dalam membaca Alquran akan membuat penduduk langit kagum sehingga mereka akan mendatangi rumahnya, hal ini karena rumah orang yang membaca Alquran tersebut memancarkan cahaya sehingga terlihat sampai ke langit. (seperti penduduk bumi melihat bintang-bintang). Perhatikan Hadis Rasulullah SAW dari Ibnu Umar, Rasulullah SAW bersabda; ”Sesungguhnya hati ini berkarat seperti mana berkaratnya besi apabila terkena air. Seorang sahabat bertanya, “bagaimana menghapuskan karat tersebut’? Nabi SAW menjawab; “Banyakkan menyebut mati dan membaca Alquran. Rumah yang jika dibaca di dalamnya Alquran, akan dikunjungi para Malaikat dan dijauhi syaitan dan tentram kehidupan ahli rumah tersebut dan banyak kebaikan dan kurang kejahatan dan ada pun rumah yang tidak dibaca di dalamnya Alquran dikunjungi para syaitan dan dijauhi para Malaikat. Tidak tentram kehidupan ahli rumah tersebut, sedikit kebaikan dan banyak kejahatan”. Keempat: Orang yang tidur dalam keadaan bersuci. Sebagaimana layaknya selebriti di bumi yang selalu digandrungi dan di dampingi oleh para penggemarnya, begitu juga dengan selebriti langit. Ia akan di damping oleh para malaikat sebagai penduduk langit. Dengan tidur dalam keadaan bersuci, insya Allah kita akan menjadi selebriti langit. Perhatikan hadits Rasulullah SAW yang diriwayatkan Ibnu Hibban dari Abdullah bin Umar yang artinya; “Barangsiapa yang tidur dalam keadaan suci, maka malaikat akan bersamanya di dalam pakaiannya. Dia tidak akan bangun hingga Malaikat berdoa ‘Ya Allah, ampunilah hambamu si fulan karena tidur dalam keadaan suci”. Kelima: Menjenguk orang sakit. Dengan menjenguk orang sakit, kita akan menjadi selebriti langit yang selalu didoakan oleh para malaikat sebagaimana layaknya selebriti bumi yang sering didoakan oleh para penggemarnya. Perhatikan Hadis Rasulullah SAW yang diriwayatkan Imam Ahmad dari ‘Ali bin Abi Thalib yang artinya: “Tidaklah seorang Mukmin menjenguk saudaranya kecuali Allah akan mengutus 70.000 malaikat untuknya yang akan bershalawat kepadanya di waktu siang kapan saja hingga sore dan di waktu malam kapan saja hingga shubuh”. Penutup. Dengan berusaha menjadi selebriti langit Insya Allah kita akan bergabung dengan selebritiselebriti langit lainnya seperti Nabi Muhammad SAW, dan para Rasul-Rasul Allah yang lain serta para syuhada dan solihin. Wallahu A’lam.

WASPADA Jumat 19 April 2013

Mimbar Jumat


Ekonomi Syariah Untuk Kemakmuran Tak Seorang Pun Tahun Kapan Ajal Tiba Tapi Tanda-tandanya Bisa Kita Ketahui (2) Apakah itu? tanya malaikat maut. Jika ajalku telah dekat, beri tahu aku. Malaikat maut berkata, Baik aku akan memenuhi permintaanmu, aku tidak hanya akan mengirim satu utusanku, namun aku akan mengirim dua atau tiga utusanku. Setelah mereka bersepakat, mereka kemudian berpisah. Setelah beberapa lama, malaikat maut kembali menemui Nabi Ya’kub. Kemudian, Nabi Ya’kub bertanya, Wahai sahabatku, apakah engkau datang untuk berziarah atau untuk mencabut nyawaku? Aku datang untuk mencabut nyawamu. Jawab malaikat maut. Lalu, mana ketiga utusanmu? tanya Nabi Ya’kub. Sudah kukirim. Jawab malaikat, Putihnya rambutmu setelah hitamnya, lemahnya tubuhmu setelah kekarnya, dan bungkuknya badanmu setelah tegapnya. Wahai Ya’kub, itulah utusanku sebagai tanda-tanda kematian untuk setiap bani Adam. Kisah tersebut di atas mengingatkan tentang tiga tanda kematian yang akan selalu menemui kita, yaitu memutihnya rambut; melemahnya fisik, dan bungkuknya badan. Jika ketiga atau salah satunya sudah ada pada diri kita, itu berarti malaikat maut telah mengirimkan utusannya. Karena itu, setiap Muslim hendaknya senantiasa mempersiapkan diri untuk menghadapi utusan tersebut.Kematian adalah kepastian yang akan dialami oleh setiap manusia sebagaimana yang telah ditegaskan dalam firman Allah SWT, Tiap-tiap yang berjiwa akan merasakan mati. (QS Ali Imran 185). (Sumber: Quran dan hadis shahih/Rep).

Jihad Seorang Ibu Oleh Ahmad Muttaqin Nasution Ketua Jam’iyatul Muallimin Sumatera Utara


