Issuu on Google+

Prakiraan Cuaca Selasa (4/8) Medan 25-34 C

Berastagi 18-28 C

R. Prapat 25-34 C

Parapat 18-28 0C

P. Siantar 19-290C

Sibolga 20-32 0C





Hujan guntur

BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

SELASA, Wage, 4 Agustus 2009/13 Sa’ban 1430 H

MK Ingatkan KPU Berikan Bukti Sengketa Pilpres JAKARTA (Antara): Mahkamah Konstitusi (MK) mengingatkan Komisi Pemilihan Umum (KPU) untuk dapat memberi bukti terkait adanya gugatan dari capres/ cawapres peserta pilpres 2009. “Jika KPU sebagai termohon tidak dapat memberi bukti yang sebaliknya, maka permohonan pemohon dapat dikabulkan dengan segala konsekuensi hukumnya,” kata Ketua MK, Mahfud MD, di Jakarta, Senin(3/8). Sebelumnya, tim pasangan capres/cawapres, Jusuf Kalla/ Wiranto dan Megawati/Prabowo Subianto, telah mengajukan gugatan perkara perselisihan hasil Pemilu Presiden 2009. Ketua MK menyebutkan konsekuensi hukumnya, seperti, bisa pemungutan suara ulang, penghitungan suara ulang, atau pengurangan perolehan suara. “Tapi MK sendiri belum tahu pihak mana yang akan menang dalam perkara ini, sebab perkaranya belum diperiksa. Semua akan tergantung pembuktian dipersidangan yang terbuka untuk umum,” katanya. Mahfud MD menyatakan semua harus percaya pada semangat para pemohon yang mengatakan bahwa pengajuan gugatan ini, bukan soal kalah atau menang. “Tetapi soal kebenaran, kualitas demokrasi dan tegaknya konstitusi,” katanya. “Kita juga harus percaya pada kesiapan capres/cawapres terpilih bahwa pengajuan perkara ini, adalah hak konstitusional yang harus dihargai dan karenanya pasangan yang telah dinyatakan menang (terpilih) siap menerima apapun putusan MK,” katanya. Ia menambahkan MK menjamin akan mengadili perkara sengketa pilpres dengan independen, obyektif, dan tanpa dapat diintervensi oleh siapapun. “Independensi MK ini bukan hanya dari independen dari tekanan pemerintah atau incumbent,” katanya. MK, kata dia, bertugas menegakkan demokrasi dan mengawal tegaknya konstitusi. “Perkara yang sedang ditangani sekarang ini, adalah pertaruhan bagi masa depan demokrasi dan konstitusionalisme kita. Oleh sebab itu, MK tidak mungkin bermain-main dalam menangani perkara ini,” katanya.

No: 22872 Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman

Harga Eceran: Rp 2.500,-

Rp37 T Untuk Kesejahteraan Rakyat Dan Untuk Penataan Kelembagaan Serta Pelaksanaan Sistem Perlindungan Sosial JAKARTA (Antara): Pemerintah mengalokasikan anggaran sebesar Rp37 triliun untuk Pemeliharaan Kesejahteraan Rakyat, serta Penataan Kelembagaan dan Pelaksanaan Sistem Perlindungan Sosial dalam RAPBN 2010. Hal itu disampaikan Kepala Negara Susilo Bambang Yudhoyono dalam Pidato Pengantar Rancangan Undang-undang tentang Anggaran Pendapatan dan Belanja Negara tahun 2010 dan Nota Keuangan di de-

pan rapat paripurna luar biasa DPRRI di Gedung MPR/DPR di Jakarta, Senin (3/8). “Sasaran yang hendak dicapai dari prioritas tersebut adalah menurunkan angka kemiskinan menjadi

12 - 13,5 persen,” katanya. Pada kesempatan itu Kepala Negara mengemukakan sejumlah kebijakan dan program pemerintah untuk pemeliharaan kesejahteraan rakyat, serta penataan kelembagaan dan pelaksanaan sistem perlindungan sosial antara lain melalui kenaikan gaji —bagi PNS, TNI, Polri, pensiunan, serta guru/dosen— dan pemberian BLT pada saat terjadi tekanan yang sangat berat terhadap

kelompok keluarga miskin. Pemerintah juga akan memberikan perlindungan pada masyarakat miskin atau hampir miskin (near poor) dengan menyediakan jaring pengaman sosial. “Salah satu fungsi negara adalah memberikan perlindungan dan menyediakan jaring pengaman sosial kepada masyarakat lapisan bawah. Untuk itu, berbagai program pro rakyat seperti BOS, Jamkesmas, PKH,

Lanjut ke hal 2 kol. 4

BACA DI HALAMAN DALAM Mudahnya Ganja Dan Heroin Masuk Medan, Pejabat Bandara Surati PT Pos General Manager (GM) Ap-II Bandara Polonia Medan Endang Sumiarsa menegaskan, pihaknya segera menyurati Dirut PT Pos di Jakarta terkait maraknya pengiriman ganja dan heroin dari luar negeri yang digagalkan petugas keamanan jajaran Bandara Polonia. 10

Pilkada 22 Daerah Tunggu Payung Hukum Rencana menggelar pemilihan kepala daerah (pilkada) secara serentak untuk 22 kabupaten dan kota di Sumut pada 2010, masih menunggu payung hukum. 11

Bank Sumut Kembali Raih Penghargaan Sangat Baik

Ruislagh SMAN 4 Rugikan Negara Dan Langgar Peraturan Tindakan Pemko dan DPRD Kota Pematangsiantar serta badan usaha PT Detis Sari Indah (DSI) terhadap pelaksanaan ruislagh atas aset pemerintah yakni tanah dan bangunan SMAN 4 dan SD 122350 di Jl. Pattimura merugikan keuangan negara. 19

Pemberontakan Supriyadi Salah Jepang Oleh Eddi Elison

Opini - 13

RAPBN 2010 Rentan Inflasi Pengamat ekonomi Vincent Wijaya menilai dari berbagai indikator yang diumumkan Presiden SBY dalam RAPBN 2010 sangat rentan inflasi. 16

Defisit Tahun Depan Rp98 Triliun Pemerintah dalan RAPBN 2010 menetapkan angka defisit sebesar Rp98 triliun atau 1,6 persen dari produk domestik bruto (PDB). 16

Baca halaman 4.

Depdiknas Peroleh Anggaran Terbesar

Baca halaman 2.

Kena Demam Tinggi

Waspada/Surya Efendi

KENAKAN MASKER: Para santri mengenakan masker dan berada dikarantina diruangan klinik Pondok Pesantren Darul Arafah menunggu hasil laboratorium Balitbang Depkes, Senin (3/8).

MK Mulai Gelar Uji Pasal 205 UU Pileg JAKARTA (Antara): Mahkamah Konstitusi (MK), Senin(3/8), mulai menggelar uji Pasal 205 ayat (4) Undang-Undang (UU) Nomor 10 tahun 2008 tentang Pemilu Legislatif. Permohonan itu diajukan oleh Partai Hati Nurani Rakyat (Hanura), lima caleg Partai Persatuan Pembangunan (PPP), dan Partai Gerakan Indonesia Raya (Gerindra). Ahli yang dihadirkan MK, Eep Saifullah Fatah, menyatakan, pasal tersebut multitafsir, sehingga menimbulkan ketidakpastian hukum. “Secara tekstual, itu mencederai asas proporsional,” katanya dalam persidangan dipimpin Mahfud MD. Hal senada dikatakan oleh ahli lainnya yang diajukan oleh MK, J

Kristiadi, bahwa pileg yang berlangsung di tanah air, bukan proporsional murni. “Pasalnya asas (proposional murni), yakni, one man one vote,” katanya. Kenyataannya, kata dia, proporsional dengan distrik. “Pileg bukan proporsional murni,” katanya. Sementara itu, anggota Komisi Pemilihan Umum (KPU), I Gusti Putu Artha, menyatakan, KPU konsisten dengan sudah dirumuskan hal itu dalam Peraturan KPU. “Jadi itu sebabnya KPU konsisten apa yang sudah kita rumuskan di peraturan KPU,” katanya.

DPR Sahkan RUU APBN-P Menjadi UU

Lanjut ke hal 2 kol. 4

Lanjut ke hal 2 kol. 7

Harus Ada Kesepakatan ASEAN Berantas Bisnis Narkotika MEDAN (Waspada): Perjanjian (pakta) kerjasama internasional mengenai kesepakatan bersama memberantas bisnis narkotika ilegal dan peredarannya perlu ada, kalaupun memang telah ada semestinya lebih diaktifkan khusus antara Indonesia dan Malaysia. Hal itu ditegaskan praktisi hukum Hasrul Benny Harahap, SH, M.Hum kepada Waspada, di Medan, Senin (3/8) menanggapi kesan bebasnya orang dari Malaysia membawa narkotika, terutama shabu-shabu. Sebab, lanjutnya, sangat aneh bila kita melihat dan membaca beri-

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengungkapkan gaji pegawai negeri sipil dan prajurit TNI serta Polri, dan pensiunan pada tahun 2010 akan dinaikkan rata-rata lima persen, guna memperbaiki penghasilan mereka. “Alokasi anggaran antara lain untuk memperbaiki penghasilan

ta media massa demikian banyak orang, apakah kurir atau bandar narkotika yang mampu melewati secara bebas pelabuhan serta bandara di Malaysia. ‘’Pertanyaannya, apakah memang semudah itu atau memang sama sekali tidak ketat pengawasannya ketika akan dibawa keluar Malaysia, terutama ke Indonesia khususnya ke kawasan Sumatera,” tanya Benny. Justru, lanjut dia, kita lebih salut terhadap kerja pemerintah Indonesia

Lanjut ke hal 2 kol. 7

MEDAN (Waspada): Ratusan santri di Pondok Pesantren Darul Arafah di Desa Lau Bakeri, Kec. Kutalimbaru, Kab. Deli Serdang diduga terserang virus flu babi (H1N1). Dua diantaranya terpaksa menggunakan infus. Para santri tersebut secara bersamaan pertama kali menderita pusing, batuk, flu disertai demam tinggi sejak Jumat (31/7). Namun, dokter dari puskesmas setempat dan Dinas Kesehatan Deli Serdang yang tiba dilokasi Senin (3/8) pagi, mengatakan para santri tersebut terserang Infeksi Saluran Pernapasan Atas (ISPA). Pantauan Waspada, 1.900 santri yang menuntut ilmu di pondok pesantren tersebut mengenakan masker penutup hidung dan mulut yang dibagikan Dinas Kesehatan Deli Serdang. Dinkes juga mendirikan posko

Lanjut ke hal 2 kol. 7

Gaji PNS Dan TNI-Polri Naik

JAKARTA (Antara): Rapat Paripurna Luar Biasa Dewan Perwakilan Rakyat-Republik Indonesia (DPRRI), Senin (3/8) menyetujui Rancangan Undang-Undang (RUU) Anggaran Pendapatan dan Belanja Negara-Perubahan (APBN-P) 2009 menjadi undang-undang. “Dengan demikian RUU APBNP disetujui menjadi undang-undang,” kata Muhaimin di Gedung DPR, Senayan, Jakarta, Senin. Sementara itu juru bicara Fraksi Partai Demokrasi-Indonesia (PDIP) I Gusti Agung Rai Wiraja menyatakan menyetujui RUU APBN-P 2009 untuk disahkan menjadi undang-undang. Di tempat yang sama Menteri Keuangan Sri Mulyani mengatakan soal stimulus ekonomi 2009, pemerintah berusaha semaksimal mungkin agar terserap secara penuh. Dalam APBN-P 2009 disepakati asumsi makro, pertama, pertumbuhan ekonomi 4,3 persen dari sebelumnya enam persen. Kedua,

Malaysia Agar Perketat Pemeriksaan

Untuk ketujuhkalinya PT Bank Sumut meraih penghargaan sebagai bank berpredikat ‘sangat baik’ dari majalah keuangan nasional InfoBank. 9

7 Prioritas Kebijakan Pemerintah

Ratusan Santri Darul Arafah Dikarantina

KPU Siapkan Materi Hadapi Gugatan Di MK JAKARTA (Antara): Komisi Pemilihan Umum (KPU) selama dua hari, sejak Minggu (2/8) hingga Senin (3/8) menyiapkan materi berupa jawaban dan data-data yang diperlukan untuk menghadapi gugatan pemilu presiden dan wakil presiden 2009 di Mahkamah Konstitusi. “Pada prinsipnya sudah siap semua. KPU provinsi sudah mengumpulkan bahan-bahan sejak kemarin. Mereka dibagi menjadi beberapa kelompok untuk menyiapkan bahan itu, yakni soal daftar pemilih tetap dan dugaan penggelembungan suara,” kata Ketua KPU Abdul Hafiz Anshary, di Jakarta, Senin (3/8). KPU telah mengundang KPU provinsi di seluruh Indonesia untuk menyiapkan data-data serta dokumen yang diperlukan dalam sidang perselisihan hasil pilpres yang dijadwalkan dimulai Selasa, 4 Agustus 2009. Ditemui terpisah, anggota KPU I Gusti Putu Artha mengatakan, pihaknya optimistis dapat membuktikan bahwa dugaan-dugaan seperti penggelembungan suara maupun masalah dalam DPT, tidak benar. Bukti-bukti yang diperlukan berkaitan dengan DPT, misalnya untuk di Jawa Tengah, KPU telah menyiapkan surat keputusan tentang pemutakhiran data pemilih.

Beras Bersubsidi, BLT bersyarat, dan sebagainya akan terus diperkuat,” katanya. Lanjut ke hal 2 kol. 7

aparatur negara dan pensiunan melalui kenaikan gaji pokok dan pensiunan pokok, pemberian gaji dan pensiunan bulan ke-13, kenaikan uang makan/lauk pauk bagi TNIPolri dari Rp35.000/hari menjadi Rp40.000/hari kerja,” kata Presiden ketika menyampaikan Pidato Pengantar RAPBN 2010 dan Nota Keuangan di depan Rapat Paripurna Luar Biasa DPR di Jakarta, Senin (3/8). Pidato pengantar RAPBN biasanya disampaikan pada tanggal 15 atau 16 Agustus, yakni beberapa hari menjelang peringatan hari ulang tahun Republik Indonesia. Namun karena DPR masa bakti 2004-2009 akan berakhir masa jabatannya pada akhir September serta pemerintahan baru dilantik 20 Oktober, maka penyampaian RAPBN ini

diajukan lebih awal sekitar dua minggu sehingga DPR dan pemerintah bisa bersama-sama membahas dalam waktu yang sesingkat mungkin, sebelum mengakhiri masa tugasnya. Pada acara yang dihadiri pula oleh Ibu Ani Yudhoyono, serta Wakil Presiden Jusuf Kalla serta Ibu Mufidah serta para pejabat negara lainnya, Presiden menyebutkan perbaikan penghasilan para pegawai negeri sipil, anggota TNI dan Polri serta pensiunan telah dilakukan sejak tahun 2004. Khusus bagi semua dosen serta para guru, Yudhoyono menjelaskan, pada Dana Alokasi Umum (DAU) terdapat tunjangan profesi guru.

Lanjut ke hal 2 kol. 7

DPRD Batubara Putuskan Temui Deplu Urus Husein Pemkab Tetap Lakukan Upaya Pembelaan LIMAPULUH (Waspada): DPRD Batubara memutuskan untuk mendatangi Departemen Luar Negeri (Deplu) di Jakarta sekaligus memberi dukungan agar eksekusi hukuman gantung sampai mati terhadap Husein Sitorus sebagaimana vonis Pengadilan Malaysia dapat ditunda. “Ini salah satu agenda rapat pimpinan dewan memutuskan melakukan kunjungan ke Daplu yang dijadwalkan tanggal 10 Agustus 2009,” sebut Ketua Komisi A DPRD Batubara, Sahari Zakaria, SH kepada Waspada melalui telefon selular memaparkan agenda rapat pimpinan yang digelar

DPRD Batubara, Senin (3/8). Eksekusi ini diharapkan dapat ditunda oleh Mahkamah Tinggi Rayuan karena Husein bukan pelaku atau orang pemilik ganja dan hanya berprofesi sebagai tekong boat membawa barang dagangan ke Malaysia dengan imbalan mendapatkan gaji/uang. “Semua ini nanti akan kita paparkan dihadapan Deplu sekaligus dapat melakukan komunikasi dengan Menteri Luar Negeri Malaysia dengan harapan amnesti dapat diberikan kepada Husien,” ujarnya. Lanjut ke hal 2 kol. 4

Dua Siswa SD Tewas Kena Gas Beracun Dalam Kapal Tongkang

Makan Siang Ditagih Rp 9,8 Juta, Turis Jepang Lapor Polisi Roma

BELAWAN (Waspada): Dua dari enam siswa sekolah dasar (SD) tewas ketika mencari besi bekas di dalam palka sebuah kapal tongkang yang sedang diperbaiki pada sebuah dok yang diduga illegal di Lorong Pemancar Lingkungan 29 Kel. Belawan I, Kecamatan Medan Belawan, Senin (3/7) malam. Keterangan yang dihimpun Waspada di lokasi kejadian menyebutkan kedua anak yang tewas tersebut adalah Rajak Alfiadi siswa kelas I dan Amraza Uliah Sahjana siswa kelas 6 SDN Pajak Baru Belawan. Peristiwa naas itu terjadi sekitar pukul 17.30 dan diketahui sekitar pukul 18:00. Ketika itu kedua korban bersama empat temannya sedang mencari besi tua di lokasi dok kapal milik A Guan. Entah siapa yang memulai keenam anak tersebut masuk ke dalam palka mainhold atau palka yang berisi banyak gas beracun milik salah seorang pengusaha Belawan. Belum berapa lama didalam palka itu, kedua korban pingsan dan meninggal karena menghirup gas beracun dalam palka itu sedangkan empat teman korban yang belum diketahui namanya

ROMA, Italia (Waspada): Bersantap di restoran di Roma harus benar-benar waspada. Bisa-bisa setelah hidangan tandas, bill yang disodorkan sungguh mencekik leher. Hal ini seperti dialami oleh sepasang turis Jepang. Alkisah, Yasuyuki Yamada dan tunangannya bersantap di restoran Il Passetto bulan lalu. Mereka terkejut karena bill yang mereka terima menerakan harga 700 euro atau setara Rp 9,8 juta. Harga itu termasuk seporsi pasta 207 euro (Rp 2,9 juta) dan juga ongkos pelayanan yang mencapai 115 euro (Rp 1,6 juta). Pasangan ini melaporkan tagihan mahal ini kepada polisi setempat. Kasus tidak menyenangkan ini menjadi perhatian pemerintahan Italia. Untuk menebus promosi buruk itu, pemerintah pun mengun-

dilarikan warga ke Rumkital Belawan untuk mendapatkan perawatan medis. Mendengar adanya peristiwa itu, dua warga sekitar Zainal, 26, dan Waisan, 43, berusaha memberikan pertolongan. Namun naas, kedua warga itu turut jadi korban dan terpaksa dirawat di RSU Martha Friska, Brayan karena mengalami kritis dan sekitar pukul 19:00 kedua korban dibawa keluarganya ke rumah duka. Kapolsekta Belawan AKP B Pasaribu bersama Kanit Reskrim Iptu B Pakpahan di lokasi kejadian mengatakan, pihaknya masih melakukan pemeriksaan terhadap lokasi kejadian dan belum ada yang ditetapkan sebagai tersangka dalam peris-tiwa itu. Seorang warga sekitar, Khelmi Mayor mengatakan selama ini warga telah resah dengan keberadaan dok kapal yang berada dekat dengan pemukiman warga itu. Lokasi dok kapal itu tidak pernah dijaga sehingga warga sekitar bebas masuk untuk mencari besi bekas. “Dok ini illegal dan harus segera ditutup karena berbahaya,” katanya.(cre)

dang turis itu kembali berkunjung ke Italia dengan gratis. Meski berterimakasih, namun Yamada, 35, tidak tertarik menerima hadiah itu. Menurutnya itu adalah “cara yang tidak berguna memanfaatkan uang pembayar pajak warga Italia”. Lanjut ke hal 2 kol. 7

erampang Seramp ang - Makan siang menegakkan bulu roma - He...he...he...

Berita Utama 2 Depdiknas Peroleh Anggaran Terbesar PPIA Protes Dikti JAKARTA (Antara): Departemen Pendidikan Nasional (Depdiknas) pada RAPBN 2010 memperoleh alokasi anggaran terbesar yang mencapai Rp51,8 triliun. “Anggaran besar untuk Departemen Pendidikan Nasional untuk menuntaskan pelaksanaan program wajib belajar pendidikan dasar sembilan tahun, pemerataan dan perluasan akses pendidikan, serta peningkatan mutu, relevansi dan daya saing pendidikan,” kata Presiden Susilo Bambang Yudhoyono pada Pidato Pengantar RAPBN 2010 dan Nota Keuangan di depan Rapat Paripurna Luar Biasa DPR-RI,

di Gedung MPR/DPR, Jakarta, Senin (3/8). Pada Rencana Kerja Pemerintah (RKP) 2010, pemerintah mengalokasikan anggaran belanja untuk seluruh Kementerian/Lembaga mencapai Rp327,6 triliun, meningkat Rp10,6 triliun dibanding RAPBN tahun 2009. Menurut Kepala Negara, dengan anggaran pendidikan yang mencapai 20 persen dari APBN diharapkan dapat menaikkan kesejahteraan guru, meningkatkan mutu pendidikan guna membangun keunggulan dan daya saing bangsa di abad 21.

Tahun 2010 Ada 1,7 Juta Angkatan Kerja Baru JAKARTA (Antara): Menteri Negara Perencanaan Pembangunan Nasional atau Kepala Bappenas Paskah Suzetta mengatakan, pada 2010 akan ada 1,7 juta angkatan kerja baru dan lapangan kerja yang tersedia 1,87 juta. “Jadi akan ada surplus 170 ribu lapangan pekerjaan. Jika tidak ada pengangguran baru maka pada 2010 angka pengangguran dapat ditekan,” kata Paskah saat jumpa pers di Direktorat Jenderal Pajak di Jakarta, Senin (3/8). Ia menambahkan, saat ini jumlah pengangguran sebanyak 9,25 juta orang. Paskah mengatakan, untuk tingkat kemiskinan pada tahun 2010, jumlah kemiskinan diperkirakan sebesar 12 sampai 13 persen. Sementara ditempat yang sama Menteri

Keuangan Sri Mulyani mengungkapkan, program bantuan langsung tunai (BLT) tidak akan ada lagi pada 2010, tetapi diganti dengan program keluarga harapan (PKH) dengan budget Rp 1,1 triliun. Sementara harga beras miskin atau bersubsidi Sri Mulyani mengatakan, pemerintah memastikan pada 2010 naik menjadi Rp 2.150 per kg dari Rp 1.600 per kg. Ia menjelaskan, subsidi beras pada 2010 mencapai Rp 11,8 triliun dengan jumlah rukun tetangga sasaran (RTS) sebanyak 7,5 juta kepala keluarga (KK) dengan durasi selama 12 bulan. “Pemerintah mengurangi anggaran subsidi menjadi Rp 144,4 triliun dari Rp 160 triliun,” imbuhnya.

DPR Setuju RUU Legislatif Jadi UU JAKARTA (Antara): Rapat Paripurna Luar Biasa DPR menyetujui RUU tentang MPR, DPR, DPD dan DPRD (legislatif) disahkan menjadi UU, setelah mayoritas fraksi menyatakan persetujuannya dalam pemandangan fraksi masing-masing. Dalam rapat paripurna yang dipimpin Ketua DPR Agung Laksono di Jakarta, Senin(3/ 8), sembilan fraksi, yakni FPDIP, FPD, FPAN, FPKS, FBPD, FPBR, FPDS, FKB dan FPPP menyatakan setuju RUU disahkan menjadi UU melalui pemandangan akhir fraksi yang dibacakan juru bicara masing-masing.Namun, Fraksi Partai Golkar masih menyatakan keberatan untuk beberapa pasal yang ada dalam RUU itu. Setelah seluruh fraksi menyampaikan pemandangan akhirnya dan sebelum pimpinan sidang mengambil keputusan pengesahan, Agung Laksono menskors persidangan selama 10 menit untuk dilakukannya lobi antarfraksi demi mencari titik temu. “Menurut catatan kami, sembilan dari sepuluh pimpinan fraksi menyetujui pengesahan RUU tentang MPR, DPR, DPD, dan DPRD, menjadi Undang-Undang dan satu fraksi, FPG untuk membahas ulang pimpinan MPR, dan syarat pembentukan fraksi,” ujar Agung. Dalam pembahasannya di tingkat pansus, DPR menyepakati adanya perubahan judul RUU dari semula bernama “RUU tentang Susunan dan Kedudukan MPR, DPR, DPD dan DPRD” menjadi “RUU tentang MPR, DPR, DPD

dan DPRD”. Menurut Ketua Pansus Ganjar Pranowo, perubahan judul tersebut disepakati karena muatan dalam RUU ini telah berubah dari hanya ruang lingkup susunan dan kedudukan menjadi lebih luas mengatur prosedur pelaksanaan hak, kewajiban, tugas, wewenang serta hubungan dari masing-masing lembaga perwakilan. UU tersebut juga memuat hal-hal strategis yang berkaitan dengan fundamental struktur ketatanegaraan Indonesia, seperti peranan MPR dalam perubahan UUD, proses pemakzulan serta pemilihan presiden dan atau wapres dalam hal berhalangan tetap. Selain itu, UU juga memuat tentang penegakan disiplin dan kode etik anggota dewan, dimana para anggota legislatif yang menyandang status terdakwa dalam satu kasus hukum dengan ancaman pidana akan diberhentikan sementara sebagai anggota DPR/DPRD dan pemulihan status berikut hak-haknya akan dikembalikan apabila pengadilan membuktikan mereka tidak bersalah. Pada bagian lain RUU itu juga diatur tentang penggunaan hak-hak kelembagaan DPR secara jelas. Khusus mengenai hak interpelasi, antara lain diatur bahwa presiden hadir untuk memberikan penjelasan tertulis terhadap materi interpelasi dalam rapat paripurna yang diselenggarakan DPR.

BPK Audit Dana Pemilu 2009 JAKARTA (Antara): Ketua Komisi Pemilihan Umum (KPU) Abdul Hafiz Anshary mengatakan mulai Senin (3/8) Badan Pemeriksa Keuangan (BPK) mengaudit pengelolaan dana KPU yang digunakan untuk penyelenggaraan pemilu legislatif dan presiden 2009. “Audit mulai hari ini (Senin, 3/8), jadi semua sampai KPU kabupaten atau kota dan provinsi. Waktunya selama 40 hari,” kata Hafiz, di Jakarta, ketika ditemui di Gedung KPU. Menurut Hafiz, audit tersebut merupakan kegiatan rutin dari BPK dan tidak ada kaitan dengan kasus apa pun. “Ini pemeriksaan rutin saja seperti di lembaga-lembaga negara lain,” katanya. Pada Senin siang, tim dari BPK tampak mendatangi KPU dan mengadakan pertemuan dengan Sekretariat Jenderal KPU. Pertemuan yang berlangsung di ruang rapat KPU tersebut bersifat tertutup. Ketika dikonfirmasi mengenai kegiatan

audit BPK tersebut, Sekretaris Jenderal KPU Suripto Bambang Setyadi membenarkan hal tersebut. Ia mengatakan audit yang dilakukan BPK ini untuk anggaran rutin KPU dan yang digunakan untuk menyelenggarakan pileg atau pilpres. “Ini hanya pemeriksaan biasa. Memeriksa pengelolaan anggaran KPU 2008-2009 dan anggaran untuk Pileg dan pilpres. Jadi ini tugas rutin,” kata Sekjen menerangkan audit yang dilaksanakan BPK. Anggaran yang akan diaudit yaitu untuk tahun anggaran 2008 dan 2009 sebesar Rp20,1 triliun. Jumlah dana itu terdiri atas anggaran 2008 sebesar Rp6,6 triliun dan anggaran 2009 sebesar Rp13,5 triliun. Namun, Suripto mengatakan dari total anggaran tersebut tidak semuanya digunakan KPU karena masih ada anggaran yang belum cair di tahun 2008 dan kembali ke kas negara yaitu sekitar Rp2,9 triliun.

Polri Yakin Berkas Antasari Lengkap JAKARTA (Antara): Kepala Divisi Humas Polri Irjen Pol Nanan Soekarna mengatakan, penyidik Polri sebenarnya telah yakin bahwa berkas berita acara pemeriksaan (BAP) tersangka kasus pembunuhan yang juga Ketua Komisi Pemberantasan Korupsi nonaktif Antasari Azhar telah lengkap. Ia mengatakan hal itu di Jakarta, Senin(3/ 8), menanggapi pengembalian berkas tersangka kasus pembunuhan Direktur PT Putra Rajawali Banjaran, Nasrudin Zulkiarnain dari Kejaksaan Agung ke Polda Metro Jaya. Pengembalian berkas hingga dua kali itu dilakukan pihak kejaksaan karena adanya kekurangan yang harus dilengkapi oleh penyidik. “Tugas polisi dalam penyidikan adalah membuat terang perkara dan menemukan tersangka. Dan kedua hal itu telah dilakukan. Jadi sebenarnya, berkasnya sudah lengkap,” katanya. Ia mengatakan, jika ada hal-hal yang perlu ditambahkan maka hal itu dapat dilakukan di pengadilan dan tidak harus dilakukan oleh polisi selaku penyidik. Menurut Nanan, kendati demikian, penyidik tetap akan memenuhi hal-hal yang diminta oleh jaksa penuntut umum. Ia mengaku tidak tahu secara pasti apa saja

yang diminta oleh jaksa penuntut umum hingga berkas Antasari dikembalikan lagi. Nasrudin tewas ditembak usai main golf di Modern Land, Tangerang, Banten, 14 Maret 2009. Ia meninggal dunia di RS Pusat Angkatan Darat Gatot Subroto, 15 Maret 2009, karena luka yang dialami di kepala cukup parah kendati tim dokter telah berusaha keras untuk menyelamatkan nyawanya. Pada akhir April 2009, Polda Metro Jaya menangkap enam tersangka yang berperan sebagai eksekutor di berbagai tempat di Jakarta. Pemeriksaan berikutnya mengarah kepada keterlibatan mantan Kapolres Metro Jakarta Selatan, Kombes Pol Williardi Wizar, dan pengusaha media Sigid Haryo. Ketua Komisi Pemberantasan Korupsi (KPK) Antasari Azhar juga ditahan sebagai tersangka karena diduga sebagai otak dalam pembunuhan ini. Akibatnya, Antasari dinonaktif sebagai Ketua KPK. Hingga kini, polisi belum menjelaskan motif kasus ini namun diduga adalah masalah asmara dengan seorang caddy golf bernama Rani Juliani.

Ijazah S1 Australia Disetarakan Dengan D3 Indonesia

BRISBANE (Antara): Perhimpunan Pelajar Indonesia di Australia (PPIA) memprotes kebijakan Ditjen Pendidikan Tinggi (Dikti) RI yang menyetarakan ijazah lulusan sebagian besar program sarjana (S1) perguruan tinggi di Australia dengan diploma tiga (D3) di Indonesia. Sikap PPIA terhadap Pedoman Penilaian Ijazah Perguruan Tinggi di Australia yang dikeluarkan Dikti RI itu disampaikan Mohamad Fahmi, ketua umum (demisioner) organisasi yang memayungi lebih dari 15 ribu mahasiswa Indonesia di Australia itu, dalam pernyataan persnya di Brisbane, Senin (3/8). Fahmi mengatakan, para mahasiswa program sarjana (undergraduate) Indonesia di Australia merasa dirugikan oleh kebijakan Dikti tentang sistem penyetaraan ijazah pendidikan tersebut. “Daftar penyetaraan Dikti ini tidak sesuai dengan prinsipprinsip kesetaraan dan cenderung asal-asalan,” kata maha-

siswa program doktor di Universitas La Trobe Melbourne itu. Kebijakan ini dikeluhkan banyak mahasiswa Indonesia di Australia, terutama mereka yang setelah lulus ingin bekerja di lembaga pemerintah dan non-pemerintah di dalam negeri yang mengharuskan penyetaraan ijazah oleh Dikti padahal di Australia, ijazah S1 sudah disetarakan berdasarkan standar “Australian Qualification Framework”. Kualitas lulusan tingkat sarjana yang ditempuh dalam durasi waktu tiga atau empat tahun di Australia itu sebenarnya tidak berbeda dengan tuntutan kualitas program sarjana di Indonesia seperti ditulis Kepmendiknas No. 232/u/ 2000 Pasal 3, katanya. “Namun, penyetaraan Dikti menggunakan pukulan waktu empat tahun untuk program S1 mengabaikan ratifikasi Republik Indonesia pada `Regional Convention on Recognition of Studies, Diplomas, and Degrees in Higher Education in Asia Pacific` di

Bangkok, 16 Desember 1983,” katanya. PPIA merekomendasikan kepada Dikti agar menyetarakan semua program S1 di Australia yang memenuhi kriteria “Australian Qualification Framework” dengan S1 di Indonesia. Untuk itu, pihaknya mendesak Dikti agar menyisir ulang daftar penyetaraan yang sekarang digunakannya, kata Fahmi. Hasil penelusuran PPIA mendapati adanya empat universitas non-Australia dimasukkan ke daftar universitas Australia, beberapa program S2 disetarakan dengan S3, beberapa program S3 disetarakan dengan S2, serta sejumlah kesalahan lainnya, kata dosen Universitas Padjadjaran ini. “Rekomendasi PPI Australia ini mewakili suara lebih dari lima belas ribu orang pelajar Indonesia di Australia. Sepatutnya Dikti membuka mata dengan realitas ini. Untuk ke depan secepatnya dilakukan perbaikan dalam sistem penyetaraan ijazah pendidikan yang ada,” katanya.

Harus Ada ...

dungi antar sesama negara anggota ASEAN, apalagi kita (Indonesia) sangat tidak suka jika dijuluki jaringan narkotika terbesar di dunia. Sebab, jika itu terjadi maka sudah pasti meruntuhkan martabat Indonesia di mata internasional. Sementara praktisi hukum Taufik Siregar, SH, M.Hum yang juga salah seorang staf (dosen) pengajar di perguruan tinggi Universitas Medan Area (UMA), berpendapat, hukum dan aturan terkait narkotika sudah bagus, cuma saja ’law enforcement’ (penegakan hukum) nya dinilai sangat lemah. Soal perlunya perjanjian kerjasama khusus antara negara, terutama Indonesia - Malaysia mengenai pengawasan ketat atas narkotika di bandara maupun pelabuhan laut, Taufik menegaskan memang perlu dan harus ada. Ini, terkait dengan akhir-akhir ini semakin banyaknya orang datang dari Malaysia tertangkap petugas Indonesia karena membawa narkotika. Bentuk kerjasama seperti disarankan Taufik, adalah untuk sama-sama tegas dan ketat serta serius mengusut siapa tersangka pelaku pemilik, pembawa dan pengedar narkotika di Malaysia. Khusus perlindungan dan pembelaan atas warga negara Indonesia yang terancam hukuman mati di Malaysia, prakakurat terhadap item-item yang dimohonkan tersebut, Putu mengatakan pihaknya berharap persidangan dapat selesai lebih cepat, tidak sampai berlarut-larut. KPU, lanjut dia, juga telah menyiapkan saksi ahli untuk hadir di persidangan. Saksi tersebut, lanjut dia, dapat berasal dari internal KPU. Untuk menghadapi gugatan ini, KPU telah menyiapkan tim advokasi yang beranggotakan sejumlah jaksa pengacara negara.

tisi hukum menyatakan salut terhadap negara Australia dan AS yang cekatan dalam upaya membela warga negaranya. ’’Diplomasi dan lobbi diplomatnya sangat serius terhadap negara yang akan menghukum warga negara mereka yang terlibat pidana, terutama narkotika,’’ papar Taufik. Tegasnya, pemerintah RI harus melalui jalur diplomasi yang handal agar pemerintah Malaysia mau memperketat pemeriksaan di bandara dan pelabuhannya terhadap orang yang terindikasi membawa narkotika saat keluar dari negeri mereka tersebut. Sedangkan Maswandi, SH, M.Hum baik selaku praktisi hukum maupun dosen hukum internasional di UMA, mengemukakan, pemerintah harus bisa menempatkan petugas di setiap pelabuhan dengan dasar dibuatnya kerjasama bilateral atau melalui perjanjian dalam kerangka ASEAN. Sementara, tentang penerapan hukuman sebagaimana Malaysia melakukannya terhadap warga Negara Indonesia, maka Indonesia juga harus demikian terhadap WNA yang terlibat narkotika di Indonesia, termasuk jikapun pelakunya warga negara Malaysia. Selain itu, perlu meningkatkan peran Duta Besar RI di Malaysia guna memberikan dukungan terhadap pentingnya pemberantasan narkotika di Indonesia. “Jadi jika dilihat dari ketiga hal itu dan kalaupun memang belum ada diupayakan serta dilakukan, maka itu membuktikan pemerintah kita sendiri memiliki kelemahan,” papar Maswandi. Kelemahan sebagaimana pendapat Maswandi itu yakni belum memiliki/belum adanya kerjasama Indonesia – Malaysia tentang upaya pembe-rantasan narkotika. Kemudian, penerapan ancaman hukuman tentang narkotika masih ringan. (m34)

gantung sampai mati oleh PN Malaysia, karena membawa ganja 148 kg. “Upaya pembelaan terhadap Husein jauh hari sebelumnya telah dilakukan dengan mengajukan kesaksian tertulis pada masa proses persidangan berjalan April 2009,” sebut Kabag Hukum Pemkab Batubara Zulhendri kepada Waspada, Senin (3/8). Dikemukakan itu menanggapi langkah yang telah dilakukan Pemkab Batubara selama ini untuk membebaskan Husien dari jeratan hukuman gantung. Kesaksian tertulis masingmasing diajukan Ahmad Tingkis dan Syafri Ifit Copi, warga Tanjungtiram ini dilakukan di hadapan Konjen Malaysia Di Medan dan dilegalisir. “Kita sendiri langsung yang mengantarkan menghadap majelis hakim di Pengadi-

lan Sah Alam Malaysia dengan harapan dijadikan sebagai bahan pertimbangan sebelum menjatuhkan vonis ,” ujarnya sembari mengatakan kesaksian demikian pernah dilakukan warga negara Jerman yang menjalani proses hukum di negara jiran. Langkah selanjutnya dilakukan Pemkab Batubara selain mengajukan kembali keterangan saksi tertulis di tingkat Mahkamah Rayuan juga mengupayakan menyiapkan saksi baru bila dibutuhkan. “Untuk itu kita secepatnya melakukan koordinasi dengan pengacara Husein,” ujarnya dalam waktu dua atau tiga hari lagi akan berangkat ke Malaysia sebagai mewakili Pemkab Batubara melalui dana bantuan bupati. Selain mempertanyakan Komnas HAM Internasional atas vonis hukuman gantung sampai mati. (a11)

yang benar-benar perang terhadap peredaran narkotika serta penyalahgunaannya, maupun kemampuannya mengungkap dan menangkap pelaku-pelakunya di bandara atau pun pelabuhan. “Tegasnya, Indonesia lebih serius daripada Malaysia dalam pemberantasan masuk dan peredaran narkotika,’’ ucapnya. Kemudian, Benny juga mengemukakan, pemerintah RI hendaknya memberikan masukan kepada pemerintah Malaysia perihal narkotika tersebut agar lebih memperketat pemeriksaan di bandara maupun pelabuhan, terlebih lagi jika terendus adanya pengiriman narkotika dari Malaysia ke Indonesia. Selain itu, Malaysia juga mesti tegas dan adil menghukum orang terkait narkoba, jangan kalau terkena warganya seakan ’tutup mata’, namun saat warga negara lain, terutama Indonesia, belum jelas faktanya, ternyata langsung divonis gantung sampai mati. ’’Kita imbau supaya Malaysia tidak sekadar slogan bertindak keras terhadap orang terlibat dan terkait narkotika. Makanya, secara khusus harus ada pernjanjian antara Indonesia dan Malaysia disertai seluruh negara ASEAN,” ujar Benny. Dengan demikian, kata dia lagi, akan dapat saling melin-

KPU Siapkan Materi ... “Itu kita lampirkan untuk menjawab bahwa kita me mang serius melakukan pemutakhiran di level bawah sesuai dengan jadwalnya,” katanya. Sementara itu, untuk menjawab dugaan penggelembungan maupun pengurangan suara, KPU menyiapkan berita acara seluruh tingkat kabupaten di seluruh Indonesia. Dengan pemberian kesaksian dan bukti yang sangat

DPRD Batubara ... Sebelum langkah ini dilakukan DPRD, kata Sahari, telah membentuk tim khusus untuk menemui Gubsu Syamsul Arifin, SE untuk rencana yang akan dilakukan sekaligus meminta masukan minimal eksekusi terhadap Husien dapat ditunda. Pemkab Batubara dapat mendukung sepenuhnya langkah yang akan dilakukan demi menyelamatkan warganya dari tiang gantungan. “Kita bukan eksekutor dan pengguna anggaran tak terlepas memerlukan dukungan Pemkab,” katanya. Telah berupaya Sementara itu Pemkab Batubara tetap melakukan upaya pembelaan terhadap langkah banding yang ditempuh Husien Sitorus, 60, warga Dusun IX, Desa Bogak, Kec Tanjungtiram yang divonis hukuman

WASPADA Selasa 4 Agustus 2009

MK Mulai Gelar ... Sebelumnya dilaporkan, Direktur Eksekutif MHI selaku kuasa hukum caleg PPP, AH Wakil Kamal, menyatakan, ketentuan Pasal 205 ayat (4) tersebut, rumusan normanya tidak sempurna sehingga terdapat celah untuk munculnya banyak penafsiran. “Puncaknya sejak terbitnya putusan MA Nomor 15P/Hum/ 2009 dalam perkara permohonan hak uji materiil antara Zaenal Ma’arif cs melawan Ketua KPU,” katanya. Pasal 205 ayat (4) itu memuat rumusan norma yang mengatur pembagian kursi tahap kedua. Bunyi pasal tersebut, yakni, “Dalam hal masih terdapat sisa kursi dilakukan penghitungan perolehan kursi tahap dua, dengan cara membagikan jumlah sisa kursi yang belum terbagi kepada partai politik peserta pemilu yang memperoleh suara sekurang-kurangnya 50 persen dari BPP DPR”. “Bahkan setelah terbitnya putusan MA tersebut, semakin banyak muncul perbedaan penafsiran sesuai dengan kepentingan politik masing-masing,” katanya. Hal senada dikatakan oleh kuasa hukum Partai Hanura, Andi M Asrun, yang meminta MK untuk menyatakan bahwa Pasal 205 ayat (4) UU Pileg itu, bersifat tidak mengikat. “Keberadaan pasal itu sudah menguntungkan bagi parpol besar,” katanya. Sementara itu, Ketua MK, Mahfud MD, meminta pihak pemerintah/DPR, dan pihak terkait untuk memberikan kesimpulan pada Selasa (4/8) siang. “Kemudian, pemohon diminta untuk memberikan alasan dari pengajuan uji (Pasal 205), karena sebelumnya pernah ada putusan pasal yang sama,” katanya.

DPR Sahkan RUU ... inflasi 4,5 persen dari sebelumnya 6,2 persen. Ketiga, nilai tukar Rp10.500 per dolar AS sebelumnya Rp9.400 per dolar AS. Keempat, Sertifikat Bank Indonesia (SBI) tiga bulan tetap 7,5 persen. Kelima, harga minyak Indonesia (ICP) 61 dolar AS per barel dari sebelumnya 80 dolar AS per barel. Keenam adalah “lifting” minyak tetap 960 ribu barel per hari. Dalam APBN-P 2009 disepakati juga besaran produk domestik bruto (PDB) tahun 2009 sebesar Rp5.401 triliun dari sebelumnya Rp 5.327 triliun.

Gaji PNS Dan ... “Tunjangan tersebut diberikan kepada guru dan dosen yang memiliki sertifikat pendidik, sebagai penghargaan atas profesionalitasnya, sesuai dengan kewenangannya,” kata Yudhoyono. Jika selama ini gaji guru terendah adalah Rp2 juta setiap bulannya, maka dalam RAPBN 2010 akan dialokasikan dana penyesuaian berupa tambahan tunujangan kependidikan bagi guru sebesar Rp7,9 triliun. “Kita semua berharap dengan ditingkatkannya alokasi anggaran ini, maka kesejahteraan para guru dan dosen akan semakin membaik dan akhirnya—sesuai dengan harapan rakyat— mutu pendidikan kita akan meningkat lebih tinggi lagi,” kata Kepala Negara dengan penuh harap.

Rp37 T Untuk ... Pada kesempatan itu Presiden menyampaikan sejumlah asumsi makro dan besaran APBN 2010 dalam RAPBN 2010 sebesar Rp1.009,5 triliun tersebut. Disebutkan antara lain target pertumbuhan ekonomi sebesar 5 persen, inflasi 5 persen, nilai tukar rata-rata per dolar AS sebesar Rp10.000, harga minyak mentah Indonesia (ICP) rata-rata per barel 60 dolar AS dan lifting minyak rata-rata 965 ribu baret per hari. Pemerintah juga menargetkan penerimaan pajak sebesar Rp729,2 triliun, PNBP (Pendapatan Negara Bukan Pajak) Rp180,9 triliun, alokasi belanja pemerintah pusat sebesar Rp699,7 triliun, alokasi anggaran kementerian/lembaga sebesar Rp327,6 triliun, alokasi anggaran Departemen Pendidikan sebesar Rp51,8 triliun, alokasi anggaran Departemen Pertahanan sebesar Rp40,7 triliun, dan alokasi anggaran Departemen Pekerjaan Umum Rp34,3 triliun. Kemudian alokasi anggaran Departemen Agama Rp26 triliun, alokasi anggaran Departemen Kesehatan Rp20,8 triliun, alokasi anggaran Departemen Perhubungan Rp16 triliun dan alokasi anggaran Kepolisian Negara Rp25,8 triliun.

Ratusan Santri ... di lokasi pesantren yang direncanakan selama 14 hari. dr Aguswan dari Puskesmas Pembantu Desa Lau Bakeri kepada Waspada mengatakan sedikitnya 500 santri yang mengalami gejala demam tersebut telah diperiksa dan 295 diantaranya menderita demam tinggi disertai batuk, pusing dan flu telah dikarantina disejumlah ruangan dan klinik di pondok pesantren ini. ‘’Dugaan sementara para santri ini terserang ISPA. Kami hanya memberikan suntikan, obat penurun panas, obat batuk dan anti biotik,’’ ujarnya. Hal senada juga dikatakan Kepala Bidang Pencegahan dan Pemberantasan Penyakit Dinas Kesehatan Deli Serdang, Ridha Hutajulu. Meski gejala yang ditunjukkan para korban mengarah kuat ke ISPA, tapi pihaknya tetap mengambil contoh cairan darah dan cairan dari tenggorokan dari para santri untuk selanjutnya dikirimkan ke Balitbang Depkes untuk memastikan tidak terjangkit virus H1N1, katanya. Sementara, Wakil Pimpinan Pondok Pesantren Darul Arafah, Harun Lubis membenarkan para santrinya terserang demam sejak Jumat (31/7). Jumlah para santri terbanyak menderita demam tersebut terjadi Minggu (2/8) malam. Karena jumlah santri yang menderita demam terus bertambah, kami menghubungi Dinas Kesehatan Deli Serdang. ‘’Sejauh ini belum ada satu pun dari para santri yang terjangkit penyakit ini yang dirujuk ke rumah sakit,’’ tuturnya. (h03)

Makan Siang Ditagih ... “Saya berterimakasih, namun saya tidak berniat menerimanya meski ada undangan formal datang,” kata Yamada di rumahnya di dekat Tokyo seperti ditulis Guardian dan dilansir Sydney Morning Herald, Senin (3/8). Meski demikian Yamada dan pasangannya tetap punya rencana kembali ke Italia di liburan mendatang, dengan ongkos sendiri. Il Passetto berkeyakinan bahwa bill untuk Yamada betul. Restoran itu menyatakan turis Jepang itu memesan menu paling mahal, di dalamnya termasuk losbter dan tiram. Beberapa minggu sebelumnya pasangan Jepang yang lain mengkomplain restoran itu atas bill 352 euro (Rp 4,9 juta) untuk “makanan sederhana dan main course yang dimakan berdua.” Restoran Il Pasetto, yang telah berusia 150 tahun dan salah satu pelanggannya adalah Leonardo DiCaprio dan Harrison Ford, tutup setelah komplain Yamada, namun diperkirakan akan buka kembali. Selama ini banyak turis Jepang dilaporkan kecewa dengan layanan yang buruk dan harga yang mahal di Italia. (dtc)

Dipaksa Minum Miras, Anak Penarik Betor Di Asahan Kritis TANJUNGBALAI ( Waspada): Abang beradik anak penarik becak bermotor di Kabupaten Asahan, dipaksa menenggak minuman keras oleh 4 pria dewasa di salah satu rumah kosong. Dan, akibatnya, Aditya Irfansyah, 8, warga Desa Sei Apung, Kec. Tanjungbalai, Asahan, terpaksa menjalani perawatan intensif di RSUD Kota Tanjungbalai, Senin (3/8). Sementara adiknya, Feri Irgi Ardiansyah, 6, hanya menjalani rawat jalan. Kejadian itu berawal ketika kedua putra pasangan Idham, 29, dan Ika Cipta, 23, itu, ber-main-main di salah satu rumah kosong tidak jauh dari tempat tinggal mereka. Di sana, Aditya dan Feri, bertemu 4 pria dewasa yang sedang menanggak minuman keras jenis new port. “ Mereka memanggil kami dan menyuruh meminum air berwarna hijau, kata mereka rasanya strawberry,” ujar Adtya. Semula Aditya dan Feri menolak permintaan 4 pria itu. Akan tetapi, karena dipaksa

dan diancam, akhirnya mereka meminumnya. “ Aku 3 gelas, sedangka Feri 3 gelas, tapi karena pahit, ya kami muntahkan, namun kami dipaksa meminumnya lagi,” ujar Aditya. Setelah menenggak minuman keras itu, Aditya dan Feri sempoyongan. “ Kepala kami pusing kali bang, seperti berputar-putar,” ujar Aditya. Sementara, pengakuan ibu korban, Ika Cipta, kejadian itu diketahui ketika neneknya menyuruh kedua bocah itu membeli rokok di kedai. “ Mereka disuruh membeli rokok, tapi yang dibelinya sisir. Dan, ketika disuruh menukarkannya kembali ke kedai, malah sabun yang dibeli mereka. Tidak biasanya mereka seperti itu, makanya kami curiga,” ujar Ika Cipta. Melihat sikap aneh itu, selanjutnya Ika dan sang nenek menginterogasi kedua bocah. “ Akhirnya mereka mengaku telah dipaksa menenggak minuman keras jenis new port oleh 4 pria dewasa tetangga kami,” jelas Ika. Takut terjadi hal tidak diinginkan terhadap kedua putranya itu, Ika lalu membawanya berobat

ke RSUD Tanjungbalai. “ Pengakuan anakku, perutnya sakit dan panas serta kepalanya pusing berat, makanya langsung kami bawa berobat ke rumah sakit. Dan, petunjuk paramedis, Aditya harus dirawat inap, sedangkan Feri hanya menjalani rawat jalan,” kata Ika. Ditolak Lebih lanjut dikatakan Ika, mereka juga telah melaporkan kejadian yang menimpa kedua anaknya itu ke Pos Polisi Bagan Asahan, tapi ditolak dengan alasan tidak ada kasus kriminal seperti itu. Selain itu, petugas di sana juga meminta agar tidak dilibatkan dalam kasus itu. “ Kata polisi di Bagan Asahan, mereka tidak menangani kasus seperti yang dialami anakku. Dan, petugas di Pos Bagan Asahan itu juga meminta agar kami jangan melibatkan polisi dalam kasus ini, apa karena kami orang miskin, makanya pengaduan kami tak diterima,” ungkap Ika. Akhirnya, Ika terpaksa melaporkan kejadian itu ke Mapolres Asahan, namun sampai ini belum ada tindak lanjutnya.