iang hari yang cukup panas di minggu pertama RaApabila ia melahirkan anak, maka keluarlah madhan 1434 H, sebuah ia dari dosa-dosanya seperti keadaannya mobil pick up yang penuh muatan pasir berhenti di pinggir jalan. pada hari ia dilahirkan ibunya dan apabila Dari mobil itu tampak keluar tiga ia meninggal, tidaklah ia meninggalkan orang laki-laki dan langsung bergegas menuju pohon yang ada di dunia ini dalam keadaan berdosa sedikitpun, pinggir jalan itu untuk berteduh. dan akan didapatinya kuburnya menjadi Penulis mengenal salah satunya adalah seorang anak muda yang sebuah taman dari taman-taman surga. yang berusia sekitar dua puluh lima tahun. Bersama dua temanTuntutan kemajuan dan tuntutan kehidupan hari nya yang lain mereka menjadi pekerja sebuah pangini memaksa banyak wanita harus berjihad di luar long yang hari-harinya memuat, mengantar dan rumahnya. Tentu saja hal ini diharapkan tidak sampai menurunkan bahan-bahan bangunan. berakibat terabaikannya kegigihan berjihad dalam Saat itu mereka sedang mengantarkan pasir keluarga. Karena walau bagaimanapun sentuhan kasih pesanan. Penulis sengaja mendekati lalu bertanya, sayang dan kelembutan serta ketabahan seorang wanita ”Mengapa tidak langsung diturunin pasirnya Wan” (ibu) sangat dibutuhkan dalam rangka memelihara ke(bukan nama sebenarnya). “Istirahat sebentar Pak, harmonisan rumah tangga. capek kali rasanya, mulai tadi pagi sampai sore nanti Rasulullah SAW suatu saat mendapati putri kanterus mengantarkan bahan”, katanya. Penulis kembali dungnya Fatimah Azzahra, istri dari Ali bin Abi Thalib bertanya,”Iwan puasa?”. “Alhamdulillah, puasa Pak”. sedang menangis sambil menggiling syair (sejenis padi“Udah ada tinggal puasanya?”. “Sampai hari ini, padian) dengan menggunakan penggilingan tangan dari Alhamdulillah belum ada Pak”, jawabnya. batu. Melihat itu Rasul pun lalu menanyakan apa yang Tentu saja jawaban itu membuat penulis merasa menyebabkan anandanya menangis. Ternyata menggikagum. Betapa tidak, dengan beban kerja yang seling dan urusan-urusan rumah tanggalah yang menjadi demikian berat ditambah suhu udara yang mencapai penyebabnya. Mengetahui itu, Rasul pun lalu duduk 36 derajat celcius, dia mampu memelihara ibadah puadisamping anandanya sambil menyampaikan kabar sa. Padahal setiap hari dia berbaur dengan rekan kerja gembira yang tentu saja membangkitkan kembali yang tidak berpuasa, dia juga tinggal di sebuah gang kecil ketabahan berjihad Fatimah Azzahra. bersama para tetangganya yang kebanyakan Dalam tulisan singkat ini akan diketehampir tidak bisa membedakan ngahkan sebagian untaian kalimat penyeRamadhan dengan bulan biasa. juk yang disampaikan Rasulullah SAW Sepengetahuan penulis, dia bukepada putri kandungnya itu. Mukanlah lulusan pesantren atau dah-mudahan juga mampu memadrasah bahkan tidak sempat nyejukkan serta membangkit-kan mengecap pendidikan di SMP semangat jihad bagi para ibu karena ketiadaan dana. Itu pula dalam melaksanakan pengabyang membuat penulis sesaat diannya sebagai Almadrasatul berpikir, “apa rahasianya?”. Ula (sekolah yang pertama) bagi Tapi kemudian pertanyaan itu putra-putrinya. segera terjawab setelah penulis Rasul bersabda,”...Ya Fatiingat kalau sang anak muda ini mah, perempuan mana yang memiliki ibu yang luar biasa. menggiling tepung untuk suaminya Seorang ibu yang rela menjadi dan anak-anaknya, maka Allah SWT buruh cuci di rumah-rumah orang akan menuliskan untuknya dari setiap berada demi membantu atau lebih biji gandum itusuatu kebaikan dan mengangkatnya tepatnya menafkahi keluarganya. Dia satu derajat. Ya Fatimah, perempuan mana yang memang bukan seorang muallimah, tapi ia cukup gigih meminyaki rambut anak-anaknya dan menyisir rambut menjaga agamanya dan membimbing agama anakmereka dan mencuci pakaian mereka, maka Allah akan anaknya. Atas bimbingannya pula, sang anak muda mencatatkan baginya ganjaran pahala orang yang yang belum beruntung mengecap pendidikan memadai memberi makan kepada seribu orang yang lapar dan itu pun dengan rela hati membantu pendidikan adikmemberi pakaian kepada seribu orang yang bertelanjang. adiknya sehingga dapat melanjutkan ke sekolah yang Ya Fatimah, yang lebih utama dari semua itu adalah cukup bonafit di kota Medan. keridhaan suami terhadaap istrinya. Jikalau suamimu Manusia yang paling besar jasanya dalam kehidupan tidak ridha denganmu, tidaklah aku akan mendoakanmu. seorang anak manusia adalah ibu. Karena itu bakti anak Tidakkah engkau ketahui wahai Fatimah bahwa ridha terhadap ibu adalah bakti yang paling tinggi nilainya. suami itu adalah dari Allah SWT dan kemarahannya itu Seorang sahabat bertanya kepada Nabi Muhammad SAW, dari kemarahan Allah SWT? Ya Fatimah, apabila seorang “Ya Rasulullah, kepada siapakah aku harus lebih berbuat perempuan mengandung janin dalam rahimnya, maka baik?” Nabi menjawab,”Ibumu”. “Kemudian kepada siapa beristighfarlah para malaikat untuknya dan Allah SWT lagi?” Ibumu”. “Kemudian ke-pada siapa lagi?”. “Ibumu”. akan mencatatkan baginya tiap-tiap hari seribu kebaikan “kemudian kepada siapa lagi?”. “Ayahmu”. (al hadits) dan menghapuskan darinya seribu kejahatan. Apabila ia Riwayat diatas menyebutkan kata “ibu” tiga kali, mulai sakit hendak melahirkan, maka Allah SWT menbaru kemudian menyebutkan kata “ayah”. Hal ini memcatatkan untuknya pahala orang-orang yang berjihad perlihatkan nilai lebih dari seorang ibu, dan itu sangat pada jalan Allah, yakni perang sabil. Apabila ia melahirkan dimaklumi. Mengandung, melahirkan, menyusui, anak, maka keluarlah ia dari dosa-dosanya seperti mengasuh dan membesarkan adalah perjuangan yang keadaannya pada hari ia dilahirkan ibunya dan apabila selalu melekat bagi para ibu. Itu pula yang menjadi ia meninggal, tidaklah ia meninggalkan dunia ini dalam alasan, secara emosional anak-anak cenderung lebih keadaan berdosa sedikitpun, dan akan didapatinya dekat kepada ibunya. Kedekatan itu pula yang membuat kuburnya menjadi sebuah taman dari taman-taman para ibu memiliki peranan yang sangat penting dalam surga, dan Allah akan mengaruniakan kepadanya pahala membentuk karakter putra-putrinya. Agaknya, inilah seribu haji dan seribu umrah serta beristighfarlah makna dari ucapan Rasulullah SAW, “Ibu adalah untuknya seribu malaikat hingga hari kiamat. Madrasatul Ula (sekolah yang pertama)”. Perempuan mana yang melayani suaminya dalam Ketika seorang utusan dari kelompok para wanita sehari semalam dengan baik dan ikhlas serta niat yang datang menjumpai Rasulullah, meminta agar mereka benar, maka Allah SWT akan mengampuni semua dosajuga turut dilibatkan secara langsung dalam sebuah dosanya dan Allah SWT akan memakaikan kepadanya peperangan yang sedang dipersiapkan, maka Rasululah sepersalinan pakaian yang hijau dan dicatatkan pun menjawab bahwa jihadnya seorang wanita buuntuknya dari setiap helai bulu dan rambut yang ada kanlah di medan perang, tapi di dalam rumah tangpada tubuhnya seribu kebaikan dan dikaruniakan Alganya. Dengan jihad ini diharapkan terciptalah rumah lah untuknya seribu pahala haji dan umrah.Ya Fatimah, tangga yang kokoh dan harmonis, lahirlah anak-anak perempuan mana yang tersenyum di hadapan yang istiqamah dan kaya wawasan dan pada gilirannya suaminya, maka Allah akan memandangnya dengan akan menghasilkan pejuang-pejuang tanggung yang pandangan rahmat...” . (Al hadits). Wallahu a’lam. siap membela dan mempertahankan kebenaran.