Keterangan Kapolres Asahan Sementara Kapolres Asahan AKBP Rudy Sumardiyanto melalui Kabag Binamitara Kompol M Hutagalung dikonfirmasi Waspada menjelaskan, pihak Polres Asahan masih melakukan penyelidikan terhadap kasus tersebut, dengan mendengarkan keterangan saksi-saksi dan memeriksa korban, apakah dia sakit karena miras atau karena dia sudah ada penyakit sebelumnya. “ Bila keterangan saksi-saksi dan bukti-bukti terkait memberatkan tersangka, maka tersangka akan diproses dengan hukum yang berlaku,” jelas Hutagalung. Disinggung masalah penolakan laporan ibu korban di Pos Polisi Bagan Asahan, Hutagalung menegaskan, Pos Polisi di Bagan Asahan bukan menerima laporan, namun membantu menciptakan ketertiban di masayarakat. “ Semua laporan di arahkan ke Polres Asahan bukan di pos Polisi, karena Pos Polisi tidak ada wewenang menerima laporan,” tugas Hutagalung.(a37/csap/a12)

Waspada/Rahmad F Siregar

KRITIS: Aditya Irfansyah, 8, warga Desa Sei Apung, Kec Tanjungbalai, Kabupaten Asahan, terpaksa menjalani rawat inap di RSUD Tanjungbalai.

WASPADA Selasa 4 Agustus 2009

Luar Negeri


Menlu Israel Akan Undurkan Diri Jika Dikenakan Tuduhan

Kota Di China Ditutup Setelah Wabah Misterius

JERUSALEM (AP): Menlu Israel mengatakan Senin (3/8) dia akan mengundurkan diri jika dia dituduh melakukan korupsi. Kepolisian Israel telah merekomendasikan bahwa Avigdor Lieberman akan dituduh dengan sejumlah tuduhan kejahatan, termasuk menerima suap, melakukan kecurangan dan pencucian uang. Jaksa Agung sekarang harus memutuskan apakah akan mendakwanya dan hal itu dapat memakan waktu berbulan-bulan. Lieberman mengatakan dia tidak melakukan tindakan yang salah namun jika dia dituduh, maka dia akan mengundurkan diri dari jabatannya ‘secepatnya.’ Lieberman telah membicarakan hal itu dalam satu temu pers Senin. Polisi sedang menyelidiki jutaan dolar yang diduga mencapai Lieberman melalui sejumlah perusahaan fiktif yang dibentuknya. Polisi mengatakan Lieberman menghadapi hukuman maksimum dari keseluruhan tuduhan 31 tahun penjara. Lieberman mengepalai partai beraliran keras Yisrael Beiteinu. (m07)

BEIJING, China (Antara/ Reuters): Dua orang tewas akibat wabah radang paru-paru misterius di satu tempat terpencil di China barat, demikian laporan media resmi negeri itu, Senin (3/8), dan kota kecil tempat wabah tersebut berpusat telah ditutup guna mencegah menyebaranya infeksi. Sebanyak 10 orang telah terserang penyakit itu di wilayah etnik Tibet di provinsi Qinghai, yang berpenduduk jarang, kata kantor berita resmi China, Xinhua. Kota kecil Ziketan dan wilayah sekitarnya telah ditutup, kata Kementerian Kesehatan dalam satu pernyataan. Ziketan memiliki sebanyak 10.000 warga.China mengalami wabah berkala, yang biasanya disebarkan oleh hewan pengerat dan kutu. Wabah radang paru-paru menular melalui udara dan dapat menyebar dengan cepat dari manusia ke manusia.

Keluarga Australia Tuntut KFC SYDNEY, Australia (AP): Satu keluarga Australia menuntut Kentucky Fried Chicken (KFC) Senin (3/8), dengan mengatakan putri mereka mengalami kerusakan otak dan pincang setelah makan ayam yang mengandung salmonella. Pengacara mereka mengatakan kepada Pengadilan Tinggi New South Wales dalam satu pernyataan terbuka tidak diragukan kalau Monika Samaan, saat itu berusia 7 tahun, menderita keracunan salmonella dari ayam yang dibeli dari outlet KFC di Sydney tahun 2005. “Hanya sedikit atau tidak ada keraguan bahwa ayam menurut semua ilmuwan, pada saat situasi tidak menyenangkan ini terjadi, sebagai sumber salmonella,” kata pengacara Anthony Bartley. Para pejabat KFC yang dioperasikan Louisville, Ym Brands Inc yang bermarkasdiKentucky,tidakbisadihubungiuntukdimintaiketerangan. Gadis itu, sekarang berusia 11 tahun, hadir di pengadilan dengan menggunakan kursi roda. Bartley mengatakan dia menderita spastik quadriplegia dan kerusakan otak sejak keracunan itu.(m18)

26 Orang Cedera Ketika Pesawat Terjebak Turbulensi MIAMI, Florida (CNN): Turbulensi keras mengguncang satu pesawat Continental Airlines Senin (3/8), yang menyebabkan puluhan orang penumpang cedera dan memaksa pesawat dialihkan penerbangannya ke Miami, Florida, demikian menurut perusahaan tersebut dan seorang pejabat pemadam kebakaran. Di dalam pesawat ketika itu terdapat 168 penumpang dan 11 awak dalam penerbangan dengan No. Flight 128, yang terbang dari Rio de Janeiro, Brazil, ke Houston, Texas, demikian kata satu pernyataan dari Continental Airlines. Sejumlah ambulan dan kendaraan lainnya berbaris dalam satu antrian di landasan pacu untuk merawat dan mengangkut para penumpang cedera pada saat pesawat mendarat di Bandara Internasional Miami pada pukul 05:35 dinihari. Continental mengatakan sembilan penumpang diangkut ke rumah sakit terdekat dan 28 lainnya dirawat di bandara. Lt. Elkin Sierra dari Miami-Dade Fire Department mengatakan 26 penumpang mengalami cedera, termasuk empat orang dalam keadaan parah. Boeing 767 itu terjebak turbulensi kira-kira 75 km di utara Republik Dominika kira-kira di ketinggian kira-kira 12.000 meter, demikian menurut seorang pejabat Badan Penerbangan Federal. Pesawat itu mendarat di Miami satu jam kemudian dengan tanda sabuk pengamannya menyala, kata Continental Airlines. Mereka yang cedera mengalami berbagai bentuk cedera, meliputi lecet-lecet, sakit leher dan sakit punggung, kata Sierra. Pesawat itu menurut rencana meninggalkan Miami menuju Houston pagi menjelang siang, demikian kataWeb site Continental. (m07)

100 Anak Yatim Diselamatkan Dari Kebakaran Di Makkah MAKKAH, Arab Saudi (ArabNews): Kesatuan Pertahanan Sipil dengan selamat berhasil mengevakuasi kira-kira 100 anak yatim dari satu panti asuhan di Sitteen Street. Gedung itu dilalap si jago merah Minggu (2/8) akibat adanya arus pendek, demikian menurut jurubicara Pertahanan Sipil, Letkol. Ali Al-Muntashiri. Dia menambahkan bahwa tak satupun dari anak-anak itu yang mengalami cedera dalam kebakaran yang terjadi di aula resepsi di lantai pertama dari bangunan bertingkat empat itu. Jurubicara itu mengatakan seorang wanita yang bekerja di panti yatim piatu itu mengalami gangguan pernafasan ringan akibat terhirup asap, namun dia mendapat perawatan di tempat yang diberikan paramedis Palang Merah yang ada di tempat kejadian. “Dia tidak membutuhkan bantuan rumah sakit untuk mendapatkan perawatan lebih lanjut,” katanya menambahkan. Al-Muntashiri mengatakan tujuh unit Pertahanan Sipil, yang terdiri dari lima tim pertolongan dan dua unit pemadam kebakaran untuk menangani api. “Kedua tim melakukan usaha besar untuk menyelamatkan anak-anak itu dan mengeluarkan mereka dengan selamat,” katanya. Dia memperkirakan kerugian sekitar 30.000 riyal Saudi. Tewas dalam kebakaran Seorang anak yang mengalami keterbelakangan mental dan fisik tewas ketika kebakaran terjadi di lantai pertama satu gedung tempat tinggal di distrik Al-Aziziyah, Makkah, Jumat malam, demikian kata Al-Muntashiri Sabtu. Dia tidak mengungkapkan nama korban, kebangsaan atau usianya. Dia mengatakan ambulan Palang Merah melarikan anak itu ke RS Spesial Al Nur di mana dia dinyatakan meninggal dunia akibat menghirup asap. “Tidak bekas luka bakar pada tubuhnya,” kata Al-Muntashiri. (m07)

Turki Temukan Kerangka Berusia 8.000 Tahun IBU-IBU MEMPROTES KENAIKAN HARGA

The Associated Press

Kaum wanita yang mengenakan kalung terbuat dari sayur-sayuran memukuli perabotan dapur mereka ketika mereka mengangkat slogan-slogan menentang pemerintah karena gagal mengatasi kenaikan harga bahan makanan di New Delhi, India, Senin (3/8).

China Tahan Lagi 319 Suku Uighur BEIJING, China (AP): Polisi di bagian barat China menangkap lagi 319 orang yang dicurigai terlibat dalam kerusuhan etnis berdarah antara minoritas Uighur Muslim dan etnis Han bulan lalu, kata kantor berita Xinhua. Polisi di Urumqi, ibukota Xinjiang, mengatakan penahanan itu dilakukan di kota tersebut dan di tempat lain di wilayah barat jauh, berdasarkan informasi yang diberikan masyarakat atau yang didapat dari penyelidikan, lapor kantor berita Xinhua Minggu (2/8) malam. Penahanan itu kelanjutan dari pengumuman awal pemerintah bahwa lebih 1.600 orang telah ditahan sehubungan kerusuhan tanggal 5 Juli di Urum-

qi yang berawal ketika polisi menghadang aksi unjukrasa penduduk Uighur yang berbahasa Turki. Uighur memecahkan kaca, membakar mobil dan menyerang suku Han. Dua hari berikutnya, Han turun ke jalanan dan melancarkan serangan balasan. Xinhua mengatakan polisi Urumqi tidak akan mengatakan berapa banyak — jika memang ada — dari 1.600 tahanan itu telah dibebaskan, dan para ter-

sangka akan menghadapi tuduhan terkait kerusuhan 5 Juli itu. Pemerintah mengatakan 197 orang tewas dan lebih 1.700 cedera dalam kerusuhan itu dan kebanyakan korban adalah suku Han. Uighur mengeluhkan tentang membludaknya suku Han yang berdatangan ke wilayah Muslim mereka dan batasanbatasan yang diberlakukan pemerintah. Mereka menuduh Han melakukan diskriminasi dan Partai Komunis mencoba untuk menghapus bahasa dan budaya mereka. Suku Han — yang kebanyakan di antara mereka didorong untuk pindah ke wilayah

tidak bisa diverifikasi. China berulangkali menyalahkan penghasut dari luar negeri dan pengaruh ‘tiga kekuatan jahat’ ekstrimisme, terorisme dan separatisme - namun hanya memberikan sedikit bukti yang mendukung tuduhan itu. Khususnya, negara itu menyalahkan aktivis Uighur Rebiya Kadeer karena menyulut aksi unjukrasa yang menyebabkan kerusuhan ketika polisi campur tangan. Kadeer mengatakan minggu lalu, 10.000 Uighur hilang dalam penindasan baru-baru ini, namun seorang pejabat China menyebut jumlah itu ‘hanyalah rekaan saja’. (m18)

Xinhua Siarkan Surat Dari ‘Putra’ Rebiya Kadeer

Ratusan Ribu Masyarakat Teriakkan Nama Aquino Saat Mayatnya Diarak

BEIJING, China (AP): Rebiya Kadeer — seorang wanita pengusaha terkemuka — yang pernahmerasakanbetapasakitnyamasukpenjara China selama enam tahun. Dia dipenjarakan — sebelum pergi ke pengasingan di Amerika Serikat tahun 2005 — atas tuduhan membahayakan keamanan negara. Kantor berita China, Xinhua, menyiarkan dua pucuk surat yang diduga ditandatangani oleh 12 kerabat dekatnya di China, termasuk salah seorang adik laki-lakinya dan dua anakanaknya. Salah satu dari surat itu meminta maaf kepada para korban kerusuhan. Surat lainnya, ditujukan kepada Kadeer, yang dimulai dengan ‘Ibu yang tercinta (Dear Mama), dan menuduhnya berada di belakang aksi kerusuhan di ibukota

MANILA, Filipina (AP): Ratusan ribu masyarakat yang berkabung meneriakkan nama Mantan Presiden Corazon Cory Aquino pada saat mayatnya dengan pengawalan diarak di jalanan Manila yang disiram hujan Senin (3/8). Proses lima jam itu diperlambat oleh aksi-aksi dari para pendukungnya, ketika melintasi beberapa jalanan yang dulu pernah menjadi tempat pergerakan Cory Aquino di mana dulu ratusan ribu demonstran — yang dipimpin Cory yang saat itu mengenakan pakaian serba kuning — berhasil menundukkan tanktank militer 23 tahun lalu dan tergulinglah rezim diktator. Pada hari Senin, puluhan ribu orang meninggalkan kantor, sekolah dan rumah mereka dan membanjiri jalanan dan jalanlayang, dengan memegang balon-balon kuning, melambaikan pita kuning dan menaburkan guntingan-guntingan

Xinjiang. “Karena mu, demikian banyak orang tak berdosa yang meninggal dunia di Urumqi pada 5 Juli lalu dan demikian banyak pula rumah, toko dan kendaraan terbakar atau dirusak,” kata Xinhua mengutip isi surat itu. Tidak ada cara untuk dapat mengkonfirmasi apakah surat itu ditulis oleh keluarga Kadeer. Dilxat Raxit, seorang jurubicara untuk kelompokpro-independenKongresUighurDunia di Jerman, mengatakan bukan para anggota keluarga Kadeer yang menulis surat itu atau kalau pun mereka yang menuliskannya, tentu mereka menghadapi tekanan untuk melakukan hal yang bertentangan dengan keinginan mereka tersebut. (m07)

Polisi Nigeria Selidiki Bentrok Korut Tolak Berikan Keterangan Korea Selatan (AP): an yang semakin panas antara waktu lama jika Pyongyang menYang Menewaskan 700 Orang KoreaSEOUL, Utara menolak mem- kedua Korea dan meningkatkan coba memanfaatkan kasus itu sebagai tekanan terhadap Seoul.

MAIDUGURI, Nigeria (AP): Polisi di utara Nigeria menyelidiki bagaimana sekte Islamis berusaha menimbulkan gelombang aksi kekerasan yang mengakibatkan lebih dari 700 orang pekan lalu, demikian menurut jurubicara kepolisian Senin (3/8). Ulama moderat Muslim dan para sarjana mengatakan mereka telah memperingatkan para pejabat pemerintah tentang sekte yang tendensius menjurus kekerasan dan peringatan itu disampaikan sebelum militan Bako Haram menyerang kantor polisi di negara bagian Bauchi pada 26 Juli. Aksi kekerasan itu dengan cepat menyebar ke tiga negara bagian sebelum pasukan Nigeria melakukan pembalasan, dengan menyerbu kompleks kelompok tersebut di Maiduguri Rabu dan membunuh lebih dari 100 pejuang. Polisi dalam beberapa hari lalu telah menangkap 20 anggota sekte itu, kata jurubicara kepolisian negara bagian Borno Isa Azaza. Sebagian didapati bersama sejumlah bahan peledak, konteiner aluminium dan bahan kimia pembuat, senapan serbu dan bendera hitam dan putih dengan tulisan Arab, kata Azaza. Dia menolak untuk mengatakan dari mana para pria itu. Banyak para anggota sekte Bako Haram berasal dari negara tetangga Niger.“Penyelidikan masih dilakukan,” katanya, yang menambahkan bahwa polisi masih melakukan mencari para buronan. Azaza mengatakan kelompok itu terorganisasi dengan baik dalam serangan ke kantor polisi dan beberapa instalasi pemerintah. “Mereka membagi tugas dan menyerang semua kantor polisi di daerah metropolitan,” katanya. “Serangan itu terencana rapi.” Kota Maiduguri berada dalam keadaan tenang Senin pagi, polisi melakukan patroli jalanan dengan kendaraan lapis baja. Polisi juga berjaga-jaga di beberapa persimpangan penting dan melakukan pemeriksaan para pejalan kaki. Kol. AD Ben Ahanotu mengatakan banyak anggota sekte itu masih bebas. “Banyak di antara mereka masih bebas... hanya beberapa orang saja yang dianggap berbahaya,” katanya kepada The Associated Press. (m07)

itu oleh pemerintah — meyakini suku Uighur seharusnya bersyukur atas perkembangan ekonomi yang pesat di Xinjiang. Laporan penahanan itu muncul di saat pesan lewat Internet yang diperkirakan dari pemimpin kelompok Islam yang memerangi kekuasaan China di Xinjiang mengimbau Muslim di seluruh dunia untuk menyerang tempat-tempat penting China sebagai balasan atas apa yang mereka sebut penindasan terhadap Uighur. Rekaman suara orang yang mengaku bernama Sheik Abdul Haq al-Turkistani disiarkan di Internet Minggu. Keasliannya

ANKARA, Turki (Antara/ Xinhua-OANA): Kerangka yang berusia 8.000 tahun ditemukan selama penggalian di salah satu daerah permukiman tertua di Turki Selatan, demikian laporan kantor berita setengah resmi Anatolia. Kerangka tersebut ditemukan di dalam kuburan zaman Neolitik yang dibongkar di Yumuktepe Hoyuk di provinsi Mersin di bagian selatan negeri itu oleh beberapa ahli arkeologi dari Lecce University, Italia, dan Mimar Sinan Fine Arts University, Turki, kata laporan itu Minggu (2/8).Temuan lain selain kerangka tersebut adalah tiga mangkuk, biji gandum, dan bibit zaitun, katanya. “Vas, mangkuk, dan produk makanan seringkali ditaruh di dalam kuburan pada masa akhir Neolitik. Ini memperlihatkan bahwa orang yang hidup pada era itu percaya pada kehidupan setelah kematian,” kata Profesor Isabella Caneva dari Lecce University, Italia. Penggalian secara sistematis di Yumuktepe Hoyuk pertama kali dilakukan pada 1936 di bawah pengawasan ahli arkeologi Inggris, John Garstang. Sejak 1993, penggalian telah dilakukan oleh satu tim yang dipimpin oleh Caneva, kata laporan tersebut.

berikan keterangan rinci tentang empat nelayan Korea Selatan yang ditangkap minggu lalu setelah kapal mereka melewati perbatasan, dan hanya mengatakan penyelidikan tengah dilakukan, kata seorang pejabat Korsel Senin (3/8). Penangkapan Kamis itu dilakukan di tengah-tengah hubung-

ketegangan terkait ujicoba rudal dan nuklir Pyongyang sebagai sikap mengabaikan resolusi PBB. Rezim komunis itu juga menyandera seorang warga Korea Selatan (Korsel) dan dua wartawan Amerika sejak Maret lalu. Kekhawatiran meningkat akan nasib para nelayan itu yang mungkin ditahan dalam jangka

Senin, Jubir Kementrian Unifikasi Lee Jong-joo mengatakan Korsel telah meminta keterangan dari Korea Utara (Korut) tentang kasus itu namun diberikan jawaban yang sama seperti sebelumnya. “Korut hanya mengatakanbadankoresponden sedang melakukan penyelidikan atas kasus itu,” katanya. (m18)

kecil kertas ke atas peti mayat Aquino yang dibalut bendera Filipina, yang diletakkan di atas truk yang ditaburi kembang. Kuning merupakan simbol anti kekerasan people power, pergolakan yang memaksa Ferdinand Marcos turun dari kekuasaannya tahun 1986 lalu. Kebanyakan dari para pelayat adalah biarawati, pendeta, mahasiswa, penduduk dan para pembantu mereka yang mengenakan seragam kuning, warna favorit Aquino. Beberapa spanduk bertulisan Thank You Corazon Aquino dan You’re Not Alone — yang merupakan slogan Aquino dari revolusi 1986. Dari satu stadion sekolah di mana peti mayat itu telah dibuka untuk umum yang ingin menjenguk setelah ditempatkan di sana sejak kematiannya Sabtu, iring-iringan kendaraan yang membawa mayat Aquino melintasi tempat suci people

power di jalanraya EDSA, di mana ratusan ribu pendukungnya memblokade tank-tank Marcos pada 1986. Di sepanjang Ayala Avenue, di mana Aquino memimpin barisan pro-demokrasi, pekerja dari gedung-gedung pencakar langit menghujani iring-iringan itu dengan guntingan-guntingan kecil kertas kuning ke atas kerumunan di bawahnya. Imelda ingin akur Sementara itu, mantan ibunegara Filipina Imelda Marcos Senin mengatakan, dia ingin melakukan rekonsiliasi dengan keluarga Aquino, yang menggerakkan revolusi people power yang menumbangkan suaminya, Marcos, dari kekuasaan. “Saya bisa merasakan sakitnya, kehilangan seseorang yang dicintai, saya berdoa untuknya. Jika kedua keluarga ini akur kembali, terjadi keajaiban di kalangan rakyat Filipina,” kata Imelda. (m07) k televi Keluarg sebel meng para a keluarg boleh jenazah presiden mening pada tahun diperk tidak samb hangat



WASPADA Selasa 4 Agustus 2009

7 Prioritas Kebijakan Pemerintah

SBY: Kelola Anggaran Secara Transparan JAK ARTA ( Waspada): Pemerintah Susilo Bambang Yudhoyono (SBY ) sudah menetapkan tujuh prioritas kebijakan ekonomi nasional yang sudah dijalankan, dan ke depan akan semakin dimantapkan.


PENEMUAN AMUNISI: Seorang anggota TNI AD menata peluru kaliber 9 saat gelar penemuan amunisi di Makodim 0809 Kediri, Jawa Timur, Senin (3/8). Kodim 0908 Kediri menemukan amunisi di dua pekarangan warga di Grogol dan Pare yakni peluru kaliber 7,62 sebanyak 38 butir, 70 butir peluru kaliber 45, peluru kal 9, 2 sebanyak 105 butir, megazen, dan satu granat nanas. Dandim 0809 Letkol Inf Totok Imam menyatakan penemuan tersebut tidak terkait dengan jaringan terorisme.

Tidak Semua Anak Bisa Masuk SMP Reguler JAKARTA (Waspada): Menteri Pendidikan Nasional (Mendiknas) Bambang Sudibyo mengakui tidak semua anak bisa masuk SMP reguler. Ada saja kelompok anak yang tidak terlayani karena mengalami banyak kendala, seperti kemiskinan dan geografis yang sulit. “Bersyukur kita memiliki sistem belajar yang fleksibel, tidak kaku dan rileks. Artinya kalau tidak bisa masuk SMP reguler bisa masuk SMP terbuka atau paket B di pendidikan kesetaraan,” kata Bambang Sudibyo saat membuka Lomba Motivasi Belajar Mandiri (Lomojari) 2009 di Plaza Depdiknas, Senin (3/8). Baik SMP reguler, SMPT

atau paket B kesetaraan dikatakan Mendiknas sebagai satu sistem pendidikan di Indonesia yang masih memprioritaskan perluasan akses. Selain untuk meningkatkan angka partisipasi kasar (APK) SMP, juga untuk menyukseskan program wajib belajar (wajar) 9 tahun. Saat ini APK SMP sudah mencapai 98 persen dari target 95 persen pada akhir 2008. “Pelan tapi pasti kita akan menuju mutu pendidikan lebih berkualitas. Karena itu ada program Bantuan Operasional Sekolah (BOS) yang tahun ini anggarannya mencapai Rp17 triliun,” terangnya. Sementara, 45 Sekolah Menengah Pertama Terbuka

(SMPT) dari 15 provinsi di Indonesia menghadirkan sejumlah siswanya mengikuti Lomojari 2009 di Jakarta. Kegiatan yang sudah masuk tahun ke-7 dimaksudkan sebagai upaya meningkatkan kreativitas, semangat dan rasa percaya diri siswa. “Lomba keterampilan siswa seperti ini merupakan alat mempersiapkan mutu dan kualitas siswa SMPT yang memang didisain sedemikian rupa, supaya mereka jadi anak-anak terampil dan mampu menghadapi kehidupan nyata yang penuh persaingan kerja,” ujar Direktur Pembinaan SMP Depdiknas, Didik Suharyadi. Jenis keterampilan yang

dilombakan dan dipamerkan dikelompokkan menjadi 5 bagian yakni, kriya tekstil, kerajinan, kriya kayu, tenun tradisional dan tata boga. SMPT Percut Sei Tuan dari Deli Serdang, Sumut menjadi salah satu dari 45 SMPT yang ikut Lomojari. Kepala Sekolah SMPT Percut Sei Tuan Arwidah Parinduri mengatakan, jenis keterampilan yang diambil kriya tekstil berupa bordir dan sulaman. “Kami disini mengajarkan siswa-siswi untuk terampil membordir. Hasil produksinya dipasarkan melalui toko dan pameran,” kata Arwidah, yang tahun lalu juga menyertai siswanya ikut Lomojari.(dianw)

Ahli Forensik: David Widjaya Alami Luka Defensif JAKARTA (Antara): Ahli forensik Universitas Indonesia Dr Djaja Surya Atmadja mengatakan, David Hartanto Widjaya, 22, mengalami luka defensif yang menunjukkan bahwa mahasiswa Nanyang Technological University (NTU) itu diserang sebelum wafat. “Luka di tubuh David defensif wound atau luka, karena mempertahankan diri,” kata Djaja dalam jumpa pers di Jakarta, Senin (3/8). Sedangkan yang selalu diberitakan media Singapura, David melakukan penyerangan kepada Profesor Chan Kap Luk, dosennya di NTU, sebelum David melakukan bunuh diri. Djaja memaparkan, luka terbuka dengan tepi rata pada lengan atas kiri dan kanan sesuai dengan luka tangkis atau luka karena melindungi diri. “Hal itu menunjukkan David diserang oleh senjata tajam dan melindungi dirinya,” katanya. Selain itu, berdasarkan data yang diperoleh dari keterangan hasil otopsi David oleh Health Science Authority Singapore, ditemukan luka melebar di pergelangan tangan kanan. Padahal ujar Djaja, kalau David bunuh diri, seharusnya luka seperti itu terdapat di pergelangan tangan kiri karena David bukanlah orang kidal. Djaja juga mengemukakan, robekan di ginjal kiri David cenderung kepada kekerasan benda tumpul dibanding dengan kekerasan akibat jatuh dari ketinggian seperti dijelaskan

Pengadilan Koroner Singapura. Dia juga menyorot patah tulang spiral pada paha kiri David yang sangat jarang disebabkan jatuh dari ketinggian. Sebelumnya, Pengadilan Koroner Singapura pada Rabu (29/7) memutuskan bahwa almarhum David melakukan bunuh diri sehingga kasus tersebut tidak bisa dibawa ke pengadilan kriminal. Selain itu, submission atau materi keberatan dan tanggapan hukum yang diajukan keluarga David dibantah jaksa negara jiran tersebut. Pihak keluarga dan berbagai pihak meyakini David meninggal karena telah dibunuh, bukan karena bunuh diri sebagaimana yang dikatakan sejumlah pihak di Singapura. Sebagaimana diberitakan, David meninggal secara tidak wajar di dalam kampusnya di Singapura pada 2 Maret 2009. Singapura kembalikan barang-barang David Sementara pihak kepolisian Singapura siap mengembalikan barang-barang pribadi milik almarhumDavidHartantoWidjaja, termasuk komputer jinjing (laptop) kepada pihak keluarga. “Saya sudah menghubungi keluarga David bahwa pihak kepolisian Singapura siap menyerahkan barang-barang pribadi David dalam minggu ini,” kata Yayan Mulyana, Sekretaris Pertama KBRI Singapura, di Jakarta, Senin (3/8). Menurut Yayan, barangbarang itu digunakan sebagai

barang bukti selama persidangan koroner. “Awalnya memang pihak kepolisian Singapura menyatakan akan mengembalikan barang itu sebelum persidangan pertama Mei. Namun keluar court order bahwa barang itu baru dapat dikembalikan setelah proses persidangan selesai,” tambahnya.

Yayan belum dapat memastikan kapan pihak keluarga David akan mengambil barangbarang itu. “Pihak keluarga belum dapat memastikan kapan akan ke Singapura untuk serah terima. Ayah David mengatakan, akan kembali masuk kantor setelah beberapa waktu meninggalkan pekerjaan,” kata Yayan.

Sidang Prita, Nasruddin Digelar Saat Ramadhan TANGERANG (Antara): Dua persidangan yang cukup menyorot perhatian publik yakni sidang kasus Prita Mulyasari dan lima tersangka pembunuh Direktur PT Putra Rajawali Banjaran Nasrudin Zulkarnaen, akan digelar di PN Tangerang, pada bulan Ramadhan. “Sidang Prita dan lima eksekutor Nasruddin akan dilangsungkan pada bulan Ramadhan, atau tepatnya pertengahan Agustus 2009,” ungkap Ketua PN Tangerang M Asnun, SH di Tangerang, Senin (3/8). Asnun menjelaskan, sidang Prita menjadi perhatian banyak orang karena terus disorot oleh media untuk mengikuti perkembangan konflik perseteruan antara Prita dan pihak yang merasa dirugikan. Asnun mengungkapkan, jarak waktu kedua kasus persidangan itu tidak berbeda jauh pada bulan Ramadhan, dimana pengamanan akan lebih diper-

ketat ketika dua persidangan itu digelar. “Dalam sidang Prita dan Nasruddin, PN Tangerang masih menunggu kepastian waktu persidangan dari Pengadilan Tinggi (PT) Banten.” Sementara, salah satu calon anggota majelis hakim sidang Prita, Perdana Ginting mengaku siap untuk melaksanakan sidang lanjutan kasus Prita setelah sebelumnya dihentikan PN Tangerang, 25 Juni lalu. “Bila sudah diputuskan langsung PT Banten kapan waktu sidang, saya sebagai salah satu calon majelis hakim persidangan Prita akan melaksanakan apa yang telah ditugaskan,” ujar Perdana disamping Ketua PN Tangerang. Berkas kasus Prita dan lima pembunuh Nasruddin telah diserahkan ke Kejaksaan Negeri Tangerang. Kelima eksekutor tersebut yakni Heri Susanto, Hendrikus Kia Walen, Eduardo Ndopo Mbete, Franciskus Sheran Kerans dan Daniel Daen.

Ketujuh kebijakan ekonomi yang diprioritaskan; pertama, menjaga agar sektor riil terus bergerak, kedua, mencegah terjadinya gelombang pemutusan kubungan kerja (PHK). Ketiga, menjaga stabilitas harga terutama bahan pokok. Keempat, menjaga dan meningkatkan daya beli masyarakat dalam bentuk penurunan tarif pajak penghasilan pribadi, peningkatan batas penghasilan tidak kena pajak, penurunan harga BBM, kenaikan gaji PNS, TNI, Polri, pensiunan serta guru/ dosen dan pemberian BLT pada saat terjadi tekanan yang sangat berat terhadap kelompok keluarga miskin. Kelima, memberikan perlindungan pada masyarakat miskin atau hampir miskin. Keenam, menjaga ketahanan pangan dan energi. Ketujuh, tetap berupaya mempertahankan pertumbuhan ekonomi nasional pada angka relatif tinggi setidaknya 4-4.5%. “Pemerintah akan terus menjaga stabilitas harga pangan, khususnya beras dengan menyediakan dana siaga sebesar Rp1 triliun pada 2010,” ujar SBY dalam pidato penyampaian pengantar/keterangan pemerintah atas Rancangan Undangundang (RUU) tentang Anggaran Pendapatan dan Belanja Negara (APBN) 2010 di depan rapat paripurna luar biasa DPR, Senin (3/8) di DPR Jakarta. Menurut SBY, pembangunan ekonomi nasional 2010 tidak terlepas dari tantangan dan harus bisa menjawabnya dengan langkah nyata antara lain, memelihara dan memantapkan stabilitas ekonomi makro sebagai prasyarat bagi pembangunan ekonomi yang berkelanjutan. Mendorong peningkatan akselerasi pertumbuhan ekonomi dengan mengembangkan sumber pertumbuhan yang lebih berimbang, yang lebih bertumpu pada peran investasi dan ekspor non migas. Kemudian menciptakan lapangan kerja yang lebih luas guna menurunkan tingkat pengangguran dan kemiskinan. Menciptakan iklim investasi lebih baik, meningkatkan ketersediaan infrastruktur memadai dan berkualitas, agar dapat mencapai tingkat pertumbuhan ekonomi yang lebih tinggi dan berkelanjutan, serta meningkatkan kemitraan antara pemerintah dan swasta untuk pembiayaan investasi dalam penyediaan insfrastruktur. Dalam rencana kerja pemerintah (RKP) 2010 kata SBY, ada lima agenda program pembangunan nasional yaitu, pemeliharaan kesejahteraan rakyat, utamanya rakyat miskin serta penataan kelembagaan dan pelaksanaan sistem perlindungan sosial. Peningkatan kualitas SDM, pemantapan reformasi birokrasi dan hukum serta pemantapan demokrasi dan keamanan nasional. Lalu pemulihan ekonomi di dukung pembangunan pertanian, infrastruktur dan energi. Peningkatan kualitas pengelolaan sumber daya alam dan kapasitas

penanganan perubahan iklim. Diakuinya penyusunan RAPBN 2010 dilakukan berdasarkan asumsi ekonomi makro sebagai berikut; pertumbuhan ekonomi diperkirakan 5%, tingkat inflasi 5%, nilai tukar rupiah rata-rata Rp10.000/dollar AS, suku bunga SBI 3 bulan ratarata 6.5%, harga minyak mentah Indonesia di pasar internasional US$60 per barrel dan lifting 965 ribu barrel per hari. Pendapatan negara dan hibah direncanakan mencapai Rp911.5 triliun atau meningkat Rp38.8 triliun dari sasaran RAPBN Perubahan 2009. Belanja negara direncanakan Rp1.009,5 triliun, berarti lebih tinggi Rp3.8 triliun dari yang dianggarkan dalam RAPBN-P 2009. Dengan demikian defisit anggaran 2010 direncanakan Rp98 triliun (1.6% dari PDB). “Jumlah ini mengalami penurunan Rp35 triliun dibandingkan target rencana dalam RAPBN-P 2009 sebesar Rp133 triliun (2.5 persen PDB).” Prioritas belanja juga dipertajam dengan program prioritas nasional yakni, memperbaiki kesejahteraan aparatur negara dan pensiunan, melanjutkan seluruh program kesejahteraan rakyat seperti PNPM, BOS, Jamkesnas, PKH dan beras bersubsidi, melanjutkan pembangunan infrastruktur transportasi, pertanian, energi dan proyek padat karya lainnya. Kemudian mendorong revitalisasi industri dan pemulihan dunia usaha, meneruskan reformasi birokrasi guna mewujudkan tata kelola pemerintahan yang baik dan peningkatan pelayanan publik, mempertahankan anggaran operasional, pemeliharaan dan pengadaan alutsista TNI, mempertahankan anggaran pendidikan minimal 20% dari anggaran belanja negara dan meningkatkan kualitas pengelolaan sumber daya alam dan kapasitas penanganan perubahan iklim. Pemerintah juga mengalokasikan Rp37 triliun untuk pemeliharaan kesejahteraan rakyat, serta penataan kelembagaan dan pelaksanaan sistem perlindungan sosial yang diharapkan mampu menurunkan angka kemiskinan menjadi 1213.5%. Sementara, alokasi anggaran yang akan digunakan untuk meningkatkan kualitas sumber daya manusia Indonesia pada 2010 mencapai Rp51,2 triliun. Untuk mendukung prioritas pemantapan reformasi birokrasi dan hukum serta pemantapan demokrasi dan keamanan nasional, pemerintah menganggarkan dana Rp18,1 triliun untuk meningkatkan kinerja birokrasi pemerintahan mendukung terwujudnya tata kelola pemerintahan yang baik dan peningkatan kualitas pelayanan publik. Guna menunjang upaya pemulihan ekonomi yang didukung pembangunan pertanian, infrastruktur dan energi 2010, pemerintah merencanakan alokasi anggaran Rp61,2 triliun. Hasil yang ingin dicapai, tercapainya laju pertumbuhan ekonomi setidaknya 5%, meningkatnya investasi dalam bentuk pembentukan modal tetap bruto 8.5%. Menurunnya tingkat pengangguran terbuka menjadi 8% dari angkatan kerja dan meningkatnya produktifitas

dan akses UKM kepada sumber daya produktif. Guna mendukung peningkatan kualitas pengelolaan sumber daya alam dan kapasitas penanganan perubahan iklim dalam RAPBN 2010, pemerintah mengalokasikan Rp4.3 triliun. Hasil yang diharapkan, meningkatnya kapasitas mitigai dan adaptasi perubahan iklim. Meningkatnya pelaksanaan rehabilitasi dan konservasi sumber daya alam melalui upaya rehabilitasi hutan, penanganan illegal logging, pengelolaan pertambangan secara berkelanjutan dan pengendalian pencemaran lingkungan. Meningkatnya upaya pengelolaan sumber daya kelautan melalui pengendalian illegal fishing dan perbaikan ekosistem wilayah pesisir laut dan pulau kecil. Sementara, Depdiknas 2010 direncanakan memperoleh alokasi Rp51,8 triliun, Dephan Rp40,7 triliun, Departemen PU Rp34.3 triliun, Depag Rp26 triliun, Polri Rp25,8 triliun, Depkes Rp20,8 triliun dan Dephub Rp16 triliun. Alokasi anggaran belanja pegawai direncanakan Rp161,7 triliun atau naik sekira Rp28 triliun (21%) dari perkiraan realisasi 2009. Alokasi antara lain untuk memperbaiki penghasilan aparatur negara dan pensiunan melalui kenaikan gaji pokok dan pensiun pokok ratarata 5%, pemberian gaji dan pensiun bulan ke 13, kenaikan uang makan dan lauk pauk bagi TNI Polri dari Rp35.000/hari menjadi Rp40.000/hari, serta kenaikan uang makan bagi PNS pusat dari Rp15.000/hari kerja menjadi Rp20.000/hari kerja. Pemerintah juga akan membuat desain awal bagi kebijakan jangka menengah meliputi, pengalihan secara bertahap subsidi harga BBM, listrik dan pangan kepada subsidi tepat sasaran. Membatasi pengguna subsidi hanya kepada rumah tangga sasaran, sektor prioritas dan pelayanan umum dengan sistem distribusi tertutup. Perbaikan basis data rumah tangga sasaran khususnya petani, pengrajin dan nelayan sehingga tidak terjadi tumpang tindih penerima subsidi. Untuk memenuhi kebutuhan pembiayaan defisit anggaran, pemerintah mengupayakan pinjaman dengan persyaratan lunak dengan biaya relatif

ringan. Juga mengutamakan penerbitan SBN rupiah di pasar dalam negeri guna pengembangan pasar modal dan membantu pengelolaan likuiditas pasar. Harus transparan SBY mengingatkan anggaran yang semakin besar dialokasikan ke daerah tidak diikuti dengan penyimpangan, mismanagement, apalagi korupsi. SBY meminta aparatur pemerintahan mengelola anggaran itu secara baik dan transparan. “Selain masalah transparansi dan pertanggungjawaban keuangan daerah, saya ingin mengingatkan kepada seluruh jajaran pemerintah di pusat dan daerah untuk sekali lagi tidak melakukan kejahatan korupsi. APBN dan APBD uang rakyat sehingga harus dimanfaatkan untuk kepentingan dan kesejahteraan rakyat,” tegasnya. Besarnya dana APBN yang dialokasikan ke daerah, membuktikan komitmen semua pihak menjalankan desentralisasi dan otonomi secara konsisten dan bertanggungjawab. Karena itu kata SBY, alokasi anggaran harus diikuti fungsi dan tanggungjawab. “Semakin besar tanggungjawab yang diserahkan ke daerah, semakin besar pula alokasi anggaran yang ikut di desentralisasikan.” Ketua DPR Agung Laksono mengatakan, perencanaan anggaran harus mengacu kepada analisa biaya manfaat yang menempatkan peningkatan kesejahteraan rakyat menjadi satu-satunya ukuran bagi keberhasilan proyek pembangunan. “Karena itu dalam pertanggungjawaban anggaran kita tidak semata-mata mempertanyakan dana yang tersedia dan dapat dipertanggungjawabkan, tetapi penting juga mempertanyakan seberapa jauh manfaat yang diperoleh rakyat dari pembangunan progam dan proyek yang telah ditetapkan,” katanya. Selain itu, panitia anggaran bersama pemerintah menyepakati besaran asumsi dasar RAPBN yaitu pertumbuhan ekonomi berkisar 5-6 persen, inflasi 4-6 persen, nilai tukar rupiah terhadap dollar AS Rp9500-10.500, tingkat suku bunga SBI 3 bulan 6-7 persen, harga minyak 50-70 US/Barel dan lifting 0.960 juta barrel/ hari. (aya)

Polri Yakin Berkas Antasari Lengkap JAKARTA (Antara): Kepala Divisi Humas Polri Irjen Pol. Nanan Soekarna mengatakan, penyidik Polri telah yakin bahwa berkas berita acara pemeriksaan (BAP) tersangka kasus pembunuhan yang juga Ketua Komisi PemberantasanKorupsinon-aktif Antasari Azhar telah lengkap. Dia mengatakan itu di Jakarta, Senin (3/8), menanggapi pengembalian berkas tersangka kasus pembunuhan Direktur PT Putra Rajawali Banjaran, Nasrudin Zulkarnain dari Kejaksaan Agung ke Polda Metro Jaya. Pengembalian berkas hingga dua kali dilakukan karena adanya kekurangan yang harus dilengkapi oleh penyidik. “Tugas polisi dalam penyidikan membuat terang perkara dan menemukan tersangka. Kedua hal itu telah dilakukan. Jadi sebenarnya berkasnya su-

dah lengkap,” katanya mengatakan, jika ada hal-hal yang perlu ditambahkan, maka dapat dilakukan di pengadilan, tidak harus dilakukan polisi selaku penyidik. Menurut Nanan, kendati demikian, penyidik tetap akan memenuhi hal-hal yang diminta oleh jaksa penuntut umum. Tetapi dia mengaku tidak tahu secara pasti apa saja yang diminta jaksa penuntut umum hingga berkas Antasari dikembalikan lagi. Nasrudin tewas ditembak usai main golf di Modern Land, Tangerang, Banten, 14 Maret 2009. Dia meninggal dunia di RS Pusat Angkatan Darat Gatot Subroto 15 Maret 2009 karena luka dialami di kepala cukup parah, kendati tim dokter telah berusaha menyelamatkan nyawanya.

Catatan Peristiwa Penting Juli 2009 1Juli : Warga Medan Suspect Flu babi Untuk pertamakali flu babi menyerang kota Medan. Rumah Sakit Umum Pusat H. Adam Malik (RSUP HAM) Medan Rabu (1/7) sore menerima lima orang pasien suspect flu babi atau H1N1. Kelima pasien yang bersaudara tersebut adalah warga Kelurahan Kota Matsum Jl Japaris Medan. Kelimanya adalah WKC, 9, EC, 36, C, 17, CK, 14, dan V, 20 keturunan Tionghoa. Sebelumnya kelimanya berangkat ke Thailand untuk berlibur. Mereka berada di Thailand selama empat hari. Saat transit di Kuala Lumpur, di dalam pesawat mereka, salah satu penumpang positif mengidap H1N1. 1 Juli: Jamaah Haji Indonesia Gunakan Paspor Hijau Calon jamaah haji Indonesia mulai musim haji 1430/2009 harus menggunakan paspor internasional atau yang lazim disebut paspor hijau, sebagaimana telah ditetapkan pemerintah Arab Saudi. Menurut Menteri Agama Muhammad Maftuh Basyuni, penggunaan paspor internasional adalah ketentuan yang dikeluarkan oleh pemerintah Arab Saudi terhadap calon jemaah haji dari berbagai negara di dunia. Selama ini Indonesia mendapat kemudahan menggunakan paspor khusus haji (paspor coklat) yang dinilai lebih praktis. Arab Saudi juga tetap mewajibkan penggunaan vaksin meningitis bagi calon jemaah haji Indonesia. Soal vaksin ini, kata dia, memang ada perbedaan pandangan antara Depkes dan Majelis Ulama Indonesia (MUI). Namun Depag akan tetap melaksanakan ketentuan yang berlaku selama ini, yaitu tetap menggunakan vaksin buatan Belgia. 8 Juli: Hasil Hitung Cepat: SBY-Boediono Satu Putaran Sejumlah lembaga survei yang melakukan hitung cepat atau quick count sesaat setelah dilakukannya penghitungan suara di Tempat Pemungutan Suara (TPS) di seluruh Indonesia, Rabu (8/7), menunjukkan pasangan Susilo Bambang Yudhoyono (SBY)-

Boediono unggul atas pasangan Megawati Soekarnoputri-Prabowo Subianto dan Jusuf Kalla (JK)-Wiranto. Hitung cepat Lembaga Penelitian, Pendidikan dan Penerangan Ekonomi dan Sosial (LP3ES) menempatkan SBY-Boediono unggul dengan 60,28 persen suara, sedangkan pasangan MegawatiPrabowo hanya memperoleh suara 27,40 persen, dan JK-Wiranto dengan 12,32 persen suara. Data LP3ES itu dihasilkan dari penghitungan suara di 1.890 TPS atau sekitar 94,45 persen dari total TPS yang menjadi sampel data LP3ES di seluruh Indonesia. Beberapa lembaga survei lain juga membuat kajian yang hampir sama. 9 Juli: JK Beri Ucapan Selamat Kepada SBY Lewat Telefon Capres Jusuf Kalla (JK) tampaknya sudah legowo alias ikhlas menerima kekalahannya dari Susilo Bambang Yudhoyono (SBY). JK mengucapkan selamat kepada kompetitornya itu melalui telefon. Saat menerima telefon dari JK, SBY kebetulan sedang hendak memberikan keterangan pers kepada wartawan di pendopo kediamannya, Puri Cikeas, Bogor, Kamis (9/7) malam. Pembicaraan dilakukan tanpa loudspeaker sehingga suara JK tidak bisa didengar wartawan. Pembicaraan lewat telefon ini menuai protes dari tim sukses JK-Wiranto karena mereka keberatan dipublikasikan secara live di tv oleh SBY. Walaupun sudah ada pembicaraan lewat telefon namun JK-Wiranto tetap menggugat hasil pilpres. 12 Juli: Indonesia KLB Flu Babi Indonesia dinyatakan kejadian luar biasa (KLB) terhadap flu babi (H1N1). Sementara, 42 Warga Negara Indonesia (WNI) yang terkena flu babi di luar negeri tidak dibenarkan kembali ke tanah air sebelum dinyatakan sembuh total. “Mereka tak boleh kembali sebelum dinyatakan negatif,” kata Menteri Kesehatan Siti Fadillah Supari, Minggu (12/7). Ke-42 WNI yang terkena flu babi itu tersebar di sejumlah negara. 14 Di antaranya merupakan utusan Indonesia yang sedang mengikuti Festival Paduan Suara

Asia, di Provinsi Gyeongnam di Korea Selatan. Ada 366 WNI yang menjadi peserta festival itu. Mereka terbang ke Korsel pada 7 Juli dengan pesawat Korean Airline. Kemudian pada 9-10 Juli, beberapa orang mulai deman dan flu. Setelah dilakukan pemeriksaan pada Sabtu (11/7), 14 orang dinyatakan positif flu babi. 17 Juli: Bom Meledak Di Hotel Milik AS Di Jakarta, 9 Korban Tewas, 52 Luka-luka Dua hotel bintang lima bertaraf internasional milik AS di kawasan Mega Kuningan, Jakarta Selatan, Jumat (17/7) pukul 07:55 dibom oleh pihak tidak bertanggungjawab. Ledakan bom mengakibatkan 9 orang tewas dan 52 orang luka-luka termasuk 16 warga negara asing (WNA). Dua bom yang mengeluarkan suara ledakan dahsyat hingga terdengar sampai radius 2 kilometer

itu semula terjadi di Hotel JW Marriot, dan tiga menit kemudian disusul ledakan bom lebih dahsyat di Hotel Ritz Carlton yang terletak berseberangan dengan Hotel JW Marriot. Selain dua bom meledak, satu bom yang masih aktif ditemukan di lantai 18 Hotel JW Marriot, namun berhasil dijinakan tim Gegana Mabes Polri bersama Tim Polda Metro Jaya. Satu bom aktif itu ditemukan dalam sebuah tas jinjing oleh pelaku yang diduga menginap di lantai 18 Hotel JW Marriot. Kapolda Metro Jaya, Irjen Pol.Wahyono menyatakan, pihaknya mengetahui identitas pelaku, ditenggarai salah satu penghuni kamar di Hotel JW Marriott. Beberapa hari setelah pengeboman, lewat internet muncul pengakuan seseorang mengatasnamakan Nur Din M Top yang menyatakan bertang-gungjawab dengan peristiwa tersebut. 22 Juli: Gerhana Matahari Tidak Terlihat, Di India Dan China Total


Restoran di Ritz Carlton Hotel berantakan dihantam bom.

Warga Sumatera Utara gagal melihat gerhana matahari total yang terjadi Rabu (22/7) pagi. Sebelumnya gerhana diperkirakan terjadi mulai pukul 06:58 dan diperkirakan berakhir pukul 12:12. Rifwar Koto, SSI, Kepala Stasiun Geofisika pada BMKG Wilayah I Tuntungan mengatakan, tidak terlihatnya gerhana karena posisi letak bumi, bulan dan matahari tidak pada garis lurus pada daerah pengamatan. Di kawasan MedanTuntungan tempat dia mengamati, hanya bisa dilihat pada fase menjelang total itupun terlihat hanya sedikit di kwadran ke-3. Sementara gerhana matahari bisa dilihat di Banda Aceh mulai pukul 07:15 dan puncaknya pada 07:59, berakhir pada 08:49. Tapi sayang, sekumpulan awan ikut menghalang. Peristiwa langka itu hanya bisa dilihat dengan alat bantu, salah satunya filter polaris. Sedangkan di India dan China gerhana matahari berlangsung total.