Oleh Azhari Akmal Tarigan Staf Pengajar Fakultas Syari’ah IAIN.SU Medan


i tengah kemajuan pesat yang telah dicapai ilmu ekonomi dalam kurun waktu satu abad terakhir, ilmu ekonomi di mata ekonom Umer Chapra, dihadapkan kepada sebuah pertanyaan krusial: Sejauh mana disiplin ilmu ini berhasil memainkan peran kuncinya dalam mewujudkan kesejahteraan dan meningkatkan kualitas hidup bagi seluruh umat manusia? Dalam konteks inilah, kita semestinya menyepakati bahwa tolok ukur untuk menilai keberhasilan atau kegagalan setiap cabang ilmu adalah sejauh mana kontribusi langsung atau tidak langsungnya dalam mewujudkan kesejahteraan umat manusia. Dalam perspektif ekonomi Islam, hal ini berkorelasi dengan seuntai doa yang diwariskan Ra-sulullah SAW melalui lisannya yang suci,Ya Allah, aku berlindung kepada-Mu dari ilmu pengetahuan yang tidak bermanfaat, dari hati yang tidak khusyu, dari jiwa yang tidak pernah puas dan dari doa yang tidak dikabulkan. Kemelut Sejarah Diskursus di atas mengingatkan kita pada permasalahan epistemologi disiplin ilmu ekonomi dalam upayanya mencari nisbah antara etika dan ilmu ekonomi (M. Dawam Raharjo, 1981). Apa yang menjadi keyakinan para ekonom aliran mainstream bahwa ilmu ekonomi ber-sifat wertfrei alias bebasnilai - adalah salah alamat. Karena, konsekuensi logis dari semua ini adalah ilmu ekonomi telah ditampilkan hanya menjadi serangkaian persamaan dan parameter matematika, time series, regresi dan ekonometri sehingga lahirlah wajah ilmu ekonomi yang kering dari nilai-nilai kemanusiaan (Boulding, 1970). Sebagaimana ditulis dengan tajam oleh Khursid Ahmad (2001) bahwa paradigma ekonomi konvensional yang muncul saat ini bercirikan pada paradigma yang berupaya melepaskan ilmu ekonomi dari

semua kaitan transedental dan kepedulian etika, agama, dan nilai-nilai moral. Pendekatan yang sangat sekuler dan berorientasi duniawi, positivistik dan pragmatis. Lebih dari itu, ilmu ekonomi berkembang sebagai sebuah disiplin yang semata-mata mengitari pusat kepentingan diri, usaha pribadi, mekanis-me pasar dan motif mencari keuntungan... Semua ini pada akhirnya bermuara pada kemelut sejarah ilmu ekonomi konvensional saat ia tercerabut dari matrik budaya dan nilai-nilai dalam menganalisis dan menggagas pemecahan berbagai persoalan ekonomi. Alhasil, apa yang selanjutnya kita temui adalah pertumbuhan dan pengembangan ilmu ekonomi dengan pilar penyangga teori yang rapuh. Seperti dinyatakan oleh Robert Heibronner (1976), para ekonom mulai menyadari bahwa mereka telah membangun sebuah bangunan yang canggih di atas landasan sempit yang rapuh. Kesimpulan serupa ditunjukkan oleh Chapra, menurutnya, peristiwa depresi hebat telah memperlihatkan secara jelas kelemahan logika Hukum Say dan konsep laissez faire.Ini dibuktikan oleh ekonomi pasar yang hampir tidak mampu secara konstan menggapai tingkat full employment dan kemakmuran. Ironisnya, di balik kemajuan ilmu ekonomi yang begitu pesat, penuh inovasi, dilengkapi dengan metodologi yang semakin tajam, modelmodel matematis dan ekonometri yang semakin luas untuk melakukan evaluasi dan prediksi, ternyata ilmu ekonomi tetap memiliki keterbatasan untuk menggambarkan, menganalisis maupun memproyeksikan kecenderungan tingkah laku ekonomi dalam perspektif waktu jangka pendek. Dengan kata lain, ilmu ekonomi bekerja dengan asumsiasumsi ceteris paribus. Variabel-

Krisis ekonomi 1930, 1970, 1980, 1999, dan 2001 - paling tidak membuktikan bahwa sistem ekonomi kapitalis maupun sosialis (yang mendasarkan diri pada filsafat materialismesekulerisme) telah gagal menjawab dan menyajikan solusi atas persoalan ekonomi dan kemanusiaan. variabel yang justru mempengaruhi kecenderungan jangka panjang termasuk faktor nonekonomi diasumsikan konstan. Hal ini tidaklah mengherankan, bila kita mengingat apa yang pernah dikatakan oleh Keynes, Dalam jangka panjang kita semua toh akan mati. Sayangnya, kita seperti terkungkung dan kehabisan energi dalam perangkap teori dan implementasi ilmu ekonomi konvensional yang ternyata tetap saja mandul untuk melakukan terobosan mendasar guna menjawab pertanyaan-pertanya an di atas. Lingkaran Kezaliman Dalam bingkai kesejarahan inilah kita dapat memotret wajah buram ilmu ekonomi konvensional dalam mencapai tujuan-tujuannya. Maka krisis demi krisis ekonomi yang terus berulang — untuk menyebut antara lain krisis ekonomi 1930, 1970, 1980, 1999, dan 2001 - paling tidak membuktikan bahwa sistem ekonomi kapitalis maupun sosialis (yang mendasarkan diri pada filsafat materialisme- sekulerisme) telah gagal menjawab dan menyajikan solusi atas persoalan ekonomi dan kemanusiaan. Maka yang selanjutnya kita saksikan adalah lingkaran-lingkaran kezaliman yang mengiringi hilang timbulnya siklus krisis dalam sejarah panjang kehidupan perekonomian bangsabangsa di muka bumi ini. Karenanya, keadilan ekonomi macam

apakah yang hendak kita wujudkan bila tata ekonomi dunia baru saat ini ternyata melahirkan tragedi kemiskinan dan kelaparan; kesenjangan negara kaya dan negara miskin; serta perangkap utang luar negeri (debt trap) dan hegemoni ekonomi global. Untuk menyebut satu contoh saja, lihatlah laporan Konferensi Tingkat Tinggi (KTT ) Pangan Setelah Lima Tahun Kemudian (World Food Summit: Five Years Later) di Roma, 10-13 Juni 2002 yang memaparkan bahwa sebanyak 815 juta manusia di negara berkembang masih menghadapi kelaparan, 300 juta di antaranya adalah anakanak yang bergulat dengan kelaparan dan setiap saat selalu berhadapan dengan monster pencabut nyawa bernama rawan gizi (Kompas, 10/7/2002). Dalam konteks krisis ekonomi Indonesia, apa yang tersisa dari krisis yang terus mendera negeri kita ini? Paling tidak kita mencatat sejumlah permasalahan mendasar dari perekonomian kita akibat akumulasi kezaliman ekonomi selama ini berupa: kemiskinan struktural yang parah, angka pengangguran yang meledak, ketimpangan distribusi pendapatan, ketimpangan pembangunan antar daerah, konsentrasi kepemilikan aset produktif di tangan konglomerat, beban utang luar negeri dan penjajahan ekonomi nasional oleh kekuatan asing.