WASPADA Selasa, 4 Agustus 2009

5 Soccer Games Veteran

Motivasi Atlet Masih Minim

Waspada/Yuslan Kisra

Mardi Lestari ketika di-wawancarai di Stadion Madya Senayan Jakarta

JAKARTA (Waspada): Mantan sprinter nasional, Mardi Lestari mengakui minimnya motivasi dari para atlet untuk meningkatkan prestasi. Dia juga menyesalkan rekor nomor bergengsi 100 meter yang sudah 20 tahun dipegang belum terpecahkan. “Sedih juga rasanya rekor saya belum pecah. Ini artinya, atletik kita memang mengalami kemunduran,” sebut Mardi kepada Waspada baru-baru ini di Stadion Madya Senayan Jakarta. Ditambahkannya, penyebab terjadinya kemunduran itu karena minimnya motivasi dari para atlet untuk meningkatkan prestasi. Padahal, benefit yang mereka dapatkan jauh lebih besar dari saat dirinya masih menjadi atlet. “Bisa jadi, faktor finansial ini yang membuat para atlet justru cepat puas dengan apa yang telah mereka dapatkan. Akibatnya, prestasi yang diharapkan sulit terwujud,” tambah mantan pelari kelahiran Binjai, 19 Januari 1967 ini. Mengenal nomor lari sejak masih duduk di bangku SD, Mardi kecil kala itu mengaku masih ikut-ikutan, karena secara kebetulan, M Naruli sang guru olahraga adalah paman sendiri. “Tak ada fasilitas berlatih seperti yang dijalani para atlet sekarang. Kami hanya berlatih dengan memanfaatkan fasilitas seadanya. Hanya saja, tekad saya kala itu cukup kuat. Yakni, saya sangat kepingin bisa naik pesawat secara gratis,” kenang Mardi. Tak heran, setamat SMA, Mardi junior langsung menetapkan untuk fokus di nomor 100 meter. Alasannya, nomor ini tidak begitu sulit dibandingkan nomor lain. Lebih dari itu, cabang

lari ini tidak perlu mengeluarkan biaya. “Karena saya berasal dari keluarga tidak mampu, cabang lari menjadi pilihan tepat. Sebab, saya tidak perlu mengeluarkan biaya untuk perlengkapan. Bahkan tanpa alas kaki pun jadi,” ujarnya sembari tersenyum. Layaknya seorang altlet, suka duka pun pernah ia rasakan, seperti mendapat sanjungan saat juara dan dicerca saat gagal. Tapi hal itu diakuinya justru menjadi penambah motivasi untuk terus maju. Ia pun kini bisa menuai kegigihan itu. Terlebih setelah mendapatkan pekerjaan di PT Bank Sumut. Meski demikian, suami dari Kety Retnawati yang telah memberinya tiga anak ini mengaku sulit melupakan atletik. Urusan sekolah yang sempat terhenti saat menjadi atlet pun kembali dijalaninya, yakni dengan kuliah di salah satu perguruan tinggi di Kota Medan. “Sulit memadukan prestasi di atletik dan sekolah. Karena itu saya pun memutuskan fokus di atletik dan mengabaikan sekolah. Tapi, sekarang saya sudah mulai kuliah di Medan. Bagaimana pun, pendidikan tetap penting,” tandasnya. (m20/yuslan) Data Singkat Nama : Mardi Lestari TTL : Binjai, 19 Januari 1976 Istri : Kety Retnawati Anak : Sindhi Retna Lestari, Renaldi Saputra Lestari, Ramdandi Lestari

Gumarang FC Incar Semifinal MEDAN (Waspada): Gumarang FC Medan menyatakan siap bersaing di Soccer Games Veteran sekaligus meraih prestasi maksimal pada event yang diadakan Klub Medan City itu, di Stadion Teladan Medan, 1416 Agustus mendatang. “Persaingan pada turnamen kali ini bakal ketat, jika melihat tim-tim yang akan tampil. Namun begitu, kita tetap optimis memasang target tampil di semifinal dan berharap dapat meraih gelar juara,” ujar Manajer Tim Gumarang FC, Hengki Ahmad, Senin (3/8). Menurutnya, target semifinal bukan tanpa alasan, mengingat tim asuhannya telah mempersiapkan diri secara matang, dengan menggelar latihan secara rutin di lapangan Medan Estate. Ketua Panitia Soccer Game Veteran, Helmy Yusuf didam-

pingi Sekretaris Marzuki Harahap mengatakan, hingga Senin (3/8) sudah 19 tim memastikan diri bersaing pada turnamen memperebutkan piala Prof Djohar Arifin Husein dan H Sumandraji itu. Ke 19 tim itu, yakni Kurnia FC, Gumarang FC, Kenari Utama, Persib Kaba, Pemko Medan, BTN, PLN, Bank Sumut, Garuda Plaza, Sinar Sakti, Patriot, Bintang Timur, Diknas, Pemprovsu, MPT, Albertos, Pratama FC, Kaveleri dan tuan rumah Medan City. “Event ini rencananya akan dibuka Mennegpora Adhyaksa Dault yang sekaligus akan tampil dengan tim Kementerian Negara Pemuda dan Olahraga. Selain itu, event ini juga diikuti tim asal Malaysia yang diwakili Penang Kickers,” jelas Yusuf. (m42)

Krisna Bayu Sumbang Emas Pertama Asian Martial Arts Games I BANGKOK (Waspada): Lagu Indonesia Raya akhirnya berkumandang di arena Asian Martial Arts Games I di Bangkok, ketika judoka senior Kresna Bayu menyumbangkan medali emas pertama bagi kontingen Merah Putih, Senin (3/8). Di final, Kresna Bayu berhasil mengatasi perlawanan Judoka India Anil Kumar melalui golden score. Pertarungan di kelas 100 kiligram itu terpaksa diperpanjang tiga menit setelah kedua pejudo berbagi angka 0-0 pada waktu normal lima menit. Usai pertarungan, judoka andalan Indonesia kelahiran 1974 itu mengungkapkan, emas yang diraihnya adalah yang pertama di tingkat Asia. ”Lawan saya jauh lebih berat. Saya ha-

nya berusaha bergerak terus dan tidak menyerah,” ungkapnya seusai laga. Bayu menambahkan emas diperoleh setelah naik kelas dari 90 kg, namun perjuangan Bayu tidak mudah. ”Wah, rasanya luar biasa. Saya tidak pernah membayangkan sebelumnya. Tangan dan otot saya sempat tidak berfungsi. Hampir seluruh bagian anggota badan saya kena. Tapi, coba saya paksakan. Ya, tua-tua keladi,” terangnya.

Pelatih Judo Perry Pantouw mengatakan, medali emas dari cabang judo telah melampaui target yang ditetapkan PJSI. Pasalnya, sejak awal PJSI hanya mencanangkan target medali di Asian Martial Arts. ”Kami tidak berani mulukmuluk. Medali pasti, tapi emas atau bukan tidak berani memastikan. Bayu baru mencoba di kelas 100 kg. Apa yang kami lakukan tidak sia-sia. Meraih emas sudah melebihi target. Kami optimistis bisa mempertahankan performa di SEA Games. Menu latihan tetap,” tegas Pantouw yang juga peraih emas SEA Games lima kali berturut-turut. Sukses Bayu tidak diikuti Indah Setiawati di kelas 70 kg.

Indah gagal meraih medali perunggu setelah takluk dari atlet Filipina Karen A Solomon dengan teknik bantingan ippon seoi nage. Nasib serupa juga dialami atlettaekwondo.Turunpadakelas middle dan fly putri, mereka gagal menambah medali. Namun, potensi raihan tambahan emas diberikan pencak silat melalui Ni Nyoman Supartini yang lolos ke semifinal, setelah menang telak 5-0 atas atlet tuan rumah Bansalab Mon Rutai. ”Saya yakin Supartini bias rebut emas dan dia adalah yang terbaik di kelas D. Mudah-mudahan dia tidak cedera atau terkena diskualifikasi,” tandas Manajer Pencak Silat, Ahmad Tafsil. (yuslan)

Kasus Mosi Tak Percaya Dan Mandat Muscablub ‘Ilegal’

KONI Asahan Berpedoman Legalitas

“Kepada para pemenang kami berharap agar bisa mempersiapkan diri sebaik mungkin baik fisik maupun mental sebelum menghadapi tahapan puncak seleksi Marlboro Red Racing Experience di Sentul,” tambahnya. (rel/m09)

Laili Singkirkan Petenis Thailand SOLO (Waspada): Petenis Indonesia Laili Rahmawati Ulfa menyingkirkan petenis Thailand Siriporn Phakamad pada babak kualifikasi turnamen tenis in-

ternasional SoloWomen Cirkuit (SWC) 2009 di Lapangan Tenis Manahan, Kota Solo, Jawa Tengah, Senin (3/8). Bertarung di lapangan IV

Angka Tunggal Bersilang (Sudoku) Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: agak sulit (****). Jawaban di kolom 8.

1 9 8

8 7


7 8 2 9 1 3 9


6 5

1 6 5

8 4 3 4



9 6

Petenis Thailand Natchanok Saenyaukot mengembalikan bola ke arah lawannya petenis India Yamini Reddy dalam Turnamen Tenis Internasional Solo Women Circuit di Lapangan Tenis Manahan, Solo, Senin (3/8). Saenyaukot melaju ke babak selanjutnya setelah menang dengan skor 6-2, 6-2.

4 3 7

arena olahraga tersebut, Laili menang telak dua set langsung, 6-1 dan 6-0. Meski sedang kurang sehat, dia tidak mengalami kesulitan berarti untuk mengatasi tamunya. Laili mengaku, sudah mengerti karakter permainan petenis Thailand yang menjadi lawannya. “Beberapa minggu lalu saya sudah bertanding dengan Siriporn pada sebuah turnamen tenis internasional di Bandung dan saya mengalahkan dia,” katanya. Pada pertandingan lainnya di hari kedua babak kualifikasi SWC 2009, dua petenis Indonesia Anggrenny Oky Suconong dan Monica Putri Kusumawardhana, menyerah dari petenis China dan Korea Selatan. Anggrenny dikalahkanYang Pang dalam dua set langsung, 0-6 dan 2-6, sedangkan Monica Putri menyerah lawan petenis Korsel You Jin Kang juga dua

set langsung, 2-6 dan 0-6. Anggrenny dan Monica sebenarnya dapat memberikan perlawanan sengit, namun kesalahankesalahan penempatan bola menjadi penyebab utama kekalahan mereka. Di lapangan IV, petenis Thailand Natchanok Saenyaukhot mengalahkan petenis India Yamini Reddy 6-2 dan 6-2. Empat petenis yang menang dalam babak kualifikasi hari kedua penyelenggaraan SWC 2009 akan melaju ke babak utama nomor tunggal putri. Masih di babak kualifikasi, Meutia Sabrina yang bertanding di lapangan satu mengalami kekalahan dari petenis Jepang Tomoko Taira 6-2 dan 6-1. Pada hari pertama kualifikasi, empat petenis sudah memastikan lolos, yakni Tomoko Taira dari Jepang, Ya Zhou dari China, serta Reyka Woro dan Bella Destriana dari Indonesia. (h01/ant)

baik yang mungkin disebabkan karena minimnya dana dan manajemen yang kurang baik. Hadir dalam acara tersebut Sekda Kota Medan Zulmi Eldin, Mantan PJ Walikota Medan Drs H Afifuddin Lubis MSi, Ketua Umum KONI Sumut H Gus Irawan Pasaribu SE Ak MM, Kadispora Medan Drs Darussalam Pohan MAP dan para camat se kota Medan. Kota Olahraga Ketua Umum KONI Sumut Drs Zulhifzi Lubis menegaskan, pentingnya sinergi antara koordinator KONI dengan camat setempat. Hal ini sejalan dengan visi KONI Medan untuk menjadikan kota ini sebagai Kota Olahraga pada 2010. “Untuk itu, diperlukan kontribusi dari seluruh lapisan masyarakat terutama camat untuk mensup-

port program tersebut,” tegasnya. Program itu perlu digalakkan, agar prestasi olahraga Kota Medan bisa ditingkatkan. Soalnya, pada Porda tiga tahun silam, Medan sudah hampir dikalahkan Deliserdang dalam perolehan medali. “Cuma beda satu emas. Karena itu kita harus saling bahu membahu untuk meningkatkan prestasi,” jelas sosok yang akrab disapa Opunk itu. Sedangkan Ketua Umum KONI Sumut Gus Irawan menyatakan, baru ada tiga KONI kabupaten/kota yang membentuk KONI Kecamatan. “Sebelumnya sudah ada Pematangsiantar, Asahan dan terakhir Medan. Ini hal yang baik dalam rangka meningkatkan kerjasama dalam mengangkat prestasi olahraga,” puji Gus. (h09)

One Barbell Club P. Brandan Bawa Gelar Dari Asahan P. BRANDAN (Waspada): One Barbell Club P. Berandan membawa gelar juara kedua kelas 70kg melalui Nizwar Ali di Kejuaraan Binaraga Terbuka Kisaran memperebutkan Piala Bupati Asahan, Minggu (2/8). Dalam kejuaraan itu, One Barbell Club yang bernaung di Tangkahan Lagan P. Brandan menurunkan Nizwan Ali di kelas 70 kg dan Miswansyah di kelas 65 kg. Pimpinan One Barbell Club, Irwan Tobing didampingi Syamsul Rizal, Senin (3/8) mengatakan, bangga karena pertama kali ikut kejuaraan sudah men-

dapat gelar apalagi klub yang didirikanya masih terbilang baru. “Kami bangga karena baru pertama kali ikut kejuaraan sudah mendapat gelar, apalagi kami hanya menurunkan dua atlet saja,” ungkap keduanya. Irwan menambahkan, tujuan mendirikan One Barbell Club untuk mendorong minat para remaja dalam cabang tersebut yang juga sangat langka keberadaannya di P Berandan. Selain itu, lanjutnya, olahraga ini menambah aktivitas remaja yang bernaung di dalamnya agar terhindar dari kegiatan negatif. “Dengan adanya One Barbell Club ini, para remaja dapat menyalurkan bakatnya serta melupakan segala prilaku negatif seperti keterlibatan narkoba, tawuran dan lainnya,” harapnya. (c02)

2 5 8 4 3 6 7 9 1

simulator F1 adalah bagian dari pengujian keterampilan mereka dalam mengenal atmosfer dunia F1, di mana lima pemenang tersebut diambil dari raihan waktu tercepat yang dibukukan,” jelas Risa di Medan, Senin (3/8).

Pekan Olahraga Kota (Porkot) Medan yang akan digelar 11 hingga 18 Agustus. “Kita harus menunjukkan komitmen walaupun dengan segala keterbatasan,” ujar Rahudman yang sangat antusias mengikuti acara tersebut. Medan, diakuinya telah memberi kontribusi besar dalam mencetak atlet-atlet berprestasi nasional maupun internasional, tapi prestasi masih belum optimal. Rahudman menilai, masalah sebenarnya terletak pada formulasi pembinaan yang masih belum tertata

3 4 7 1 8 9 5 6 2

8). Selanjutnya, para finalis akan bergabung dengan 46 peserta lainnya dari Pekanbaru, Jakarta, Palembang, Bandung, Yogya, Semarang, Makassar, Balikpapan, Surabaya dan Denpasar. Mereka nantinya akan mengikuti Marlboro Red Racing Experience di Sirkuit Sentul, 23 Oktober mendatang, dengan menggunakan delapan mobil yang didatangkan langsung dari Italia berupa Fiat Panda 4x4, Alfa Romeo 147 GTA, Fiat 500 dan Alfa Romeo GTVR. Marketing Manager Marlboro, Veronica Risariyana menyatakan, selamat kepada empat finalis asal Medan.”Kompetisi

MEDAN (Waspada): Sebanyak 190 Koordinator KONI Kecamatan se Kota Medan dikukuhkan di Asrama Haji Pangkalan Masyhur Medan, Senin (3/8). Mereka diharapkan bisa memacu peningkatan prestasi sekaligus menggairahkan semangat berolahraga di Kota Medan. Penjabat Walikota Medan Rahudman Harahap SH MM, meminta para Camat membantu koordinator KONI Kecamatan yang sudah terbentuk. Hal itu ditandai dengan atensi mereka terhadap pelaksanaan

1 9 6 5 7 2 4 3 8

MEDAN (Waspada): Setelah berjibaku menaklukan sirkuit jalanan Marina Bay Singapura di ajang Marlboro Red Racing Nights pada kompetisi simulator F1 sebagai tahap seleksi final regional, akhirnya terpilih empat pencetak waktu terbaik dari Medan. Keempatnya adalah Irvan Muda dengan waktu tercepat 1:44:450 detik, Tommy dengan waktu 1:44:870, Hardiman dengan waktu 1:46:161 detik dan Armika H dengan catatan waktu 1:48:013 detik. Irvan cs berhasil menyingkirkan 16 semifinalis lainnya di Retrospective Medan, Sabtu (1/

2010, Medan Kota Olahraga

6 3 5 9 1 7 8 2 4

Empat Finalis Medan Menuju Italia

Kukuhkan 190 Koordinator KONI Kecamatan

8 1 4 2 6 5 9 7 3

Marlboro Red Racing School


Ketua Umum KONI Medan Drs. H. Zulhifzi Lubis (kiri) menyerahkan pataka pertanda pengukuhan koordinator KONI Kecamatan se Kota Medan, Senin (3/8).

7 2 9 8 4 3 1 5 6

Musawarah kecamatan luarbiasa,,” tandasnya. Secara terpisah, pimpinan PS Pratama Jamal Abdul Nasir Siregar menganulir keikutsertaan PS Pratama dalam mosi tak percaya terhadap kepemimpinan Erwis dalam Pengcab PSSI Asahan. Pengcab PSSI Asahan, Selasa (4/8) ini, melaksanakan rapat dengan klub anggota resmi membahas persiapan Kompetisi Antar Klub PSSI Asahan tahun 2009 dan Porkab Asahan. (a36)

4 7 2 6 5 1 3 8 9

Pengkab Pertina Asahan terhadap satu sasana. “KONI tidak bisa mencampurinya, tapi kita klarifikasi ke pengurus cabang dan pengurus propinsi cabang olahrga dimaksud,” ujar Ketua Bidang Prestasi KONI Asahan Zaharuddin Ginting menambahkan pihaknya tetap menganggap dan mengakui kepengurusan yang sah. “Lucu ada Muscablub, yang saya tahu ada Munaslub. Kalau ada Muscablub nanti ada pula

9 8 3 7 2 4 6 1 5

“Kita tunggu keputusan PSSI Pusat, masalahnya khas menyangkut statuta PSSI Provinsi dengan adanya larangan muscab dari PSSI Pusat,” ungkap Ketua Bidang Organisasi KONI Asahan, Nurkarim Nehe. Rapat harian KONI Asahan dipimpin Ketua Umum H Zaharuddin Panjaitan didampingi Sekum Esmar Siagian dengan agenda pokok persiapan Porkab Asahan 2009 dan Porwilsu 2010, jugamembahasmasalahskorsing

5 6 1 3 9 8 2 4 7

KISARAN (Waspada): KONI Asahan tetap berpedoman kepada azas legalitas dalam setiap permasalahan pengurus cabang olahraga seperti yang terjadi di Pengcab PSSI Asahan. Demikian hasil rapat pengurus harian KONI Asahan, Senin (3/8), menyikapi kasus mosi tak percaya dan mandat Muscablub ‘ilegal’ yang bermaksud menjatuhkan Ketua Umum Pengcab PSSI Asahan Erwis Pauja Lubis.


6 Terry Bantah Tekan Bosnya


John Terry janji tidak akan menggunakan pengaruhnya.

Lescott Not For Sale MANAJER Everton David Moyes menegaskan, bek andalannya Joleon Lescott berstatus not for sale alias tidak untuk dijual dengan harga berapa pun. Moyes lantas mengecam Manchester City yang terus mencoba menggaet bek sentral The Toffees tersebut. “Mereka (City) tidak menunjukkan respek. Saya juga akan meniru tindakan pelatih Mark Hughes untuk merekrut pemain terbaik jika punya uang. Namun gaya saya akan beda dan seharusnya Reuters sesuai cara yang biasa dilakukan,” sesal Moyes, sebagaimana diberitakan AFP, Senin (3/8). Moyes sudah dua kali menolak pinangan The Citizens untuk Lescott dengan kisaran fulus 15 juta pound dan 18 juta pound. Padahal menurut pelatih asal Skotlandia itu, Lescott bahkan tidak akan dilepas Everton walaupun dengan bandrol 30 juta pound.

Spurs Beralih Van Bommel PELATIH Tottenham Hotspur Harry Redknapp beralih membidik kapten Bayern Munich Mark van Bommel, menyusul kegagalan Spurs menggaet mantan kapten Arsenal Patrick Vieira yang kini membela Juventus. Menurut News of theWorld, Senin (3/8), Redknapp kabarnya siap mengucurkan dana 5 juta pound untuk DPA merekrut gelandang Belanda berusia 32 tahun itu. Redknapp perlu pengalaman van Bommel yang sudah 47 kali membela Belanda dan sekarang menjadi kapten De Orange. Tapi karena Louis van Gaal yang baru diangkat menjadi pelatih FC Hollywood sangat membutuhkan van Bommel, maka Spurs dipastikan akan mengalami kesulitan untuk memindahkan mantan pemain PSV dan Barcelona itu dari Allianz Arena ke White Hart Lane.

LONDON (Antara/AFP): Kapten Chelsea John Terry janji, tidak akan menggunakan pengaruhnya di Stamford Bridge untuk menekan pelatih baru Carlo Ancelotti agar diberi nilai kontrak yang tinggi. “Saya ingin menegaskan bahwa saya seorang pemain. Tugas pelatih dan manajemen untuk mengambil keputusan,” tutur Terry seperti dikutip Daily Mirror, Senin (3/8). Berbagai laporan media baru-baru ini mengatakan,Terry telah meminta jaminan bahwa Chelsea tetap berkomitmen untuk memfasilitasi pemain karismatik itu sebelum memutuskan untuk menolak tawaran Manchester City bulan lalu. Bek sekaligus kapten tim nasional Inggris itu sebelumnya dibujuk agar tetap bertahan setelah melakukan pembicaraan dengan pemilik klub Roman Abramovic. Tapi Terry segera membantah anggapan, dia berusaha menekan bosnya Abramovich dan Ancelotti agar merekrut pemain hebat model gelandang AC Milan Andrea Pirlo. “Satu-satunya hal yang saya bicarakan mengenai klub adalah pemain penting seperti Didier Drogba dan Ashley Cole yang kontrak mereka berakhir, agar tetap bersama kami,” tegasnya. “Bagi saya yang penting adalah membangun tim yang ada, sehingga mereka diharapkan tetap bertahan. Tapi banyak yang beranggapan, saya meminta agar Andrea Pirlo direkrut dan meminta pemain ini atau pemain itu agar direkrut. “Saya berani berjanji bahwa saya tidak pernah terlibat dalam masalah rekrutmen pemain. Apa yang seratus persen saya ketahui adalah saya seorang pemain dan saya ingin konsentrasi sebagai pemain. Jadi saya serahkan keputusan kepada pelatih dan manajemean soal merekrut pemain,” tambah Terry.

LONDON (Waspada): Striker Fernando Torres melewati kapten Steven Gerrard dalam hal penjualan replika kostum mereka di Liverpool yang diborong oleh fans internasional. Menurut direktur komersial Liverpool, Ian Ayre, kostum replika Torres bernomor punggung 9 kini menjadi yang terlaris setelah replika Gerrard. “Semua pemain sangat penting, tapi inilah bukti pasti bahwa ada pula betapa krusialnya satu pemain tertentu,” ujar Ayre. “Fernando adalah ikon global dan seorang pesepakbola hebat. Dia sukses di lapangan dan komersial, daya tariknya sangat besar,” puji Ayre dalam Sportinglife, Senin (3/8). Penyerang Spanyol itu diboyong The Reds dari Atletico Madrid pada 2007. Torres langsung mencetak 24 gol pada musim pertamanya di Liga Premier dan merosot 14 gol musim lalu karena dia lebih sering didera cedera. Bersama Gerrard, Torres menjadi salah satu sosok paling berpengaruh di Anfield yang sayangnya kerap merugikan tim ketika mereka absen bermain. “Kostum Fernando mencatat penjualan tertinggi dan melebihi penjualan Gerrard. Perbedaan keduanya tak terlalu besar, tapi Fernando sudah mengambil-alih porsi terbesar,” tambah Ayre. Melalui Torres-Gerrard pula, The Pool berharap dapat menuntaskan dahaga 19 tahun tak pernah lagi merasakan kebahagiaan meraih gelar Liga Premier. The Reds terakhir kali menjadi jawara Inggris pada musim 1989-90 dengan mengungguli Aston Villa dan Tottenham Hotspur.

Van Der Vaart Tekad Cabut MANTAN kapten Ajax Amsterdam dan Hamburg Rafael van der Vaart, bertekad segera cabut dari Real Madrid, karena dirinya tidak masuk lagi dalam rencana pelatih Manuel Pellegrini. “Pelatih (Pellegrini) telah mengatakan, musim depan saya tidak akan tampil lagi, sehingga tentu bukan pilihan baik bagi saya untuk terus bertahan. Real menginginkan nilai transfer untuk saya,” AFP ujar gelandang Belanda itu, seperti dilansir Sky Sports, Senin (3/8). “Saya dapat memahami klub ini ingin lebih dulu mempelajari segala bentuk penawaran. Sekarang yang terpenting adalah saya ingin bermain di klub baru,” tegas Van der Vaart, seraya menambahkan dirinya tak keberatan jika mesti kembali ke Hamburg.