4 Wanita Istimewa Di Muka Bumi Oleh Hj. Siti Nazariah Zam Pemerhati Masalah Keagamaan


alam kitab Ihya, Al-Ghazali diutarakan ada 4 wanita istimewa sejak dari jaman Nabi Musa a.s sampai ke masa Nabi Muhammad SAW yakni ; Asiyah isteri Fir’aun, Maryam ibunda Isa Almasih, Khadijah binti Khuwalid dan Fatimah. Keempat wanita tersebut menggoreskan sejarah yang penuh arti dimuka bumi ini. 1.Asiyah, isteri Fir’aun (Ramses) Raja Mesir yang kaya raya tapi kejam dan bengis. Isterinya Asiyah adalah wanita beriman yang senantiasa berdoa kepada Tuhan Yang Maha Esa memohon kepada Tuhan “Wahai Tuhanku Bangunkanlah untukku sebuah Istana di dalam Surga dan selamatkanlah daku dari kekejaman Fir’aun dan perbuatannya, juga selamatkanlah daku dari kaum yang bersalah (Surah 66 Ayat 11). Pada suatu sore Asiyah sedang duduk santai di belakang istananya yang mewah dan megah sayupsayup terlihat olehnya tabut (peti kecil) sedang terapung-apung diatas air sungai Nil yang panjangnya 6695 km yang mengalir sepanjang 9 Negeri ; Ethiopia, Zaire, Kenya, Uganda, Tanzania, Rwanda, Sudan dan Mesir. Karena sesuatu yang aneh dan jarang terjadi iapun menyuruh pembantunya untuk mengambil benda tersebut dan membawakan padanya. Setelah tabut dihadapannya ia bersama suaminya (Fir’aun) membuka tabut tersebut. Mereka sangat terkejut karena isinya adalah seorang bayi laki-laki berusia tiga bulan dan segar bugar. Sambil memandang suaminya ia berkata: “Saya suka bayi ini, kita peliharalah untuk menjadi anak kita sendiri sebagai cahaya malaikat dan cahaya mataku dan matamu”. Kebetulan anaknya hanya satu saja seorang putri, Fir’aun menyetujuinya, ia lupa akan undang-undang yang baru dikeluarkannya untuk menyembelih bayi laki-laki yang baru lahir. Namun Hati Fira’un Raja Mesir itu luluh mendengar ucapan isterinya, maka selamatlah Musa dari korban undang-undang Fir’aun itu. Masa barjalan terus Musa pun telah dewasa setelah menjalankan berbagai peristiwa yang dialaminya. Pada suatu malam yang dingin, ia pun pergi mencari api untuk memanasi isterinya (puteri Nabi Syuaib) yang sedang berjalan menuju Mesir dari rumah mertuanya. Rupanya terdengar olehnya (kalam Allah) yang mengangkatnya menjadi Rasul dan memberikan mukjizat kepadanya untuk menyerang Fir’aun karena dia mendakwakan dirinya sebagai Tuhan. Setelah Nabi Musa wafat tabut yang berisi Musa bayi itu yang diambil Asiyah menjadi peti wasiat yang keramat dan

menjadi rebutan. Namun Malaikat mengambilnya dan membawakan kepada Thalut sebagai bukti ia akan menjadi raja. 2.Maryam (Ibu Isa Almasih) adalah seorang gadis yang saleh dan takwa. Ketika ia lahir ayahnya Imran (Ali Imran surat 3) telah terlebih dahulu menemui khaliqnya. ia tidak dapat melihat putrinya lahir. Padahal didambakannya sejak muda sampai hari tuanya berusia 70 tahun. Untuk memenuhi nazar janda Imran, pada suatu hari diam-diam dibungkusnya putri kecilnya itu dibawanya ke rumah suci (Baithil Maqdis) disitu ditemukannya banyak pendeta-pendeta sebagai pengawal rumah suci tersebut. Janda Imran itu mengatakan: Ini anak perempuanku akan kuserahkan kepada tuan-tuan karena saya sudah bernazar untuk menyerahkan anakku untuk menjadi abdi rumah suci ini. Pendeta-pendeta tersebut semua ingin memeliharanya; untuk menghindari pertikaian mereka membuat undian, Nabi Zakaria lah yang menang dan memang dia pun belum memiliki anak di usianya yang telah 90 tahun, sehingga ia senantiasa berdoa, “Wahai Tuhanku janganlah Engkau biarkan aku sendirian, dan engkau penerima pusaka yang lebih baik (surat 2: 89). Maryam pun dipelihara oleh Zakaria, dididiknya dan diajarkannya segala isi Taurat yang berisi hukum Allah, maka pada usia remaja jadilah ia gadis yang berilmu dan dimulyakan oleh masyarakatnya. Pada suatu hari Zakaria datang menjumpai ke kamarnya yang tangganya didalam mihrab Zakaria, ia sangat terkejut melihat sebuah hidangan yang lengkap dengan makanan, Zakaria pun bertanya; “Wahai Maryam bagaimana engkau mendapatkan ini? Sedangkan pintu semua tertutup dan tangga diruang mihrab.” Maryam menjawab: Sesungguhnya Allah memberi rezeki kepada siapa yang dikehendakinya (Surat 3: 37). Tak lama kemudian datang pula dua orang lelaki ke kamarnya dan mengatakan “Wahai Maryam engkau akan memiliki seorang putra.” Lalu orang itu hilang dalam sekejap mata, rupanya itu adalah Malaikat. Berita itu membuatnya takut dan cemas karena dia tak pernah bersentuhan dengan lelaki dan dekatpun tak pernah. Tak lama kemudian ia pun hamil, dan ketika sudah dekat melahirkan karena takut malu pada masyarakat ia pun berangkat ke sebuah bukit yang sepi, dia bersandar di bawah pohon kurma yang sudah kering kerontang, di situ dia menyendiri tiada teman,

Khadijah adalah tempat sandaran Rasulullah bila ia membutuhkan finansial untuk mensyiarkan Alquran yang berisi ajaran Tauhid atas perintah Allah. tidak ada bidan, tabib maupun dokter, yang ada hanya iman dan takwa. Ia pun melahirkan seorang anak laki-laki yaitu Isa Ruhil Qudus. Pohon kurma yang tadinya kering kini berbuah jatuh keharibaannya untuk makanannya, dengan tiba-tiba sebuah sungai pun mengalir di sisinya. Setelah melahirkan, masyarakat bertanya dengan keheranan, bayi itu pun diletakkan Maryam ke dalam buaian dan tiba tiba si Bayi Isa berbicara: “Sesungguhnya aku ini seorang hamba Allah, akan diberinya kepadaku sebuah kitab Injil dan dijadikannya aku seorang Nabi yang berguna bagi masyarakat”. 3.Khadijah binti Khuwalid adalah seorang janda yang rupawan, hartawan dan dermawan. Pada usia 40 tahun ia menikah dengan Muhammad bin Abdullah yang tampan juga rupawan dan dia berusia 25 tahun. Ketika Khadijah membutuhkan seorang pembantu yang jujur untuk menjalankan perdagangannya. Muhammad yang lagi menggembala kambing didatangi seseorang yang mengatakan ada pekerjaan yang lebih baik dari pada ini. Maka untuk menambah isi sakunya ia pun bersedia bekerja pada usaha Khadijah. Khadijah sangat percaya pada Muhammad atas kejujurannya. Dagangannya pun semakin berkembang saja selama Muhammad ikut menjalankannya. Tak berapa lama kemudian keluarga kedua belah pihak ingin mempersatukannya dengan ikatan pernikahan. Muhammad pun menikah dengan Khadijah dan inilah isteri Muhammad yang pertama. Dari perkawinan Khadijah dengan Muhammad memperoleh 6 orang anak yaitu 1. Al Qasim 2. At Thaher 3.Zainab 4.Rukaiyah, 5. Ummu Kalthum, 6.Fatimah, dan yang No.7 dari Maria Al Gibti dari Islamabad dapat seorang anak bernama Ibrahim. Pada waktu melewati masa muda dan perdagangannya pun berjalan mulus, Muhammad sering menyendiri ke gua Hira pada masa itulah Muhammad pertama sekali menerima Wahyu. Dan di saat pertama Rasul menerima wahyu ia sangat ketakutan dan cemas lalu berlari pulang menemui istrinya Khadijah dengan badannya bergetar menceritakan tentang peristiwa besar yang baru dialaminya. Khadijah pun menjawab ; “Wahai anak pamanku janganlah khawatir dan

cemas, hendaklah engkau bergembira. Demi Allah Tuhan tidak melimpahkan kehinaan pada engkau untuk selamanya karena engkau senantiasa mempererat tali kekeluargaan, bersilaturrahmi, berkasih sayang, berkata benar, memuliakan tamu, menolong orang karena korban mempertahankan kebenaran. (Sahih Bukhari 1846). Bukan itu saja, Khadijah adalah tempat sandaran Rasulullah bila ia membutuhkan finansial untuk mensyiarkan Alquran yang berisi ajaran Tauhid atas perintah Allah dan juga untuk membasmi kemusyrikan yang menyembah berhala. Dan Khadijah adalah wanita pertama masuk Islam dan kedua adalah Ali Bin Abu Thalib dalam usia masih remaja. 4.Fatimah Az Zuhra adalah Putri Nabi Muhammad SAW dengan Khadijah. Pada suatu hari terjadi sebuah malapetaka yaitu seorang pandir Quraish yang berhati iblis melempar nabi SAW dengan tanah kotor, sekujur kepalanya berlumuran tanah. Fatimah datang melihat ayahnya sedemikian rupa merasa pilu, walau dengan perasaan hati yang hancur dibersihkannya kepala ayahnya sambil menangis tersendu sendu. Tak ada yang lebih pilu rasanya dari hati seorang ayah mendengar anaknya menangis apalagi seorang perempuan : “Jangan menangis anak-ku Tuhan akan melindungi ayahmu,” kata Rasul kepada putrinya. Pada masa berikutnya tatkala Nabi sakit keras, melihat Fatimah datang beliaupun berkata “Selamat datang putriku” lalu didudukkannya di sampingnya dan Nabi membisikkan sesuatu. Kelihatan Fatimah menangis terisak isak dan tak lama kelihatan pula Fatimah tertawa gembira. Sesudah Rasul wafat Aisyah bertanya tentang hal yang dibisikkan ayahnya, fatimah menjawab bahwa ayahnya akan meninggal karena sakitnya itu hanya sekali ini. Maka saya menangis, kemudian ayah berkata bahwa Fatimahlah dari keluarga yang pertama sekali menyusul ayah meninggal. Itulah sebabnya saya tertawa. Maka habislah keturunan Nabi Muhammad SAW dari darah dagingnya. Adapun cucu Nabi Hasan dan Husin adalah putra dari Fatimah dan pada masa itu juga sudah lebih dahulu meninggal.

Mimbar Jumat


WASPADA Jumat 19 April 2013

GATOT: Jadikan Alquran Sumber Inspirasi Gubernur Sumatera Utara Gatot Pujo Nugroho mengajak seluruhalumni Sekolah Tinggi Agama Islam (STAIS) Sumatera Utara menjadikan Alquran sebagai sumber inspirasi. Alquran, menurut Gatot harus menjadi spirit dan inspirasi utama untuk menjadi pribadi-pribadi sukses.

Seruan ini diungkapkan Gatot saat menghadiri wisuda 448 mahasiswa STAIS Sumatera Utara di bawah Yayasan Perguruan Tinggi Islam Sumut, Sabtu (13/4). Kehadiran orang nomor satu di Sumatera Utara membuat wisuda sarjana

STAIS angkatan XXI ini di Asrama Haji Medan jadi lebih istimewa. Gubsu dalam sambutannya mengajak wisudawan dan wisudawati untuk terus bergerak, bergerak dan bergerak dengan kemampuan yang dimiliki


WISUDAWATI TERBAIK: Gubsu Gatot Pujo Nugroho memberikan penghargaan kepada wisudawati terbaik STAIS.


KENANGKENANGAN: Para tokoh dan pendiri STAIS mem berikan buku dan kenangankenangan kepada Gubsu usai pelaksanaan wisuda perguruan tinggi tersebut.

Al-Falah Jl. Perbatasan Bandar Khalipah-Bandar Setia Al-Falah Jl. Kemenangan 151 Kel. Indra Kasih Al-Falah Jl. Pukat Banting IV No. 10 Al-Furqan Islamic Centre Sumut Jl. Williem Iskandar Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Al-Ikhlas Jl. Mandala By Pass Gg. Tengah Lingk. II Al-Ikhlas Jl. Ambai Ujung No. 15-B. Kel. Sidorejo Hilir Al-Ihsan Jl. Suluh No. 148 Al-Ishlah Jl. Bustamam Dusun X/XI Bandar Khalipah Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Ijtima’iyah Jl. Letda Sujono No. 152 Kel. Tembung Al-Muslimun Jl. Pertiwi No. 94-C Ke. Bantan Al-Mubiin Dusun VII/Selasih Desa Bandar Khalipah Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Baiturrahman Kampus UNIMED Jl. Williem Iskandar Babussalam Jl. Bersama Ujung No. 260 Kel. Bantan Baitul Muslimin Jl. Datuk Kabu Pasar III Gg. Mesjid Darul Amin Jl. Letda Sujono Ujung No. 1 Hidayatul Muslimin Jl. Bersama No. 105 Lingk. V Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Jamik Al-Jihad Jl. Besar Tembung Dusun I No. 17 Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Jl. Pimpinan Gg. Delima No.11 Sei Kerah Hilir Taqwa UMA Kampus I Jl. Kolam No. 01 Medan Estate Ubudiyah Jl. Taduan 109 Kel. Sidorejo

Misnan Al-Jawi, SH, MH Drs. Syamsul Bahri Amrizal Aziz, S.Ag H. Mar’ie Muhammad, S.HI Drs. Maragading Hakim Siregar Drs. Bukhari Nasution Muchlis Lubis, S.HI SyofyanLubis, BA Drs. Agen Harahap, S.Pd.I Rahmad RM, S.Pd.I Mukhtar Arifin Drs. Alisyah Hasibuan Drs. H. Bahron Nasution Drs. Kasto Nader Drs. Jimin Drs. H. Muhidin Gurning Ramlan Yusuf Rangkuti Drs. Nadran Jamal Drs. M. Bakhri Pasaribu H. Syamsuddin Nur Drs. H.M. Yamin Ritonga Drs. H. Fachrurrozy, P. Drs. Mesiono, M.Pd Awaluddin Pulungan, MA H. Arso, SH, M.Ag Drs. H. Syamsul Rijal Pulungan Zailani, S.Pd.I, MA Drs. Muslim Wahid H. Sulaiman Hasibuan, Lc, MA Drs. Musdar, S.