Pindah Inisiatif Heinze BEK Argentina Gabriel Heinze mengungkapkan, perpindahannya dari Real Madrid ke Olympique Marseille merupakan inisiatifnya sendiri. “Keputusannya murni dari saya sendiri. Saya sudah memiliki pengalaman luar biasa bersama Real Madrid, namun inilah sepakbola,” tutur Heinze dalam Sky Sports, Senin (3/8). Alasan utama kepindahannya, menurut Heinze, karena pelatih Manuel AFP Pellegrini tidak bisa menjamin tempatnya secara reguler. “Sama sekali tak masalah. “Terkadang keinginan untuk gabung klub lain juga sangat besar dan saya senang dapat berada di sini dan saya akan bermain dengan sepenuh hati,” ujarnya lagi. Mantan pemain Paris Saint Germain dan Manchester United itu juga bertekad; “Mulai saat ini saya harus terbiasa dengan sikap dan dukungan suporter Marseille “Saya yakin para pendukung PSG dapat memahami situasinya.” (jonny/dari berbagai sumber)

Harapan terbuka Musim depan, harapan pasukan Rafael Benitez menjadi juara terbuka lebar. Dengan semua syarat yang telah terpenuhi, penentuan tinggal pada faktor kebugaran Torres dan Gerrard saja. Kedua pilar serangan Reds itu gantian cedera musim lalu, sehingga Si Merah yang sempat lama memimpin klasemen gagal mempertahankan posisinya hingga digeser Manchester United dan Chelsea. “Tidak ada tim lain di Inggris yang memiliki hubungan seperti Gerrard dan Torres. Tak ada yang lebih baik dari duo Liverpool di dunia ini, mereka mampu membuat pertahanan lawan menangis,” ucap bek Jamie Carragher seperti dilansir Reuters. Jika Gerrard dan Torres benar-benar fit sepanjang musim, Carragher sangat optimis Red akan mengambil mahkota Red Devils. “Bila Anda memiliki kemampuan yang baik dalam tim, tentu memberikan kepercayaan luar biasa. Sangat senang melihat mereka (GerrardTorres) menandatangani kon-trak baru, mereka yang paling penting dalam tim kami,” tegas Carragher. “Seandainya mereka fit dan terus meningkatkan kualitas fisik, maka saya pikir kami akan sangat dekat dengan gelar juara. Kami semua berharap musim depan akan menjadi tahun kami, tapi kami tetap mesti meningkatkan penam-

pilan musim lalu yang sudah baik,” katan y a menambahkan. “Kami sedang mencoba memberikan para pemain lebih banyak waktu. Mungkin satu jam hingga 75 menit, bagi beberapa dari mereka coba bermain,” timpal manajer Rafael Benitez. “Namun hal itu tergantung pada masing-masing pemain. Kami memiliki cukup pemain dan ingin memberikan mereka semua kesempatan. Tapi sebagian besar dari mereka akan bermain 60 menit atau lebih sedikit,” tambah gaffer asal Spanyol tersebut. Tapi jelang kickoff Liga Pre-


Penyerang Liverpool Fernando Torres (atas) sekarang lebih laris dibanding kapten Steven Gerrard (bawah).

mier, Merseyside Merah malah dibantai Espanyol 3-0 dalam laga eksibisi di Barcelona, Minggu (Senin WIB). Setelah melawan Espanyol, pasukan Benitez akan menjajal FC Lyn Oslo (Norwegia) dan Atletico Madrid (Spanyol) di Anfield. (h01/sl/rtr/goal)

Piala Emirates Bukan Jaminan Wilshere

KORAN olahraga Italia Il Corriere dello Sport, Senin (3/8) melansir, AS Roma telah merampungkan nego-siasi kepindahan bek Fenerbache Diego Lugano yang menyandang status bebas transfer. Kontrak bek veteran Uruguay itu selesai musim ini dan tidak diperpanjang lagi. Lugano diikat Il Lupo dengan tawaran gaji sebesar 2,5 juta euro per musim di AP Olimpico Roma. Lugano merupakan alternatif setimpal setelah I Giallorossi gagal memboyong bek Inter Milan Nicola Burdisso.

KLUB promosi Liga Seri A yang sedang membenahi pasukannya, mengidamkan striker Udinese Antonio Di Natale berada di garis serangnya. Direktur Umum Parma Pietro Leonardi dalam Football Italia, Senin (3/ 8) bahkan mengakui, bomber veteran berusia 31 tahun itu merupakan pemain paling pas untuk memimpin barisan penyerang I Gialloblu. “Dia pemain yang sangat kami dambakan. Sejauh AP ini kami baru menyampaikan ketertarikan kepadanya secara resmi,” beber Leonardi. Kedatangan Di Natale malah akan sangat vital guna menggantikan posisi striker gaek Christiano Lucarelli yang telah mandah. Di Natale diharapkan dapat menuntun bomber muda Italia Alberto Paloschi.

Selasa 4 Agustus 2009

Torres Lewati Gerrard

Lugano Rampung Roma

Di Natale Dambaan Parma


LONDON (Waspada): Manajer Arsenal Arsene Wenger tak bisa menjamin bomber belia Jack Wilshere akan mendapat kesempatan bermain lebih banyak pasca tampil bagus saat menjuarai Piala Emirates. Penyerang berusia 17 tahun itu menyumbang dua gol saat Arsenal mengatasi Glasgow Rangers 3-0 pada partai akhir turnamen di markas The Gunners itu, Minggu malam. “Saya tak tahu apakah dia akan main banyak pada laga musim ini. Sangat sulit diprediksi,” ucap Wenger dalam AFP, Senin (3/8). “Inggris punya masalah ketidak-sabaran begitu ada pemain yang baru menanjak. Mereka tak sabar menanti kemajuannya. Jadi, mari kita tenang dan sabar. “Masih ada waktu setahun menuju Piala Dunia dan kita lihat saja apakah dia bisa menempa diri dan menjaga konsistensi. Jangan menganggap seseorang bintang hanya dari dua laga. Anda harus menghargai pengembangan pemain,” tambah pelatih asal Prancis itu. Munculnya Wilshere memang memicu harapan dari publik Inggris. Apalagi dia tampil di depan pelatih Inggris Fabio Capello, yang hadir di Stadion Emirates, London. Tapi Wenger tak mau larut dalam euforia, dus tetap fokus mencari pemain baru untuk


Jack Wilshere leluasa menguasai bola dalam laga Arsenal kontra Rangers.


Villa Kampiun Tekuk Juve

Bremen, Bayern Mulus Melaju BERLIN (Waspada): Klubklub papan atas divisi satu Bundesliga model Werder Bremen, Bayern Munich dan Hoffenheim, mulus melaju ke babak kedua Piala DFB Pokal, Minggu (Senin WIB). Dua gol torehan rekrutan anyar Marcelo Moreno Martins membuat Bremen memetik kemenangan telak 5-0 atas tim divisi dua Union Berlin di Stadion Alte Försterei. Bremen selaku juara bertahan Piala DFB Pokal, benarbenar belum menemui kendala besar dalam menghadapi Union. Penyerang Boubacar Sanogo dan Marcelo Moreno Martins silih-berganti membobol gawang Union. Aksi bek asal Brazil Naldo melengkapi pesta gol kemenangan Bremen di babak pertama turnamen tersebut. Bomber baru Bayern Munich Mario Gomez yang tampil apik di ajang Audi Cup beberapa waktu lalu, kembali menunjukkan ketajamannya saat menceploskan dua gol bagi FC Hollywood untuk melumat tim amatir SpVgg Neckarelz 3-1. Gol tambahan FC Hollywood dihasilkan Hamit Altintop, sedangkan Throm menciptakan gol hiburan bagi tim tuan rumah. Bagi Bayern, ini kemenangan pertama kalinya bagi pelatih baru Louis van Gaal di ajang resmi setelah sebelumnya mereka juga memastikan gelar juara di pentas Audi Cup. Kontestan dari divisi Bundesliga lainnya, Hoffenheim, juga memetik kemenangan 50 atas tim divisi empat Oberneuland berkat gol Chinedu Obasi dan pemain anyar Mai-

menggantikan striker Emmanuel Adebayor dan bek Kolo Toure yang telah pindah ke Manchester City. “Saya sekarang sedang memikirkan skuad keseluruhan. Dua tahun lalu, saya tak tahu apakah Eduardo atau Tomas Rosicky akan kembali bermain. Mereka berdua kelihatan sudah siap kembali, jadi skuad kami sudah cukup besar,” beber Wenger. Wilshere membuka keunggulan London Reds setelah bekerjasama apik dengan Andrei Arshavin. Dia membuat gol indah dengan mengarahkan bola ke sudut kanan gawang Rangers. Sembilan menit kemudian, Gunners menambah pundi golnya melalui tendangan melengkung Eduardo da Silva, memanfaatkan kejelian Fran Merida dalam memberikan umpan terobosan. Rangers selalu kesulitan menerobos benteng Arsenal yang digalang bek veteran William Gallas. Sebaliknya kehadiran Wilshere benar-benar merepotkan pemain bertahan Rangers. Aksi individunya sempat mengundang decak kagum penonton saat beberapa kali melewati pemain lawan sambil melambungkan bola. Menit 71 sontekan Wilshere yang sangat kencang memantapkan keunggulan laskar Wenger.


Hamit Altintop memantapkan kemenangan FC Hollywood.

cosuel. Striker Vedad Ibisevic yang musim lalu menjadi pencetak gol tersubur Hoffenheim, sudah kembali merumput namun gagal menciptakan satu gol pun. Sedangkan Hannover 96 harus mengakui ketangguhan tim divisi empat Eintracht Tier yang memetik kemenangan telak 3-1. Dengan demikian Hannover menjadi tim kedua Bundesliga yang harus tersingkir di babak awal setelah FSV Mainz yang takluk 2-1 dari tim divisi empat Luebeck pada Jumat. Hasil lainnya, Sportfreunde Lotte kalah 0-1 di kandang sendiri saat menjamu Vfl Bochum. Kickers Offenbach juga menyerah 0-3 melawan tamunya Eintracht Frankfurt. (h01/bb/dpa)

SEVILLA, Spanyol (Antara/ AFP): Klub Inggris Aston Villa menjadi kampiun setelah menekuk raksasa Italia Juventus pada final Piala Perdamaian (Peace Cup) 2009 dengan skor 4-3 lewat adu tendangan penalti. Kedua tim finalis gagal mencetak satu gol pun sampai akhir babak pertambahan waktu, sehingga penentuan gelar ditentukan lewat drama tendangan 12 pas di Stadion Manuel Sanchez Pizjuan, Sevilla, Senin (3/8) dinihari WIB. The Old Lady yang mengalahkan Real Madrid 2-1 pada semifinal Jumat lalu, mendapat tekanan dari The Villans dalam permainan cepat mereka. Juve pun mampu melancarkan beberapa serangan, tapi tetap tidak menemukan cara untuk membobol gawang Villa yang dijaga kiper Amerika Brad Guzan. Penyerang veteran Juve David Trezequet kehilangan peluang terbaik yang tampaknya bisa membuahkan gol ketika tembakannya dari jarak dekat ke gawang lawan, hanya lewat di atas mistar gawang Villa


Kapten Aston Villa Nigel Reo-Coker mengangkat tropi juara Piala Perdamaian setelah menaklukkan Juventus pada final di La Cartuja Stadium, Sevilla, Senin (3/8) dinihari WIB. menit 63. Pada akhir laga, Si Nyonya Tua pun tidak mampu memanfaatkan dengan baik peluang adu tendangan penalti. Bek Nicola Legrottaglie gagal melesakkan peluang penalti terakhir, sehingga memberi Villa

kemenangan yang mengejutkan. Sebelumnya, pemain legendaris Italia Alessandro Del Piero juga tidak berhasil menyarangkan tembakannya yang segera diamankan Guzan. Sebanyak 12 klub ambil bagian dalam turnamen pra-mu-

sim Piala Perdamaian yang bergengsi di Spanyol. Turnamen ini mulai digelar tahun 2003 dan FIFA mengakuinya sebagai event internasional tahun 2007. Tahun ini untuk pertama kalinya ajang tersebut diadakan di luar Korea Selatan.

Bayern Bandroli Ribery 94 Juta Euro BERLIN (Waspada): Harapan Manchester United, Chelsea maupun Real Madrid mendapatkan Franck Ribery bakalan kandas, karena FC Hollywood membandroli bintang Prancis itu dengan fulus 94 juta euro. Ribery sendiri mengakui, angka sebesar itu menunjukkan bahwa FC Hollywood tidak mau menjualnya. “Bayern tidak pernah berniat melepaskan saya,” ujar Ribery, seperti dikutip dari TribalFootball, Senin (3/8). “Jika suatu hari nanti saya

harus meninggalkan Bayern, maka saya harus tetap menjaga hubungan dengan klub. Saya selalu melakukan itu dan saya tidak akan merubahnya,” tambah winger berusia 27 tahun itu. Dibandingkan El Real, maka The Red Devils dan The Blues yang paling getol memburu tandatangan Ribery. Tapi angka 94 juta euro yang labeli Bayern tentu saja akan ‘menakutkan’ dua klub raksasa Inggris tersebut. Ribery menjadi salah se-

orang komuditas yang paling panas di bursa transfer musim ini pasca kepastian bergabungnya Cristiano Ronaldo (MU) dan Ricardo Kaka (Milan) ke Santiago Bernabeu, Madrid. Kendati petinggi Bayern sudah menegaskan tidak ingin melepasnya, tapi Ribery masih saja mengeluarkan komentar inkonsisten yang membuat Allianz Arena kegerahan. Legenda Bayern Oliver Kahn bahkan menegaskan, Ribery menjadi biang masalah


di ruang ganti pemain. “Dia berprilaku seperti seorang diva,” kecam Kahn dalam Goal. (h01/okz/goal)


WASPADA Selasa, 4 Agustus 2009

Laili Singkirkan Petenis Thailand SOLO (Antara): Petenis Indonesia Laili RahmawatiUlfamenyingkirkanpetenisThailand, Siriporn Phakamad pada babak kualifikasi turnamen tenis internasional SoloWomen Cirkuit (SWC) 2009 di Lapangan Tenis Manahan, Kota Solo, Jawa Tengah, Senin (3/8). Pada pertandingan yang dilakukan di lapangan IV arena olahraga tersebut, Laili melibas telak dalam dua set langsung, 6-1 dan 6-0. Meskipun Laili sedang dalam kondisi yang kurang sehat, dia tidak mengalami kesulitan yang berarti ketika melawan petenis dari Thailand itu. Laili mengungkapkan, dia sudah mengerti karakterpermainanpetenisThailandyangmenjadi lawannya tersebut. “Beberapa minggu yang lalu saya sudah bertanding dengan Siriporn pada sebuah turnamen tenis internasional di Bandung dan saya mengalahkan dia pada pertandingan tersebut,” katanya. Mengenai target dalam SWC 2009, dia mengatakan, dia tidak memasang target apapun dalam turnamen ini. “Yang terpenting adalah saya menargetkan menang di setiap pertandingan. Masuk ke dalam babak utama sudah merupakan hal yang bagus bagi saya,” katanya. Sementara itu pada pertandingan lainnya di hari kedua babak kualifikasi SWC 2009, dua petenis Indonesia, Anggrenny Oky Suconong dan Monica Putri Kusumawardhana menyerah dari petenis China dan Korea Selatan. Anggrenny Oky Suconong yang bertanding di lapangan II dikalahkan oleh petenis China, Yang Pang dalam dua set langsung, 0-6 dan 2-

6, sedangkan Monica Putri yang bertanding di lapanganIIIdikalahkanolehpetenisKoreaSelatan, You Jin Kang dalam dua set langsung, 2-6 dan 0-6. Pada dua pertandingan yang berbeda tersebut, Anggrenny dan Monica sebenarnya dapat memberikan perlawanan sengit kepada dua petenis asing itu. Akan tetapi, kesalahan-kesalahan penempatan bola menjadi salah satu penyebab kekalahan kedua petenis Indonesia tersebut. Pada pertandingan lain di lapangan IV, petenis Thailand, Natchanok Saenyaukhot mengalahkan petenis India, Yamini Reddy dalam dua set langsung, 6-2 dan 6-2. Empat petenis yang menang dalam pertandingan babak kualifikasi di hari kedua penyelenggaraan SWC 2009 ini akan melaju ke babak utama nomor tunggal putri. Pada babak kualifikasi turnamen tersebut, Meutia Sabrina yang bertanding di lapangan satu mengalami kekalahan dari petenis Jepang Tomoko Taira dalam dua set langsung, 6-2 dan 6-1. Pada hari pertama babak kualifikasi, empat petenis lainnya sudah memastikan lolos ke babak utama SWC 2009, antara lain Tomoko Taira dari Jepang, Ya Zhou dari China, Reyka Woro, dan Bella Destriana dari Indonesia. “Sebanyak delapan petenis yang lolos dari babak kualifikasi tersebut akan masuk babak utama dan dimungkinkan bertemu petenispetenis unggulan, seperti Sandy Gumulya dari Indonesia dan Varatchaya Wongteanchai dari Thailand,” kata Direktur Turnamen SWC 2009, Ana Supriadi.


Krisna Bayu Sumbang Emas Pertama Indonesia JAKARTA (Waspada): Pejudo senior Indonesia Krisna Bayu (foto) berhasil menyumbangkan medali emas pertama bagi kontingen Indonesia di Asian Martial Arts Games (AMAG) I setelah memenangi kelas -100kg di Bangkok, Senin (3/8).

Dengan hasil tersebut, kontingen Indonesia yang berkekuatan 35 atlet dan mengikuti lima cabang olahraga, sudah mengantongi 1 medali emas, dua perak dan satu perunggu. Menurut informasi yang diperoleh dari manajer tim judo Kolonel Zaedun, atlet asal Jateng tersebut di final mengalahkan Kumar Anil dari India dengan teknik ippon. “Kami sangat bersyukur dan terharu menyaksikan bendera Merah Putih akhirnya berkibar

di Stadion Metropolitan Youth Center. Tapi ke depannya kami ingin tetap berjuang dan berprestasi,”ujarZaedunketikadihubungi melalui telepon internasional. Pada babak-babak sebelumnya, Krisna Bayu yang kelahiran 24 Desember 1974 berhasil me-

ngalahkan Bakhsi Muhammad (Afghanistan), juga denganippon. Kemudian di babak kedua menang WO atas atlet Kyrgistan Marte Batai yang batal tampil karenasakit.Kresnapunlangsung tampil di final. Atlet judo lain yang tampil,

kemarin, Indah Setiawati berhasil menempati lima besar Asia.Atlet asal Kaltim yang tampil di kelas -70kg ini semula menang ippon atas Han Aipin (China Taipei), tetapidisemifinaldikalahkanatlet Kazakhstan Amange Idieva. “Dalam perebutan tempat

ketiga dia kemudian mengalami kekalahan dari Solomon Karen dari Filipina sehingga ia urung mendapatkan perunggu dan akhirnya menempati posisi ranking lima Asia,” jelas Zaedun. Zaedun menambahkan, semangat para atlet tampil di AMAG demikian besar, apalagi setelah AMAG usai, mereka akan meneruskan perjuangan ke Pra SEA Games di Laos pada 8-10 Agustus mendatang. “Ke event Pra SEA Games kami akan membawa enam orang atlet junior yang baru-baru ini tampil juara di Kejuaraan Wismoyo Arismunandar Cup. Setelah itu bersama semua atlet yang tampil di AMAG kami akan tampil di Kejuaraan Asia Pasifik di Taiwan pada 12-15 Agustus mendatang,” ujarnya. Krisna Bayu merupakan atlet yang seringkali mengharumkan nama bangsa di berbagai event internasilnal dan dua tahun lalu, dia mendapatkan hadiah berupa rumah seharga Rp100 juta dari pemerintahmelaluiKementerian Pemuda dan Olahraga. (h01/ant)

Rizal Persembahkan Perak


1 3 9

6 5

6 5

8 4 3 4


9 6

4 3 7

MEDAN (Waspada): Setelah berjibaku menaklukan sirkuit jalanan Marina Bay Singapura di ajang Marlboro Red Racing Nights pada kompetisi simulator F1 sebagai tahap seleksi final regional, akhirnya terpilih empat pencetak waktu terbaik dari Medan. Keempatnya adalah Irvan Muda dengan waktu tercepat 1:44:450 detik, Tommy dengan waktu 1:44:870, Hardiman dengan waktu 1:46:161 detik dan Armika H dengan catatan waktu 1:48:013 detik. Irvan cs berhasil menyingkirkan 16 semifinalis lainnya di Retrospective Medan, Sabtu (1/8). Selanjutnya, para finalis akan bergabung dengan 46 peserta lainnya dari Pekanbaru, Jakarta, Palembang, Bandung, Yogya, Semarang, Makassar, Balikpapan, Surabaya dan Denpasar. Mereka nantinya akan mengikuti Marlboro Red Racing Experience di Sirkuit Sentul, 2-3 Oktober mendatang, dengan menggunakan delapan mobil yang didatangkan langsung dari Italia berupa Fiat Panda 4x4, Alfa Romeo 147 GTA, Fiat 500 dan Alfa Romeo GTVR. Marketing Manager Marlboro,Veronica Risariyana menyatakan, selamat kepada empat finalis asal Medan.”Kompetisi simulator F1adalahbagiandaripengujianketerampilanmerekadalammengenal atmosfer dunia F1, di mana lima pemenang tersebut diambil dari raihan waktu tercepat yang dibukukan,” jelas Risa di Medan, Senin (3/8). “Kepadaparapemenangkamiberharapagarbisamempersiapkan diri sebaik mungkin baik fisik maupun mental sebelum menghadapi tahapan puncak seleksi Marlboro Red Racing Experience di Sentul,” tambahnya. (rel/m09)

2 5 8 4 3 6 7 9 1

9 8


2 9



*Marlboro Red Racing School

3 4 7 1 8 9 5 6 2



7 8

Empat Finalis Medan Menuju Italia

1 9 6 5 7 2 4 3 8

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: agak sulit (****). Jawaban di kolom 8.

Jessy Rompies yang merupakan unggulan ketiga dan Lavinia Tananta yang merupakan unggulan kelima, belum menghadapilawanberatdibabak utama turnamen ini. Di putaran pertama, Jessy Rompies akan berhadapan dengan petenis Indonesia, CynthiaMelita,sedangkanLavinia Tananta akan berhadapan dengan Laili Rahmawati Ulfa. PetenisThailand,Varatchaya Wongteanchai yang menjadi unggulan kedua akan melawan petenis Indonesia, ReykanWoro. Padapenyelenggaraantahunlalu, turnamen yang berhadiah total $10.000 ini dijuarai oleh Sandy Gumulya. (h01ant)

6 3 5 9 1 7 8 2 4

Angka Tunggal Bersilang (Sudoku)

“wild card”. Sandy yang berperingkat 336 dunia mengatakan, petenispetenis yang tampil di babak utama turnamen ini adalah lawan-lawanyangberat,termasuk Nadia yang akan dihadapinya dalam babak utama. Mengenai petenis yang menjadi lawan terberat, dia mengatakan, dua petenis unggulan dari Thailand,VaratchayaWongteanchai yang berperingkat 466 dan Nungnadda Wannasuk yang berperingkat 568 menjadi lawan terberatnya. “Jika semuanya lancar, saya akan berhadapan dengan Nungnadda di babak semifinal,” katanya. Petenis Indonesia lainnya,

8 1 4 2 6 5 9 7 3

latihan. Beberapa gerakan masih sulit untuk saya lakukan,” ujarnya lagi. Meskipun begitu, lanjutnya, dia akan bermain semaksimal mungkin dan akan menerapkan strategi yang diberikan pelatihnya dalam SWC 2009 ini. “Karena merasa belum maksimal, saya menjadikan turnamen ini hanya sebagai ajang pemanasan dan adaptasi,” jelas Sandy. Dia mengatakan, target juara yang paling diincar adalah pada turnamen di Thailand yang berlangsung akhir Agustus 2009 ini.SandyGumulyayangmenjadi unggulanpertamapadaturnamen tersebut akan melawan petenis yang juga berasal dari Indonesia, Nadia Federika yang masuk ke babak utama melalui fasilitas

7 2 9 8 4 3 1 5 6

SOLO (Waspada): Petenis nasional,SandyGumulyamengatakan trauma cedera yang dialaminya saat ini menjadi kendala baginya dalam keikutsertaan di turnamen tenis internasional “SoloWomenCircuit”(SWC)2009 di Kota Solo, Jawa Tengah. “Target saya adalah juara, minimal bisa menembus babak final. Akan tetapi, pemulihan cedera yang masih saya lakukan menjadi kendala saya dalam mencapai target tersebut,” katanya di Solo, Senin (3/8). Cedera yang dialaminya lima bulanlalu,menurutnya,membuat permainan dalam turnamen ini tidak maksimal dan kondisi permainannya saat ini baru pulih 80 persen. “Hal tersebut dapat terlihat ketika saya melakukan

Nurul Fadillah (feather). Jelang ke AMAG, Selviana sempat mengikuti ajang Universiade yang diikuti 132 negara peserta di Beograd, Serbia pada 1-12 Juli lalu. Jelang ke AMAG, Selviana sempat mengikuti ajang Universiade yang diikuti 132 negara peserta di Beograd, Serbia pada 1-12 Juli lalu.