MEDAN TUNTUNGAN Al-Amin Jl. Pala Raya Perumnas Simalingkar Drs. Rusnan Nasution Al-Hidayah Jl. Seroja Raya Lingk. VI Kel. Tg. Selamat Drs. H.M. Syafruddin Al-Hikmah Jl. Tali Air Lingk.IV Kel.Mangga K. R.S.Jiwa Drs. Zulkifli Al-Ikhlas Jl. Bunga Kardiol Kel. Baru Ladang Bambu Drs. H. Rajuddin Harahap Al-Ikhlash Jl. Cengkeh No. 24 Kel. Mangga Jumendra Banurea, M.Ag Al-Muhajirin Perumnas Simalingkar H.M. Taufik Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Budi Muliono Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Drs. Basaruddin, DJ. Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Syaipul Asro, MA Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Drs. H. Umum Sitepu Baitul Rahman Jl. Rami 2 Perumnas Simalingkar M. Syafaruddin Iklab Jl. Letjen. Jamin Ginting Km. 12,7 Arwansyah Dalimunthe, S.Ag Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Drs. Mulyono, M.Pd Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Drs. H. Basyaruddin Dja’far Silaturrahim Jl. Kapas No. 13 No. 49 P. Simalingkar Drs. Suardi Matondang Taqwa Jl. Sawit Raya, Perumnas Simalingkar H. Khairul Jambak, MA DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Drs. H.M. Said Siregar Aisyah Abdullathif Farah Jl. Mama Suka No. 1 Per.TPD M. Nurdin Nasution, S.Pd.I Ash-Sholah Jl. Roso Marindal 1 Fauzy, ST. MM At-Taubah Blok Gading Kelambir Lima Kebun H. Perak Alamsyah, S.Pd.I Al-Furqan Perum. Bumi Tuntungan SejahteraDesa SC Ahdar Muslim, S.Pd.I Al-Hidayah Jl. Pembangunan Desa Sekip Lubuk Pakam Asnawi Al-Hafiz Hamparan Perak Kec. Hamparan Perak Hasnol Arifin Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Drs. H. Efendi Barus Al-Ikhlas Lingk. XIII Dusun Durian Kec.Percut Sei Tuan H. Hasanuddin, Lc, MA Al-Ikhlas (YAMP). Pomplek Perkantoran Pemkab. DS Abdul Latif Khan, S.Ag Al-Issyah Hakim Jl. Karya Jaya Kel./Kec. Deli Tua A. Syarbaini, S.Pd.I Al-Muhajirin Perum. Pondok Nusantara Ds Marindal-II Drs. H. Muhammad Ilyas Purba Al-Muttaqien Jl. Besar Deli Tua Gg.Kolam Kec. Deli Tua Drs. Usman Harahap Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia H. Ruslan Batubara Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Drs. Kasianto Ahmad Baitussalam Dagang Kerawan Tanjung Morawa Zainal Arifin, S.Ag Baitur Rohim Jl. Purwo Desa Suka Makmur Muhammad Yunus Graha Deli Permai Jl. Sidodadi H. Kamil Harahap, S.HI, MA Istikmal Jl. K.E. Tandean Lingk. III Bandar Sakti Zulfi Pandapotan Jami’ Asysyakirin Deli Tua H. Abd. Rahman, MA Jami’ Kel. Galang Kota Khoirul Bahri Jami’ Al-Hisan Desa Silemak Kec. Hampran Perak Drs. Abdul Hafiz Hasibuan

Jami’ Lubuk Pakam Khairul Fatihin Dusun II Kec. Tg. Morawa Lahmuddin Jl. Besar Deli Tua Km.8,3 Ds Suka Makmur Misbahul Munir Jl. P. Siantar No. 1 Desa Pagar Jati Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Hikmah Balai Penelitian Sungai Putih Nursa’adah Jl. Raya Medan- Tanjung Morawa Km. 12 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Raya Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam Taqwa Lubuk Pakam

untuk melakukan perubahan dan menyebarkan nilai-nilai Islami. “Untuk itu kepada wisudawan dan wisudawati saya berharap wisuda hari ini bukan akhir dari sebuah proses. Hari ini justru menjadi awal proses melakukan perubahan dengan segala kemampuan yang kita miliki,” ujarnya. Untuk menjadi pribadipribadi sukses, Gatot menyarankan para wisudawan untuk menjadikan Alquran sebagai spirit dan sumber inspirasi. Apalagi menurutnya, sukses adalah juga sebuah seruan yang selalu dikatakan Allah SWT melalui banyak versi di Alquran. “Jadi untuk mencapai sukses ada tiga hal yakni pertama iman, kedua ada sarana dan prasarana dan yang ketiga adanya semangat,” tutur Gatot memberi motivasi kepada para wisudawan dan wisudawati. Setelah berhasil memotivasi diri, Gubsu mengajak para wisudawan dan wisudawati agar menularkan motivasi dan spirit mereka yang bersumber dari Alquran kepada masyarakat sekitar dengan ilmu yang telah dimiliki. “Kalau itu dijalankan dengan sungguhsungguh oleh semua wisudawan dan wisudawati, kita optimis bangsa ini akan menuju bangsa dan negara yang besar,” imbuhnya. Ketua STAIS Sumut Drs Khairudin MA menambahkan, para wisudawan dan wisudawati yang telah menamatkan studinya harus berkarya di tengah masyarakat. Menurutnya wisuda merupakan awal dari pengabdian masyarakat. “Ini bukan akhir bagi para wisudawan, saya harapkan Anda bisa melanjutkan ilmu ke pendidikan S2 dan selanjutnya,” harapnya. Sekretaris Koordinator Perguruan Tinggi Agama Islam Wilayah IX Prof Dr H Amroeni MA memberikan nasehat kepada para mahasiswa agar dalam menggapai sukses tetap patuh kepada guru dan patuh kepada orang tua.(m28)

Suratman, S.Pd.I Yatiman, S.Pd.I Sudarno, S.Ag Khairul Azhar Rangkuti Drs. H. Dariansyah EMDE Drs. Suhelman Drs. H. Syahron Nst., SH, MH Drs. H. Yusuf Adi, MA Drs. Nazamuddin Amar Ma’ruf, S.Ag Drs. H. Nizar Idrus

BINJAI Agung Kota Binjai Drs. H. Khaidir Lubis, Lc Amal Jl. T. Imam Bonjol Gg. Cempaka H. Hamzah Fansuri An-Nur Jl. Veteran No. 7 Lingk. 1 Kel. Tangsi Drs. H. Pandapotan Harahap Ar-Rahmah Turiam Jl. Ikan Kakap No.1 Kel. Tanah Tinggi Drs. H. Aprianda Ath-Thohirin Jl. T. Amir Hamah Km.24 Kel. Jati Makmur Drs. H. Ahmad Nasir Al-Hidayah Jl. Talam No. 28 Kel. Nangka Binjai Drs. Lukmanul Hakim Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi H.M. Nasir, S.Ag Al-Mukhlishin Jl. Timba No. 3 Lingk. II Nangka Drs. Misman, MA Al-Qadar Komplek Griya Payaroba Indah Binjai Drs. H.Jaharuddin Batubara, MA Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Drs. Hasan Tazir Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Drs. H.M. Salim Nurul Falah Jl. S.M. Raja No. 60 Kel. Tanah Tinggi Drs. H. Farhan Rawi Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi H.M. Taufik Aminullah LANGKAT Azizi Tanjung Pura Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Stabat Al-MuhajirinJl. Kelapa Sawit Kel. Perdamaian Nurul Huda Kel. Perdamaian Kec. Stabat Nurul Iman Lingk. VII Damai Kel. Perdamaian

H. Sahrizal, S.Sos, M.SI Drs. H. Usminoto Usman H. Abdul Salam, Lc H. Sukri, S.Ag, MA H. Ramsyah, AR, BA AbdulFuad, S.Ag

TEBING TINGGI Amal Muslim Kp. Rao Annamirah Perum. Griya Prima Lingk.IV Kel. T. Marulak At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Lingk. I Al-Huda Lingk. III Kel. Berohol Kec. Bajenis Al-Hidayah Jl. Nenas Kel. Rambung Kota Al-Hasanah Jl. Kartini No. 16-A Al-Hasanah Jl. Merbau Perumnas Bagelen Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Kota Al-Muthmainnah Kel. D. Sundoro Lingk. I Al-Qomar BTN. Purnama Deli Lingk. V Kel. Bulian Darul Jihad Brimob Jl. Ahmad Yani Nurul Islam Jl. P. Irian Lingk. 04 Kel. Persiakan Nurul Iman Jl. K.L. Yos Sudarso Lingk. 02 Kel. R. Laban Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Kota Tebing Tinggi Syuhada Jl. Iskandar Muda No. 79-A Tafakkur Jl. Sei Padang Lorong Batu Sangkar Kota

Suratman, S.Ag Abdul Yazed, S.Ag Aminullah, S.Pd.I Tukiman, K.S. Syofyan, MS. Ibnu Kasim, S.Pd.I Drs. H. Pangadilan Gultom Drs. H.P. Dasopang Watijo Muqarrabin Abrar, S.Pd.I Mulkan Azima, S.Ag Drs. H. Bustami Saragih Drs. H. Ibrahim Harahap H. Muslih Lubis Supardi Zufri, S.Pd.I Turman Hasibuan

INDRAPURA Jami’ Indrapura


KISARAN Agung Jl. Imam Bonjol No. 182 Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Simpang 6 Kel. Kisaran Barat Al-Husna Kel. Sidomukti Al-Hidayah Kisaran Baru Al-Inayah Kel. Siumbut-umbut Kota Kisaran Timur Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Jl. Prof. H.M. Yamin SH Nurul Huda Jl. Malik Ibrahim No. 37 ASAHAN

Drs. H. Muhilli Lubis H. Zulhanuddin Batubara, MA Drs. M. Akhyar, MA Drs. H. Abd. Azizsyah, SH Drs. H. Mahmuddin Lubis Drs. H. Nurul Ikhsan Sitorus, SH,MA Drs. Hasanuddin Siregar Imran Ariadin, S.Pd.I H. Faisal AbdullahTj. Lc, S.Pd.I H. Samsul Qodri Marpaung, Lc Ir. Ahlan Wasahlan

I’TIBAR H.M. Hafez, Lc

Nabi Yusuf AS; Perjalanan Menuju Istana Nabi Yusuf as adalah putera ketujuh dari dua belas putera-puteri Nabi Ya’qub. Ia dengan adiknya Benyamin lahir dari rahim istri Ya’qub yang bernama Rahil. Yusuf dikaruniakan Allah rupa bagus, paras tampan, tubuh tegap idaman setiap wanita. Ia anak yang dimanjakan ayahnya, terutama setelah wafat ibu kandungnya Rahil. Sikap Ya’qub tersebut mendatangkan kecemburuan anak-anaknya yang lain. Satu malam Nabi Yusuf bermimpi, ia melihat seakan sebelas bintang, matahari dan bulan di langit turun dan sujud di depannya. Lantas ia terbangun dan menghampiri ayahnya, menceritakan mimpinya itu. Kegembiraan luar biasa tampak pada wajah Ya’qub seketika. Ia berkata kepada Yusuf: Wahai anakku, mimpimu adalah wahyu dari Allah dan bukan sekedar bunga-bunga tidur. Mimpimu memberikan tanda yang membenarkan firasatku pada dirimu, bahwa engkau akan dikurniakan oleh Allah kemuliaan, ilmu dan kenikmatan hidup yang mewah. Maka setelah nasihat ayahnya tersebut, kehidupan sulit yang diwarnai dengan konspirasi dan beragam muslihat dari saudarasaudaranya mulai dialami nabi Yusuf—meskipun akhirnya semua itu merupakan jembatan menuju Istana di mana nabi Yusuf menjadi seorang raja yang adil dan bijaksana. Adapun ragam dan bentuk konspirasi dan ujian yang dialami nabi Yusuf adalah; 1.Nabi Yusuf dimasukkan oleh saudara kandungnya ke dalam sumur. Kebencian dan kecemburuan yang berlebihan saudara Yusuf mendorong mereka melakukan ide busuknya. Mulai dari rencana membunuh Yusuf, membuangnya jauh dari kampung halaman, sampai pada ide memasukkannya ke dalam sumur. 2.Nabi Yusuf dijual sebagai budak. Ketika Yusuf di dalam sumur seorang diri, menghadapi kondisi dan suasana sumur yang mencekam, gelap gulita, jauh dari kasih sayang ayahnya, lapar dan dahaga yang mengancam kehidupannya merupakan ujian berat bagi nabi Yusuf. Sampai pada akhirnya datang sekelompok kafilah dagang yang menyelamatkan Yusuf dan menjualnya sebagai budak kepada seorang pembesar istana dengan harga yang sangat murah. 3.Nabi Yusuf menghadapi godaan Zulaikhah. Yusuf dijadikan pembantu di istana raja sampai mendatangkan simpatik wanitawanita di istana, terkhusus nyonya penguasa, yakni Zulaikhah. Tingkah laku Yusuf diperhatikan penuh hati-hati. Bunga api cinta di hati Zulaikhah makin hari membesar dan membara tiap kali ia melihat Yusuf. Sampai pada puncak birahinya Zulaikhah tidak dapat lagi menahan nafsunya dan berupaya menjebak Yusuf untuk melakukan maksiat. Berkat pertolongan Allah, akhirnya Yusuf selamat dari perbuatan mesum yang direncanakan Zulaikhah. 4.Nabi Yusuf dijebloskan dalam penjara. Atas fitnah Zulaikhah, Yusuf dimasukkan ke penjara. Tetapi bagi Yusuf penjara adalah tempat aman menghindari godaan yang menjerumuskannya ke kemaksiatan. Bagi Yusuf, penjara yang gelap dan sempit, adalah lebih baik dan lebih dicintainya daripada hidup di alam bebas tapi jiwanya tertekan dan hatinya tidak tenteram. Di dalam penjara Yusuf menguatkan pikirannya dan jiwanya beribadah dan menyembah Allah. Ia dapat melakukan dakwah di dalam penjara, memberi bimbingan dan nasihat kepada penghuni penjara sehingga banyak yang bertaubat dari kesalahannya dan simpatik kepada nabi Yusuf. Setelah berhasil menghadapi ujian demi ujian hidup, nabi Yusuf tumbuh menjadi sosok yang dewasa, adil dan bijaksana. Dan di balik beragam konspirasi itu semua skenario Allah ingin memersiapkan Yusuf menjadi pemimpin istana yang dapat mengemban risalah kenabian dan membawa umatnya ke jalan yang diridhoi Allah SWT.