4 7 2 6 5 1 3 8 9

Sandy Trauma Cedera

melalui atlet senior Basuki Nugroho yang akan turun di kelas welter putra. AMAG I yang dibuka pada Sabtu lalu, diikuti sekitar 1.800 atlet dari 41 negara peserta. Indonesia turun dengan kekuatan 35 atlet yang hanya mengikuti lima cabang olahraga yakni judo, taekwondo, karate, pencak silat dan wushu. Pengurus Besar Taekwondo Indonesia (PB TI) mengirimkan delapan atlet yang terdiri atas empat putra dan empat putri. Atlet putra terdiri dari Basuki Nugroho (kelas welter), Meri Wandra (bantam), Rizal Syamsir (heavy/kelas berat) dan Yereth (fly). Sedangkan atlet putri adalah Selviana (middle), Eka Sahara (heavy), Catur Yuni (welter) dan

9 8 3 7 2 4 6 1 5


SAENYAUKHOT MELAJU. Petenis Thailand Natchanok Saenyaukot mengembalikan bola ke arah lawannya petenis India Yamini Reddy dalam Turnamen Tenis Internasional Solo Women Circuit di Lapangan Tenis Manahan, Solo, Senin (3/8). Saenyaukot berhasil melaju ke babak selanjutnya setelah menang dengan skor 6-2, 6-2.

tertarik. “Dalam pertarungan final secara teknis Rizal bisa mengimbangi Silmanos. Tetapi karena kondisinya sedang kurang fit dan cedera akibat otot betisnya tertarik, penampilannya jadi kurang maksimal. Kami sebenarnya sempatmemimpin,tapiakhirnya disalip,”ujarFadlymelaluitelepon internasional. Taekwondo Indonesia memangberpeluangbesaruntuk meraih medali pada event yang baru pertama kali digelar ini. Karena berdasarkan hasil undian, atlet Indonesia menghadapi lawan-lawan yang relatif ringan di babak awal. Sebelumnya, Sekjen PB TI, Wahyu Hagono merasa optimis bisa meraih prestasi terbaik

5 6 1 3 9 8 2 4 7

JAKARTA (Antara): Taekwondoin Rizal Syamsir mempersembahkan medali perak kedua bagi kontingen Indonesia di ajang Asian Martial Arts Games (AMAG) di Bangkok, Minggu malam. Pada pertandingan yang digelar di Indoor Stadium Huamark Sport Complex, Bangkok, Rizal tampil menjadi runner-up di kelas berat setelah ditaklukkan atletKazakhstan,Silmanos.Selain perak, satu medali perunggu juga diraih Eka Sahara yang tampil di kelas yang sama (heavy). Pelatih taekwondo Fadly Pottu mengatakan secara teknis sebenarnya Rizal bisa mengimbangi Silmanos. Namun saat bertanding kondisi Rizal sedang kurang fit karena otot betisnya




Gelar ATP Kedua Querrey


LOS ANGELES, AS (Waspada): Petenis Amerika Serikat (AS), Sam Querrey (foto), mengatasi ketegangan pada set kedua untuk meraih gelar ATP keduanya usai kemenangan 6-4, 3-6, 6-1 atas petenis Australia Carsten Ball pada LA Terbuka, Senin (3/8). Unggulan keenam itu,

difavoritkan mengalahkan pemain peringkat 205 dunia yang belum pernah menang dalam sirkuit hingga pekan ini, dua kali mematahkan servis lawannya pada set ketiga sebelum mengakhiri pertandingan dalam waktu satu jam, 27 menit. Querrey, mengalahkan

unggulan teratas asal Jerman Tommy Haas di semifinal, menghasilkan ace kesebelasnya untuk memastikan kemenangan di bawah terik sinar matahari di LA Tennis Center sebelum menghujamkan tangan kanannya ke uda-


ra sebagai tanda merayakan kemenangan. “Ini adalah salah satu turnamen favorit saya dan sungguh menyenangkan bisa menang di sini,” kata Querrey. “Saya juga harus memberi selamat bagi Carsten yang tampil luar biasa sejak babak kualifikasi hingga berhasil mencapai final,” pujinya. (m33/ant/rtr)

PERNYATAAN Kami Suardi Yusuf/Keluarga dengan Zulham/Isteri (Neneng) menyatakan bahwa akibat berita dari pihak ketiga dan disebarkan melalui SMS mengakibatkan ketidaknyamanan dan kerugian kedua belah pihak. Oleh karena itu SMS yang telah dikirim dinyatakan dicabut dan dianggap tidak ada. Antara kami Suardi Yusuf/Keluarga dan Zulham/Isteri (Neneng) tidak pernah terjadi hal-hal yang tidak diingini. Medan, 04 Agustus 2009

Wassalam kami

Suardi Yusuf/Keluarga

Selasa 4 Agustus 2009

Davydenko Menang Beruntun

Trofi Spesial Bartoli STANFORD, AS (Waspada): Partai final Turnamen Stanford Classic berakhir dengan kejutan ketika petenis Perancis Marion Bartoli (foto) berhasil menjadi juara setelah menang 6-2, 5-7 dan 6-4 atas Venus Williams, Senin (3/8). Kemenangan ini terasa sangat spesial bagi Bartoli karena sekaligus menjadai kemenangan perdananya di turnamen tenis WTA yang berkelas premier. Dengan menjadi juara di Stanford, Bartoli mengalami kenaikan peringkat ke posisi 13. “Jika terus bermain seperti ini, maka saya punya kesempatan untuk bermain bagus di AS Terbuka dan dapat menembus peringkat lima besar. Itulah target saya,” ujar Bartoli seperti dilansir AP. “Saya tahu apa yang menjadi kekuatan dan saya mampu memperbaiki kekurangan saya. Saya memperbaiki pergerakan dan fisik, tetapi dengan kemenangan ini dapat menumbuhkan mental bertanding saya,” lanjut petenis 24 tahun itu. Pujian pun dilontarkan Venus untuk Bartoli. Juara Stanford Classic 2002 itu menilai Bartoli bermain lebih baik. “Marion bermain baik. Saya tidak dapat menemukan irama permainan dan berkonsentrasi ke lapangan,” ucap Venus. “Saya harus memberikan kredit tersendiri baginya. Itu adalah permainan terbaiknya selama saya pernah melihatnya bermain,” sambung Venus yang bersama adiknya, Serena, bangkit untuk menjuarai nomor ganda putri. (m33/ap)


Zulham/Isteri (Neneng)

UMAG, Kroasia (Waspada): Petenis nomor sembilan dunia, Nikolay Davydenko (foto), menang kedua kali secara beruntun saat mengalahkan petenis Spanyol Juan Carlos Ferrero 6-3, 6-0 dalam final Turnamen ATP lapangan tanah liat di Umag, Kroasia, Senin (3/8). Davydenko juga menang di lapangan tanah liat pada turnamen Hamburg pekan lalu dan kemenangannya itu merupakan gelar juaranya yang ke-16 sepanjang karirnya. “Ini merupakan malam yang sangat indah,” ujar petenis Rusia tersebut. Di Istanbul, petenis Rusia unggulan kelima Vera Dushevina memenangi turnamen WTA berhadiah 220.000 dolar AS. Dushevina menga-

lahkan unggulan delapan asal Ceko Lucie Hradecka 6-0, 6-1 dalam 41 menit untuk meraih gelar pertamanya sepanjang karir. Petenis berusia 22 tahun itu memenangi set pembuka dalam 16 menit ketika lawannya kerap melakukan serangkaian kesalahan ganda. Di set kedua, Hradecka berhasil menang satu game namun Dushevina melaju untuk memenangi lima game berikutnya. “Lawan saya lelah dan saya bermain sangat bagus. Saya melakukan servis dengan baik dan terus mengendalikan permainan. Saya menjalani turnamen yang menyenangkan dan sedang dalam performa yang bagus,” kata Dushevina, peringkat 49 dunia. (m33/ap)

Medan Metropolitan Bank Sumut Kembali Raih Penghargaan Sangat Baik


WASPADA Selasa 4 Agustus 2009

MEDAN (Waspada): Untuk ketujuhkalinya PT Bank Sumut meraih penghargaan sebagai bank berpredikat “sangat baik” dari majalah keuangan nasional InfoBank. Penghargaan diberikan berdasarkan penilaian terhadap sekitar 125 bank di Indonesia. InfoBank menganugerahkan penghargaan itu setelah menilai kinerjaBankSumutselamatahun 2008. Beberapa poin yang menjadi penilaian, yakni tingkat kesehatan bank dan capital atau permodalan (Camel), asset quality, manajemen, earning atau kemampuan memperoleh laba serta likuiditas. “Hasilnya sangat baik. Karenanya,BankSumutsangatpantas kembali menerima penghargaan itu,” ujar Direktur InfoBank Eko B Supriantodalam acara Malam Penganugerahan Penghargaan di Intercontinental Bali Resort

Denpasar, Jumat (30/7) malam. Penghargaan bergengsi itu diserahkan Eko kepada Direktur Utama Bank Sumut Gus Irawan Pasaribu bersama Komisaris Utama Bank Sumut Djaili Azwar. Hadir dalam acara itu, Direktur Pemasaran Bank Sumut Zenilhar, sejumlah gubernur dan sejumlah pimpinan bank di Indonesia. Gus Irawan mengatakan, penghargaan ini sangat membanggakan seluruh masyarakat Sumut. Bagi nasabah, penghargaan ini menjadi bukti bahwa kinerja Bank Sumut semakin membaik dan sehat. Sementara

Dua Nelayan Aceh Kembali Dari Thailand MEDAN (Waspada) : Dua nelayan asal Aceh tiba kembali di Medan, Jumat (31/7), setelah 1 bulan terdampar di kawasan Songkhla Thailand. Para nelayan tersebut antara lain Syaiful Bahri Ismail, 39, penduduk Lancang Baru Blang Naleng Mameh, Kecamatan Muara, Lhokseumawe. Sementara Abu Rayek, 44 kelahiran Perlak AcehTimur, selama ini menetap di Ulee Bata, Kecamatan Meuraksa, Banda Aceh. Keduanya kelihatan ceria saat mendarat di Bandara Polonia Medan dengan penerbangan Malaysia Airlines System (MAS) MH864 dari Kuala, mendarat pukul 14:50, dengan menggunakan Surat Perjalanan Laksana Paspor (SPLP) dikeluarkan pada Konsulat RI di Songkhla Thailand. Di tangga pesawat MAS Bandara Polonia Medan, disambut Kepala Perwakilan Pemprov Aceh di Medan, Drs Muchlis Azis, dan selanjutnya di bawa ke kantor Perwakilan Aceh di Jalan Pattimura Medan. Abu Rayek kepada wartawan membenarkan, perahu yang dia tumpangi mencari ikan di kawasan Aceh Besar dihantam ombak pada 30 Juni 2009. “Sempat terkatung-katung 14 hari di laut, kemudian diselamatkan nelayan Thailand dan berada disana 16 hari,” ujarnya. Setelah dijamu makan siang di perwakilan Aceh, kedua nelayan itu difasilitasi dan diantar ke stasiun bus dan Jumat sore bertolak ke Banda Aceh. (m32)

Tewas Tergilas Mobil Derek MEDAN (Waspada): Seorang pengendara sepeda motor tewas tergilas mobil derek di Jalan Kapten Sumarsono Medan, Senin (3/ 8) sekira pk 15:00. Sedangkan sopir mobil derek diamankan di markas Satlantas Poltabes Medan. Dalam kondisi kepala pecah, mayat Mhd Ridwan, 39, warga Jalan Gatot Subroto Km 6,8, Kelurahan Sei Sikambing B, Medan, segera dilarikan ke RSU Dr Pirngadi. Informasi yang diperoleh di lokasi kejadian menyebutkan, korban Mhd Ridwan mengendarai sepeda motorYamaha BK 6156 CI datang dari arah Jalan Kapten Sumarsono hendak kembali ke rumahnya. Saat itu, dari arah samping kiri, korban hendak mendahului mobil derek BK 8192 DF yang disopiri Muayin, 41, warga Jalan Perwira/ Yos Sudarso Gg Guntoro, Tanjungmulia. Persis berada di samping kiri mobil derek, tiba-tiba sepeda motor yang dikendarai korban menabrak gundukan batu dan pasir hingga korban terjatuh ke kolong mobil derek. Akibatnya, kepala korban tergilas ban belakang mobil derek hingga pecah dan tewas seketika, sedangkan sepeda motor korban terjatuh ke samping dan tidak tergilas truk. Petugas Satlantas Poltabes, Aiptu Syahnan, yang ditemui di lokasi kejadian menyebutkan, korban hendak mendahului mobil derek dari samping kiri namun terjatuh dan terlindas ban belakang truk. Sedangkan sopir truk diamankan di Mako Satlantas Poltabes Medan, namun mobil derek diamankan di gudang penyimpanan milik Pemko Medan di Jalan Kayu Putih. Sopir truk Muayin yang ditemui Waspada di Mako Satlantas Poltabes Medan mengakui tidak sempat melihat korban berada di samping mobil yang dikendarainya. “Saat saya melintas saya tidak melihat korban berada di samping kiri. Tiba-tiba saja saya merasakan ada sesuatu yang terlindas,” ujar Muayinserayamenambahkansetelahmengetahuimobilnyamelindas seseorang, dirinya spontan berhenti dan menyerahkan diri kepada petugas Satlantas Poltabes MS. (cat)

untuk karyawan, penghargaan ini akan semakin memotivasi untuk memberi kontribusi terbaik. “Hingga 30 Juni, Bank Sumut telah menghimpun laba Rp300 miliar dengan total penghimpunan Dana Pihak Ketiga (DPK) Rp9.15 triliun atau meningkat Rp1,14 triliun atau 14,23% dari posisi Juni 2008 sebesar Rp8,01 triliun,” ujarnya. Atas prestasi yang menggembirakan ini Gus Irawan optimis bahwa bank kebanggaan masyarakat Sumut ini akan bertumbuh lebih pesat di masa mendatang. Apalagi katanya, bank ini antara lain memiliki produkproduk layanan perbankan antaralainTabunganHajiMakbul, Tabungan Simpeda yang berhadiah uang tunai dan diundi 2

kali setahun, layanan M-ATM yangmelayaniaksesATMmelalui telefon selular khusus pengguna kartu Simpati Pe-De dan Kartu Simpati Extra, Western Union, pembelian tiket pesawat Garuda melaluiATMBankSumut,layanan pajak online dan safe deposit box. Jumlah ATM akan ditambah 64 unit sehingga jumlah menjadi 143 unit termasuk di antaranya 2 unit ATM untuk transaksi non tunai (pemindahbukuan) dan 1 unit Cash Deposit Machine (CDM). “Dengan begitu, bank ini benar-benar mampu menggerakkan roda perekonomian Sumut dan menjadi bank yang diperhitungkan di lingkungan nasional, serta menjadi tuan rumah di daerah sendiri,” jelasnya. Dia juga mengungkapkan,

dirinya optimis bisa mempertahankan prestasi yang telah diraih Bank Sumut saat ini. Karenanya, lanjut Gus Irawan, ke depannya bank dipimpinnya ini akan lebih ekspansif lagi dalam mengembangkan usaha. Sementara itu, Komisaris Utama Djaili Azwar mengatakan, penghargaaninimenjadikebanggaan sekaligus tantangan bagi pihaknya sebagai dewan komisaris yang baru. “Ini artinya, upaya terbaik untuk menumbuhkembangkan Bank Sumut, harus terus dilakukan,” jelasnya. Karenanya sebagai dewan komisaris yang baru, dirinya bersamaduakomisarislainnya,yakni M Lian Dalimunthe dan Irwan Djanahar mengomitmenkan kesiapan melakukan upaya terbaik tersebut. (m19)

PDAM Diminta Beri Layanan Terbaik Di Bulan Puasa MEDAN (Waspada): Pemprovsu minta PDAM Tirtanadi benar-benar memberikan pelayanan air minum terbaik dalam memasuki bulan puasa Ramadhan yang sudah diambang pintu. Dalammewujudkanharapan tersebut, Sekdaprovsu, Drs RE Nainggolan,MMSidakkeinstalasi PAM Sunggal, Sabtu (1/8). “Kita meminta PDAM Tirtanadi all out dalam pelayanan air minum terutama saat-saat memasuki bulan suci Ramadhan yang sudah diambang pintu,” kata RE Nainggolan kepada wartawan usai kunjungan itu. Nainggolan memilih Sidak ke instalasi pengolahan air (IPA) Sunggal karena instalasi tersebut memberikan kontribusi pelayananairminumterbesar.“Menurut

laporan yang saya terima instalasi ini mensuplai sekitar 60 persen kebutuhan air minum pelanggan di Medan dan sekitarnya,” katanya. Dalam kunjungan itu, Nainggolan mengamati semua proses pengolahan air baku hinggga siap disuplai melalui pipa-pipa distribusi kepada pelanggan. Ketika mengamati dari dekat lima bak penyaringan air minum yang keseluruhan menghasilkan air minum 2000 liter perdetik. Nainggolan memperoleh informasi, bak penyaringan tersebut masa operasionalnya sudah termasuk tinggi dan semuanya harus dioperasionalkan hingga perawatan dan pembenahan masing-masing bak penyaringan harus menunggu bak penyaringan baru. Namun begitu, sampai seka-

rang semua bak itu masih bisa menghasilkan air sebagaimana standard yang ditetapkan. Sebagian saringan bak-bak tersebut sudah diganti, sementara sebagian lainnya sudah mendesak untuk diganti. Dirut PDAM Tirtanadi, Drs Sjahril Effendy Pasaribu, berjanji akan memberikan pelayanan terbaik sebagaimana diharapkan. Dirut mengakui, berdasarkan pengalaman selama ini setiap Ramadhan ada kecenderungan penggunaan air lebih besar dari biasanya. “Kami akan menyesuaikannya dengan menambah jam operasional dan memastikan pengaturan distribusi air minum lebih baik. Seperti tahun-tahun sebelumnya pelayanan di bulan suci Ramadhan diupayakan paling baik,” kata Sjahril.(m19)

Perbedaan Budaya Sumber Kekuatan Warga Medan MEDAN (Waspada): Keragamanbudayaadalahnilaikekayaan budaya bagi warga kota Medan dalam memupuk sikap keberkawanan.Keragamanbudayawarga kota Medan bukanlah penghalang, tetapi menjadi sumber kekuatan kita untuk tetap bersatu menjaga kondusifitas. “Perbedaan itu menjadi anugerahdankaruniaTuhanyang patut kita syukuri. Dasar perbedaan itulah dapat melahirkan fikiran yang arif dan sikap yang bijak hingga dengan mudah mengelola keragaman itu,” kata Drs. Safwan Khayat, MHum(foto) Ketua Pimpinan Daerah Majelis Adat Budaya Melayu Indonesia (PD MABMI) Kota Medan yang terpilih pada Musda IX PD MABMI Medan dalam siaran persnya, Sabtu (1/8). Menurutnya, suatu budaya suku bangsa lahir dari niat luhur penganut budaya itu sendiri. Nilai dasar yang diajarkan dalam suatu


budayasukubangsayaknimengajarkanbagipelakubudayaitusendiri untuk hidup saling menghargaigunamenjagahubunganbaik. “Landasan budaya tak jauh dari dasar ajaran agama yang menanamkan pesan moral dan kerja keras,” tegasnya. Kearifan dalam berfikir dan bijak dalam bertindak, lanjutnya,

tak luput cerminan seseorang bersikap berbudaya. Sikap berbudayainimenjadibagiandari sikap seseorang itu menegakkan ajaran agamanya yang diyakini. Berfikir arif dan bersikap bijak senantiasa kita jaga. Pola tindak merusak yang didorong oleh syahwat kepentingan bukan cermin tipe kepribadian yang berbudaya dan beragama. “Sikap persahabatan dengan menjaga pola tindak yang merusak hanyalah merugikan diri sendiri. Suasana aman sudah tentu pasti nyaman,” jelasnya. Mantan Kasat Lantas PoltabesMedaninijugamenjelaskan, keragaman budaya bagi penduduk kota Medan harus saling mengisi tanpa melukai. Dukungan warga di atas program kebijakan pembangunan kota Medan turut membantu pemerintah kota (Pemko) Medan mengelola keragaman budaya itu sendiri.(m39)

Menggantungkan Harapan Di Atas Tanggal 10 DERETAN bendera-bendera merah putih serempak berkibar dihembus angin sore, Senin (3/8). Kibaran bendera tergolong cukup lama itu menjadi pemandangan gratis di kawasan depan Taman Makam Pahlawan Jalan Sisingamangaraja Medan. Riak-riak

bendera merah putih di pinggiran jalan negara itu sebagai tanda sebentar lagi kita menyambut Hari Kemerdekaan RI ke-64. Kibaran bendera itu juga melambangkan wajah-wajah penjual bendera tetap ceria dan bersemangat menyambut 17 Agustus, meski harga pembelian

kain, bahan pembuat bendera, bergerak naik. Para pedagang informal itu tetap optimis penjualan tahun ini tetap bergairah. “Kami tetap optimis penjualan bendera merah putih tahun ini tetap memperoleh keuntungan,”kata Hari,25, pedagang bendera di depan Makam


Seorang pedagang bendera informal di depan Makam Pahlawan Jalan Sisingamangaraja Medan, Senin (3/8), sibuk menyusun benderanya untuk menarik pembeli.

Pahlawan Jalan Sisingamangaraja Medan, kemarin. Menurut Hari, harga kain saat ini menembus Rp350.000 sampai Rp375.000 per bal. Sedangkan tahun lalu bisa diperoleh dengan harga Rp300.000. Meski demikian pedagang bendera tahun ini masih bisa menahan nafsu menaikkan harga penjualan.Yang penting sama-sama enak dan bisa merayakan tujuhbelasan dengan bendera baru. Lalu bagaimana cara pedagang menyiasati harga kain naik? Kata Hari, itu tergantung tawar menawar dengan pembeli. Yang jelas, pasaran bendera untuk dipasang di rumah, 50 cm, antara Rp15.000 sampai Rp20.000. “Harga itu bisa turun, jika ada penawaran. Namanya juga pedagang kaki lima. Harga tergantung penawaran,”ujarnya. Kemudian, pedagang menyiasati dan menutupi biaya tambahan pada penjualan bendera sepeda motor atau ukuran kecil. Bendera kecil itu dibuat dari sisa-sisa potongan kain, juga bisa dijual Rp1.500 sampai Rp2.000 per buah. Ini pun juga tergantung penawaran. Ditawar-tidak ditawar penjualan bendera kecil ini tetap untung. Hari mengaku menjual bendera dari buatan abangnya telah berlangsung beberapa tahun.Tahun lalu sebelum harga kain naik, katanya, mereka

mendapat keuntungan mencapai satu jutaan. Atau seratus persen lebih dari modal pembelian kain. “Insyaallah tahun ini keuntungan bisa lebih dari tahun lalu,” ujarnya. Mengenai minat beli masyarakat, Hari mengatakan puncaknya tanggal 10 Agustus ke atas. Biasanya pembeli ramai di situ. Kalau sekarang pembeli belum tampak banyak. “Kami tetap yakin pembeli pasti tetap ada dan ramai.” Rustam, 32, pedagang bendera yang nongkrong di Jalan Imam Bonjol, juga mengatakan, bendera-bendera ukuran kecil menjadi tumpuankeuntungandanmenutupi biaya lebih dari kenaikan harga kain tahun ini. Dari penjualan bendera besar dalam situasi harga kain naik, lanjutnya, sulit mengharapkan keuntungan. “Kami hanya menjual agar barangnya cepat habis saja. Kalau pun ada keuntungan dari penjualan bendera besar, tergantung dari penawaran juga,” ujarnya. Rustam bersama anaknya menjajahkan ben-dera ini juga tetap optimis dagangannya tetapi laku seperti tahun lalu. Baginya sama dengan pedagang bendera yang lain. Menunggu pembeli ramai di atas tanggal 10 Agustus. (m15)


PERNGHARGAAN: Dirut Bank Sumut Gus Irawan Pasaribu bersama Komisaris Utama Djaili Azwar dan Direktur Pemasaran Zenilhar foto bersama sertifikat penghargaan bank sangat baik yang baru diterima.