Arif-Al Azhim Polres Asahan

H. SalmanTanjung, M.Ag, MA

BATUBARA Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Nurul Iman Desa Perkotaan Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

H. Serin H. Lukman Yanis, H.S. Azwan Lubis H. Muslim Ismail

PEMATANGSIANTAR Al-Abrar Jl. Aru Kel. Bantan Al-Amin Jl. Brigjen Rajamin Purba Kel. Bukit Sofa Al-Falah Jl. Pane No. 1 Kel. Karo Al-Falah Jl. Rakutta Sembiring No. 5 Kel. Naga Pita Al-Furqon Jl. Tekukur No. 2 Kel. Sipinggol-pinggol Al-Hanif Jl. Ade Irma Suryani Nasution No. 28 Al-Hidayah Jl. Bazoka No. 6 Kel. Bukit Sofa Al-Hidayah Jl. MelanthonSiregar No. 36 Sukamakmur Al-Hikmah Jl. Sibatu-batu Kel. Bah Kapul Al-Hilal Jl. Melanthon Siregar No. 218 P. Marihat Al-Huda Jl. Medan Km. 7,5 Kel. Tambun Nabolon Al-Huda Rindam Jl. Bangau Kel. Setianegara Al-Ihsan Gang Kapuk Kel. Tanjung Tengah Al-Ihsan Jl. Rajawali No. 26 Kel. Simarito Al-Ikhlas Jl. Ampi No. 17 Kel. Bantan Al-Ikhlas Jl. Bakung No. 44 Kel. Simarito Al-Ikhlas Blok II Sibatu-batu Makmur Al-Ikhlas Gg. Air Bersih No. 22 Kel. Naga Pitu Al-Ikhlas Jl. Mawar Karang Sari Permai Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Al-Ikhlas Jl. Silou Raya No. 2 Kel. Siopat Suhu Al-Ikhlas Jl. Tangki Kel. Naga Pita Al-Jihad Jl. Jenderal Ahmad Yani Kel. Asuhan Al-Jihad Jl. Melati No. 11 Kel. Simarito Al-Jihad Jl. Tongkol No. 86 Kel. Pardomuan Al-Khairiyah Jl. Jorlang Hataran No. 1 Kel. Simarito Al-Khoirot Tambun Timur Kel. Tambun Nabolon Al-Mukminun Jl. Sang Nawaluh Kel. Siopat Suhu Al-Musyawarah Jl. Flores II Kel. Bantan Baitul Abrar Jl. Meranti Kel. Kahean Baiturrahmah Jl. Tanah Jawa No. 75 Kel. Melayu Bakti, Jl. Singosari Kel. Bantan Bhakti Jl. Serdang Kel. Martoba Dakwah Jl. Jawa No. 23 Kel. Bantan Darul Aman Jl. Enggang No. 4 Kel. Sipinggol-pinggol Darul Maimanah Jl. Sriwjaya Gg. Mesjid Kel. Baru IlhamJl. Jenderal Ahmad Yani No. 43 Kel. Pardomuan Istiqomah, Jl. Bolakaki Kel. Banjar Jamik As-Saidah Jl. Siatas Berita Kel. Tomuan Jamik Jl. Medan Km. 4 Kel. Naga Pitu Mualifatul Bilad Jl. Setianegara II Kel. Setianegara Mujahidin Jl. Kabu-kabu No. 22 Kel. Kahean Nurul Hikmah Jl. Dr. Cipto No. 122 Kel. Simalungun Nurul Huda Blok III Kel. Bah Sorma Nurul Huda Jl. Melanthon Siregar Pematang Marihat Nurul Ihsan Jl. Nagahuta Gg. Mesjid Kel. Setianegara Nurul Iman Jl. Rakoetta Sembiring Kel. Naga Pitu Nurul Iman Tambun Timur Kel. Tambun Nabolon Rahmat Jl. Madura Bawah Kel. Bantan Rahmat Jl. Singosari No. 30 Kel. Martoba Raya Jl. Mesjid Kel. Timbang Galung Syafaat Jl. S.M. Raja Barat Kel. Bah Kapul Taqwa Ash-Sholeh, Jl. Silimakuta No. 30 Kel. Simarito Taqwa Jl. Dr. Wahidin Kel. Melayu Taqwa Jl. K.H. Ahmad Dahlan No. 18 Kel. Bukit Sofa Taqwa Jl. Merdeka No. 271 Kel. Dwikora Taqwa Jl. Patuan Anggi Gg. Perak Kel. Baru Ubudiyah Jl. Melur No. 11 Kel. Simarito

Bunyamin Rangkuti, S.Ag H.M. Rafii Nasir, BA Hanizar, S.Ag Masparuddin Purba Wahyudi, S.Ag Drs. Badaruddin Dalimunthe H. Aslam Alhuda Nst., S.Pd.I H. Ahmad Syuthury, S.Ag Samantio Sinaga, S.Pd.I H. Alimuddin Simamora H.M. Syarif Ritonga, Lc Jamuin Sinaga Drs. Mukhtar Mansur Sinaga, S.Ag Drs. H. Chaidir Sitompul M. Rusly Drs. Salahuddin, M.D. Drs. H. Amnar Lubis Zulhamri Siregar, S.HI Iswadi Lubis, S.Ag Hamami, S.Ag Drs. H. Yusri Batubara, MH H. Hasan Basri Siregar, MA Irwansyah Nara Harahap, S.Ag Drs. H. Zainul Arifin H. Sofyan Han Mhd. Arifin Siregar Suliardi, S.Pd.I H. Hasan Basri Siregar, MA M. Nuh Rambe, S.Ag Drs. H. Mhd. Ali Lubis Drs. H. Muhammad Asli Drs. H. Nasril Jambak Faidil Siregar, S.Ag Drs. H. Rasyid Nasution H. Zulkarnain Nasution, S.Ag Abdul Manaf Ahmad Hanafi Lubis, S.Ag H. Abdul Djalil, A. Ki Drs. Dardjat Purba, SH, MM Drs. H. Mustafa Kamal Siregar H. Abdul Ghaffar Nasution Muhammad Yunan Arga Syarifuddin Nasution, S.HI Agus Pandapotan Nst., S.Pd.I Drs. H. Marham, M.S. H. Muzayyin, BA Makmun Drs. Thamrin Asram Albar Suheri, S.Ag Drs. H. Abdul Haris Nasution Suhartono, S.Ag Fakhruddin Sagala, S.Pd.I Wajir Caniago Ahmad Syukri Batubara, S.Ag Hamdan Nasution, S.Ag M. Yusuf Purba, S.Pd.I Muhammad Yunan Arga

SIDIKALANG Agung Jl. Mesjid No. 2 Sidikalang Al-Muhajirin Perumnas Simbara Sidikalang

H. Sudiarman Manik, S.Pd.I Syafrizal Sitorus, S.Ag

Waspada, Jumat 19 April 2013