Waspada Seminarkan Perda Menara Bersama MEDAN (Waspada): Harian Waspada akan menggelar seminar peraturan daerah tentang Menara Bersama operator telekomunikasi yang sudah disahkan DPRD Sumut padahal di satu sisi operator selular belum bisa menerimanya. Ketua Panitia Seminar Armin Nasution didampingi Sekretaris Khaidir Anwar dan Bendahara Edward Thahir, Senin (3/8), mengatakan seminar Pro Kontra Menara Bersama: Antara Kepentingan Pemda dan Coverage Operator Selular berlangsung di Hotel Garuda Plaza (GPH) Medan Kamis (6/8). “Kita merasa perlu untuk menggali lebih dalam tentang Perda ini. Sebenarnya saat ini Perda tersebut sudah disahkan DPRD Sumut. Di sisi lain, operator selular beranggapan masih banyakhalyangkurangjelas,”kata Armin. Itusebabnyadenganseminar itu paling tidak memberi wacana baru bagi Pemprovsu, operator selular dan para stakeholders bisa memahami tentang isi Perda sebenarnya. Latar belakang seminar ini,

tegasnya, sudah dimulai ketika pemerintah pusat melalui Peraturan Bersama Mendagri, Menteri PU, Menkominfo dan Kepala BKPMD No. 18/2009 – No. 07/PRT/M/2009 – 19/PER/ M.Kominfo/03/ 2009 – No. 3/ P/2009 mengeluarkan Pedoman Pembangunan Menara Bersama Menara Telekomunikasi. Dengan adanya aturan itu diharapkan implementasinya di daerah dapat berdayaguna, sekaligus juga mampu menyerap aspirasi daerah. Armin mengungkapkan seluruh fraksi di DPRD Sumut kemudian menerima dan menyetujui Ranperda pembangunandanpenataanmenaratelekomunikasibersamaProvsumelalui rapat paripurna dewan, Senin (6/ 7) di gedung DPRD Sumut. Kedelapan fraksi masingmasing FPG, FPDI-Perjuangan, FPDemokrat, FPPP, FPKS, FPAN, FPDS dan FPBR menyatakan setujuterhadapranperdamenara bersamauntukdisahkanmenjadi Perda. Sebelumnya, Pansus menara bersama DPRD Sumut melaporkan, mengenai teknis yang belum

tercantum dalam draft ranperda akan dimuat dan diatur lebih lanjut dalam Pergubsu pembangunan dan penataan menara telekomunikasi bersama diterbitkan setelah adanya MoU antara Pemprovsu dengan Pemkab/ Pemkose-Sumut,sehinggaperda ini nantinya benar-benar dapat dilaksanakan sebagaimana diharapkan. Seminar nantinya akan dihadiri seluruh operator selular yang ada di Medan. Pembicara yang sudah memastikan hadir a.l. Direktur Urusan Pemerintahan Daerah Direktorat Jenderal Otonomi Daerah Depdagri Made Swandi, Kadis Kominfo Sumut Eddy Syofian, Ketua Asosiasi Telefon Seluar Indonesia (ATSI) regional Sumut Agus Simorangkir, praktisi hukum Prof. Ningrum Sirait. Sementara moderator akan diisi Hinca Panjaitan, praktisi dan pengamat pers. Para peserta berasal dari Dinas Tata Kota dan Tata Bangunan pemerintah kabupaten/kota, dinas Kominfo, pengusaha, praktisi, dosen dan operator selular. (m08)

Siaran TV Cenderung Ganggu Perkembangan Moral Anak MEDAN (Waspada): Ketua KPID Sumut H. Abdul Haris Nasution menegaskan, saat ini banyak tayangan di televisi yang sangat mengganggu perkembangandanpertumbuhanmoralanak. Keadaan buruk ini tidak bisa dibiarkan, karena akan menjerumuskan para generasi muda ke dalam kanca kerusakan. Pernyataan itu muncul pada acara media litarasi Komisi Penyiaran Indonesia Daerah (KPID) Sumatera Utara dengan tema Waspadai isi siaran radio dan televisi di kompleks Asrama Rumah Anak Madani, Jalan Marelan, Kamis (30/7). Menurut Nasution, melihat banyaknya tayangan televisi yang cenderung membentuk sikap dan prilaku anak kepada tak baik, maka KPI berkewajiban melakukan bimbingan dan pengawasan. Agama manapun juga, tegas Nasution, melarang siaran yang tidakbaik.Mengingathalitu,anakanakharuspandaimemilihsiaran tak baik dan sekaligus melakukan kritisi terhadap bentuk-bentuk siaran tidak mendidik itu. KPI sudah menetapkan be-

berapa larangan untuk tidak ditayangkan dan disiarkan seperti yang berbau SARA, porno grafi dan pornoaksi, persoalan privasi, menghasut serta berbau fitnah. “Semua bentuk siaran itu harus mendapat kritisi bagi anak-anak,” katanya dihadapan ratusan siswa dan siswi. Sedang Hj. Supriati Harahap dari KPID Sumut, menyebutkan, para anak-anak harus pandai memilih dan memilah, karena siaran televisi saat ini cenderung mengubah sikap dan prilaku kepada yang negatif. Anak-anak jangan hanya melihat tayangan sinetron di televisi dari sisi percintaan, kekerasan dan pembagian harta warisan saja, karena hal itu akan mengajarkan kita lebih banyak kepada sikap negatif. Namun, para anak-anak harus dapat memilih dan memilah berbagai tayangan yang disajikan televisi yang mampu memotivasi menumbuhkan kemauan berbuat kepada nilai-niali positif. Walaupun diakui sangat sedikit sinetron yang ditayangkan bisa menjadi contoh untuk berbuat

kebaikan. MenurutSupriati,dalamkehidupan yang glamour atau serba takterkendalisaatini,kitalupabaik orang tua apalagi anak-anak untuk memilah dan memilih mana tontonan bermanfaat atau tidak. Bahkan, Usep juga dari KPID Sumut menegaskan, jika melihat dan mendengar tayangan dan siaran seperti apa yang katakan ketua KPID, segera laporkan. Ketua Komisi Perlindungan Anak Indonesia Daerah (KPAID) Sumut, Zahrin Piliang, dalam sambutan pembukaan mengimbau para orang tua dan anak untuk mematikan televisi mulai pukul 18:30 hingga 21:00, sejak Senin hingga Sabtu, karena ketika itu anak sedang mengerjakan pekerjaan rumah dari sekolah. Piliang juga menyebutkan, saat ini banyak orang tua yang lalai dalam membimbing anak ketikabelajar,sehinggakeseriusan anak tidak terkonsentrasi untuk belajar di rumah. Padahal, bimbingan orang tua sangat diperlukan ketika anak sedang belajar di rumah untuk memberi motivasi, walaupun tidak paham.(m14)

PTI Al-Hikmah Bersaing Demi Ilmu Pengetahuan 600 Lulusan Diwisuda MEDAN (Waspada): Mengatasi berbagai masalah dan tantangan barat sebagai dampak globalisasi seperti krisis ekonomi, sosial budaya, hukum dan moral hanya dapat diatasi dengan solusi ilmu pengetahuan dan kemampuan bersaing yang mengedepankan pentingnya ilmu pengetahuan. Hal tersebut dikatakan Ketua Senat Perguruan Tinggi Islam (PTI) Al-Hikmah Medan, Drs. ZainudinSiregar,SH,SE,MMpada wisuda sarjana perguruan tinggi tersebut di gedung Auditorium Unimed, Sabtu (1/8). Zainuddin Siregar menyebutkan, daya saing yang semakin kompetitif, tidak lagi bergantung terhadap ilmu pengetahuan yang dimiliki dan dikuasai di bangku kuliah.“Kenyataaninisudahtentu mewajibkan saudara-saudara untuk tetap menambah ilmu pengetahuan, dengan kata lain upaya-upayapengembangandiri harus tetap dilakukan untuk diterapkanditengahmasyarakat,”

katanya. Menurutnya, sebagai Lembaga Pendidikan Tinggi, Perguruan Tinggi Islam Al-Hikmah dituntut harus mampu memberikan respon dan jawaban terhadap tantangan zaman baik pada saatinimaupunyangakandatang. “Para alumni diharapkan tidak hanya mampu mengayomi keluargasendiri,disampingituharus dapat memberikan warna dan pengaruh kepada masyarakat” jelasnya. Dalamrangkameningkatkan kualitas akademik meliputi intelektualitas, keilmuan, ketaqwaan dan keterampilan, Perguruan Tinggi Islam Al-Hikmah telah melaksanakan berbagai seminar, forum diskusi, lokakarya dan penelitian-penelitian baik di kalangandosenmaupunmahasiswa. Dalam bidang kerja sama, Perguruan Tinggi Islam AlHikmah juga melaksanakan kerja sama dengan instansi-instansi terkait dan lembaga perguruan tinggibaiknegerimaupunswasta,

juga melakukan KKN dan PKL yang diikuti mahasiswa yang sudahmendudukisemesterakhir. “Kami seluruh civitas akademika berusaha dengan segala kemampuan menghimpun segala potensiyangadauntukmengembangkandanlebihmeningkatkan mutu Perguruan Tinggi Islam AlHikmahsecaramenyeluruh,”kata Zainudin. Lulusan Al-Hikmah yang diwisuda berjumlah 600 orang, masing-masing Sekolah Tinggi Agama Islam program Sl Pendidikan Agama Islam angkatan XVll sebanyak 240 orang, Sekolah Tinggi Ilmu Ekonomi program Sl Manajemen 145 orang. Sekolah Tinggi Ilmu Hukum program Studi Ilmu Hukum Sl sebanyak 115 orang, dan program D-III Akuntansi angkatan VI sebanyak 20 orang. Sedangkan Sekolah Tinggi Ilmu Tarbiyah Tebing Tinggi Program Studi Pendidikan Agama Islam angkatan III sebanyak 30 orang. (m41)

Medan Metropolitan



Selasa 4 Agustus 2009

Terkait Mudahnya Ganja Dan Heroin Masuk Medan

Pejabat Bandara Surati Dirut PT Pos MEDAN (Waspada): General Manager (GM) AP-II Bandara Polonia Medan Endang Sumiarsa menegaskan pihaknya segera menyurati Dirut PT. Pos di Jakarta terkait maraknya pengiriman ganja dan heroin dari luar negeri yang digagalkan petugas keamanan jajaran Bandara Polonia. “Kepada pimpinan PT Pos Wilayah I sudah kami surati, sekarang tinggal giliran surat dilayangkankepadaDirutPT.Pos,” katanya kepada wartawan di Bandara Polonia, Senin (3/8).

Menurut Endang, sejak dirinya menjabat GM AP-II atau sekitar 8 bulan berjalan, sudah lima kali petugas bandara menggagalkan pengiriman ganja dan tiga kali menggagalkan pengiri-

BAP Tersangka Narkoba Segera Dikirim Ke Jaksa MEDAN (Waspada): Sat Narkoba Poltabes Medan dalam waktu dekat akan mengirimkan berita acara pemeriksaan (BAP) tersangka Candra Surya Nasution (foto), warga Komplek Veteran Medan Estate, Percut Sei Tuan, ke kejaksaan. “Tersangka masih berada di sel tahanan Poltabes Medan dan sebentar lagi BAP nya kita kirim ke jaksa,” jelas Kasat Narkoba, Kompol Jukiman Situmorang, ketika dikonfirmasi Waspada, Senin (3/8). Dijelaskan Jukiman, saat ini polisi masih melengkapi berkas milik tersangka, nanti kalau sudah selesai baru kita kirim. Informasi di Poltabes, tersangka ditangkap Sat Narkoba Poltabes Medan 27 Juli 2009 sekira pukul 16:30, di kediamannya saat mengkonsumsi narkoba. Dalam penangkapan itu polisi menyita barang bukti sabhu dan ganja. Hasil pemeriksaan sementara di Poltabes Medan, tersangka yang residivis, pernah ditahan dalam kasus narkoba tahun 96. setelah keluar dari Rutan, tersangka kemudian ditangkap polisi lagi dalam kasus penganiayaan dan dihukum 1 tahun pernjara. (m39)

Enam Jurtul Togel Masuk Bui MEDAN LANBUHAN (Waspada): Satu pekan terakhir ini, enam juru tulis atau jurtul toto gelap (togel) ditangkap petugas Polsekta Medan Labuhan. Empat dari enam tersangka itu warga Kecamatan Medan Deli yakni JS, 44, warga Lorong Jaya Kelurahan Mabar, DK, 35, warga Jalan RPH Mabar, ON, 47 warga Jalan Kawat VI Kelurahan Tanjung Mulai, JS, 38 warga Jalan Bauksit Kelurahan Kota Bangun, Kecamatan Medan Deli. Dua lainnya warga Kecamatan Medan Labuhan yakni MTS, 47, warga Lingkungan I Tojai Kelurahan Tangkahan dan JB, 46, warga Jalan Tangguk Damai 12 No 124 Kompleks Perumahan Griya Martubung Kelurahan Besar. Kapolsekta Medan Labuhan, AKP Dony Aleksander, SIK didampingi Kanit reskrim Iptu Eddy Safari mengatakan keenam tersangka sedang menjalani proses persiapan berkas untuk segera dilimpahkan ke Jaksa Penuntut Umum ( JPU) Belawan. “Keenamnya ditahan dan dititip di rutan sedangkan barang bukti berupa kertas rekap, HP dan uang 803 ribu masih disita,” katanya, Senin (3/8). Ditegaskan Kapolsek, pihaknya akan tetap memburu dan menyatakan perang terhadap setiap warga yang berusaha menghidupkan usaha perjudian seperti togel atau sejenisnya di wilayah hukum Polsekta Medan Labuhan.” Untuk yang satu ini tidak ada kompromi, semuanya akan diproses ke pengadilan,” kata Dony. (cre)

Bandar Togel Diancam 20 Tahun Penjara MEDAN (Waspada): Sampai saat ini bandar judi toto gelap (togel) A Giok, 60, warga Jl. HM Yamin, masih diperiksa secara intensif penyidik Unit Vice Control Sat I Tindak Pidana Umum (Tipidum) Direktorat Reskrim Poldasu. Dikatakan Kasat I Tipidum, AKBPYustan Alfiani, A Giok terancam dihukum 20 tahun penjara karena telah melanggar pasal 303 KUHP tentangjudi.“Tersangkamasihdiperiksaintensifdandiancamhukuman 20 tahun kurungan penjara karena melanggar pasal 303 KUH Pidana,” kata Yustan, Jumat (31/7). Sementara putri A Giok, Marina, 20, masih berstatus saksi. “Masih saksi, namun bila diketahui terlibat, putrinya tersebut kita jadikan tersangka,” ungkap Yustan. DijelaskanYustan, penggerebekan rumah A Giok berkat informasi warga menyebutkan, rumah tersangka kerap dijadikan bisnis togel. Berkat laporan itu petugas VC Poldasu melakukan pengecekan. Ternyata, laporan warga benar dan A Giok diringkus di dalam rumahnya berikut sejumlah barang bukti berupa 2 mesin fax, rekapan nomor togel yang sudah keluar, rekapan nomor togel, 5 HP, uang tunai dan sejumlah ATM. “Dari pengakuan tersangka, menjual togel melalui mesin fax. Uang hasil jual togel itu kemudian ditransfer melalui ATM. Tersangka juga mengaku sudah dua tahun melakukan bisnis itu,” kata Yustan. Tersangka juga mengaku memiliki sub agen dengan memberi 20 persen hasil penjualan. “Dari sini tersangka berhasil meraup omset ratusan juta tiap bulannya.” Sebelumnya, Kamis (30/7) malam sekira pukul 21:30, rumah di kawasan Jl. HM Yamin samping Bank Mestika digerebek polisi. Dari penggerebekan itu petugas mengamankan A Giok beserta sejumlah barang bukti. Juga diamankan putri A Giok, Marina diduga membantu ibunya menjalankan bisnis togel.(m11)

Pembobol Toko Grosir Rokok Diringkus MEDAN (Waspada): Reskrim Unit Jahtanras Poltabes Medan meringkus tersangka pembobol toko grosir rokok di Pancur Batu dalam penyergapan di Jalan Lintas Sumatera (Jalinsum) Tanjung Morawa, Sabtu (1/8). Selanjutnya tersangka SS, 47, sopir, warga Desa Bandar Labuhan, Tanjung Morawa, dijebloskan dalam sel tahanan Mapoltabes Medan. Kasat Reskrim, Kompol Gidion Arif Setyawan melalui Kanit Jahtranras, AKP Faidir, kepada wartawan mengatakan, tersangka melakukan aksinya 17 Januari 2009 dinihari. Dengan merental mobil Kijang Innova, tersangka bersama temannya mendatangi toko grosir milik M. Sitepu, 54, warga Jalan Djamin Ginting Gang Swadaya di Pancur Batu. Tersangka kemudian membuka paksa pintu toko menggunakan gunting besi besar, linggis. Setelah pintu terbuka, tersangka menyikat beberapa tin rokok yang ditaksir harganya mencapai Rp58 juta. Peristiwa ini kemudian dilaporkan korban ke Polsekta Pancur Batu. Selain di Pancur Batu, tersangka juga melakukan aksinya di wilayah hukum Polsekta Deli Tua. Polisi kemudian memburon tersangka namun tidak berhasil menangkapnya. Setelah diburu selama 7 bulan, akhirnya polisi menerima informasi, salah seorang tersangka berada di Jalinsum Tanjung Morawa.“Polisi kemudian menuju ke lokasi dan menangkap tersangka SS dan memboyongnya ke Poltabes,” jelas Faidir. (m39)

man heroin dari luar negeri ke Medan. Yang menjadi masalah, lanjutnya, ganja-ganja itu dikirim melalui paket titipan kilat bahkan melalui paket pos, karena mereka tidak melengkapi peralatan mendeteksi barang berbahaya seperti X-ray. “Jadi, surat saya kepada Dirut PT. Pos untuk meminta agar PT Pos Wilayah I dilengkapi peralatan itu,” ujar. Dia menilai semakin hari orang-orang yang mencoba mengirim barang terlarang antar pulau melalui paket pos semakin profesional. Seperti, petugas menggalkan11kgganjayangakan

dikirim ke Jakarta dengan penerbangan Garuda, Minggu (2/8) sore. Paket-paket pengiriman sudah mulai dilapisi kertas putih seperti kertas timah. “Saya juga heran, kenapa banyak sekali muncul penangkapan ganja di Medan, apakah ada gembongnya di sini,” ujarnya. Sementara mengenai heroin dari Malaysia, dia menyatakan keinginan untuk mengirim surat kepada bandara asal datang heroin. Masalahnya, kenapa di sana tidak begitu ketat pengawasan, sehingga mudah lolos ke Indonesia.

Ketika dia menjabat Kepala bidang keselamatan Bandara di Bandara Soekarno Hatta, Cengkareng,duatahunlalu,pihakBandara Changi Singapura komplain kepada Bandara Cengkareng, karena dua peluru dan pisau lolos ke sana. Karena Bandara Medan menjadi sasaran heroin dari luar negeri, kita berpeluang mengkomplain bandara asal heroin itu, ujar Endang seraya menambahkan salut kepada jajaran petugas Bea dan Cukai Bandara Polonia dapat menggagalkan heroin tersebut.(m32)

Perketat Pintu Masuk Pelabuhan-Bandara MEDAN(Waspada):Gerakan Anti Narkoba (GAN) Indonesia dan DPD Gerakan Masyarakat Anti Narkoba (GRANAT) Sumatera Utara mengatakan, negaranegara lain termasuk Malaysia sangat ketat mengawasi narkotika/psikotropika masuk ke negaranya. Namun terkesan agak longgar saat ke luar dari negerinya. Sinyalemen itu diakui Sekjen GAN Indonesia Zulkarnain NasutionyangjugaDirekturPusat Informasi Masyarakat Sumatera Utara (Pimansu) saat di temui di Medan, Jumat (31/7). “Saat ini sudah muncul tren baru atau perubahan kepada maraknya narkotika/psikotropika jenis shabu-shabu (SS) atau ‘Amphetamin Type Stimulant’ (ATS),” katanya. Menurut Nasution, jika selama ini orang berpikir lumbungnya ganja/narkotika adalah di Aceh, ternyata menurut amatan kita sudah terjadi perubahan kepada jenis SS belakangan ini dengan bermainnya bandar-

bandar narkoba di kawasan Sumut – Aceh – Malaysia. “Munculnya tren ini sejak bencana tsunami.” Nasution juga tidak menampikperihalbegituhebatnyanegara lain termasuk Malaysia melindungi negara dan bangsanya dari narkoba.Namunterkesanlonggar saat keluar. Apakah bentuk atau sifatnya transit atau memang sebagai produsen. Katanya, ini cukup banyak bukti seperti sebulan terakhir ini saja sedikitnya ada lima kasus masuknya SS ke Indonesia, khususnya Sumut dan Aceh. Belum lagi waktu lalu. Justru itu, lanjutnya, ini yang sangat perlu diwaspadai oleh segenap elemen di Sumut maupun Aceh dengan memperketat pintu masuk, seperti pelabuhan laut legal, bandara serta termasuk pelabuhan terbuka maupun illegal yang terbilang banyak di kawasan ini. Sekaitan itu, khusus di pelabuhan-pelabuhan resmi perlu kiranya Badan Narkotika Provinsi (BNP) serta Pemprovsu mem-

berikan peralatan deteksi yang canggih, sebab selama ini di pelabuhan laut dan udara masih berkategori kurang canggih. Menurut Nasution, pemerintah sudah perlu merevisi pasalpasal dalam Undang-Undang Nomor 5/1997 tentang psikotropika, yakni tidak ada hukuman mati kecuali hukuman yang ada adalah hukuman maksimal 15 tahun penjara. Artinya, SS bukan masuk Golongan I melainkan golongan II, sementara ganja dan ekstasi masuk golongan I dengan ancaman hukuman mati. Sementara itu, Ketua DPD Granat Sumut Hamdani Harahap yang juga sebagai praktisi hukum, menyebutkan, sinyalemen negara lain termasuk Malaysia sebagai produsen atau tempat transit, boleh-boleh saja. ’’Hal itu dibuktikan dengan sejumlah kasus tertangkapnya pembawa SS maupun ekstasi belum lama ini, umumnya mereka yang datang dari negeri jiran. Itu fakta, apakah tempat produksi atau transit.(m34)

Penembakan Terhadap Pelaku Perampokan Sesuai Prosedur MEDAN (Waspada): Kapoltabes Medan, Kombes Pol Drs. Imam Margono, menegaskan, penembakan terhadap pelaku perampokan berinisial AC, 42, warga Jalan Denai Medan, hingga kritis yang dilakukan ajudan Kapoltabes di Jalan Sutrisno simpang Jalan Ismaliyah Medan, sudah sesuai prosedur. “Penembakan terhadap pelaku kejahatan itu sudah sesuai prosedur. Dalam hal ini, anggotanya yang melakukan penembakan terhadap perampok itu tidak dikenakan sanksi karena tindakannyatersebutsudahbenar dan berdasarkan prosedur,” tegas Imam Margono, Senin (3/8). “Kalau saya saja yang berada di lokasi, saya akan menembak perampok itu. Karena tindakan perampok sudah mengancam diri petugas dengan cara mengancampakaisenjatatajam(sajam) sehingga harus dilumpuhkan,” terangnya.

Dijelaskan Imam, peristiwanya berawal, korban bernama Riki alias Acuah, 25, warga Jalan Thamrin Medan, sedang menunggu temannya di Jalan SutrisnoMedantepatnyadidepan PT Inti Prima Jaya Medan, sambil berhandpone. Tanpa disadari, tiba-tiba tersangka AC bersama temannya yang belum diketahui identitasnya menghampiri korban dan menodongkan sajam ke korban sambil mengambil handphone. Mendapat perlakuan tersebut, korban terkejut dan berusaha mempertahankan handphone miliknya sehingga terjadilah pergumulan antara mereka. Karena dua lawan satu, akhirnya tubuh korban terluka akibat terkena sayatan pisau. Disaat aksi gumul mereka, ajudan Kapoltabes Medan BrigadirSyaifulmelintasdiTempat Kejadian Perkara (TKP) melihat kejadian tersebut langsung ber-

henti dan berusaha menangkap kedua tersangka. Namun apa yang terjadi, tersangka AC langsung menodongkan pisaunya ke arah petugas dan mencoba untuk melukainya. Dengan sigap, ajudan Kapoltabes Medan itu langsung mengambil langkah mundur dan mencabut senjatanya dari selipan pinggang. Kemudian memberikan tembakan peringatan supaya pelaku menyerah. Pelaku bukannya menyerah malah menyerang petugas. Melihat kenekatan pelaku, polisi kemudian melakukan penembakan hingga tersangka AC tersungkur bersimbah darah. Sedangkan temannya berhasil melarikan diri. Kemudian tersangka AC dilarikankeRumahSakitBrimobdasu untuk mendapatkan perawatan medis atas luka tembak yang dialaminya. Sedangkan korban membuat pengaduan ke Mapoltabes Medan. (m39)

Hindari Razia Dua ABG Cedera Tubruk Angkot MEDAN (Waspada): Dua anak baru gede (ABG) mengendarai sepeda motor berbocengan cedera setelah menubruk angkot, ketika mencoba kabur dengan melawan arah menghindari petugas Polsekta Medan Baru yang sedangmelancarkanraziadiJalan Gatot Subroto depan Medan Fair Plaza, Minggu (2/8) dinihari. Selanjutnyakendaraankedua ABG itu dan sepeda motor seorang pria lainnya yang tidak

memakai helm melakukan kebut-kebutan, diamankan karena tidak bisa memperlihatkan SIM dan STNK. Pantauan Waspada di lapangan, Polsekta Medan Baru bekerjasama dengan petugas SatlantasPoltabesyangmenggelar razia rutin itu mengamankan puluhan sepeda motor yang sebagian besar tidak bisa memperlihatkanperlengkapansurat-surat kendaraannya seperti SIM dan

Waspada/Ismanto Ismail

PERIKSA RANMOR: Petugas Patroli Polsekta Medan Baru melakukan pemeriksaan terhadap sepeda motor dua ABG yang menubruk angkot karena menghindari razia di Jalan Gatot Subroto depan Medan Fair Plaza, Minggu (2/8) dinihari.

STNK. Razia di Jalan Gatot Subroto itulangsungdipimpinKapolsekta Medan Baru, AKP M Adenan AS, SH,SIK, dan Waka Polsekta Iptu Gunawan SH. Razia dilakukan terhadap sepedamotor,mobilpribadi,taksi, angkot, mobil boks berplat BK, BL, BM, B, dan lainny. Sedangkan sasarannya senjata api, senjata tajam, narkoba, pelaku perampokan, pencurian kenderaan bermotor dan buronan teroris Noordin M Top. Saat dilakukan razia terhadap angkot, para penumpang pria disuruh turun untuk dilakukan penggeledahan. Sedangkan kepada pengendara sepeda motor yang tidak membawa SIM danSTNKbahkantidakmemakai helm, langsung di tilang petugas Satlantas. Sementara kendaraan tanpa memakai plat nomor polisi (BK) yang mencurigakan diamankan di Mapolsekta Medan Baru. Kapolsekta Medan Baru mengatakan, razia yang digelar ini sasarannya narkoba, senjata tajam, senjata api, pelaku kejahatan. Razia yang digelar ini juga berkaitandenganpeledakanbom di Jakarta, untuk menciptakan kota Medan tetap kondusif. “Personelyangmelakukanraziaharus bersikap santun,” ujarnya. (m31)

Waspada/Rudi Arman

BARANG BUKTI: Kanit Judi/Sila Poltabes AKP Ronny Nicolas menunjukkan barang bukti dua unit mesin fex, 5 calkulator, 5 lembar kertas rekapan nomor togel, uang Rp 1.500.000 dan 3 buah HP yang diamankan dari kediaman tersangka, Senin (3/8).

Markas Togel Beromset Puluhan Juta Digerebek MEDAN(Waspada): Reskrim Uni Judi/Sila Poltabes Medan menggerebek markas judi toto gelap(togel)yangberomsetsetiap putaran mencapai Rp 20 juta di Jalan Pertempuran Medan, dan mengamankaniburumahtangga bernama A Hung, 68. Dalam penggerebekan itu, Ahin dan Amin (suami dan anak tersangka) berhasil kabur dan masih terus diburon. Kasat Reskrim Poltabes Medan, Kompol Gidion Arif Setiyawan, melalui Kanit Judi/ Sila, AKP Ronny Nicolas, Senin (3/8), kepada wartawan mengatakan, penggerebekan serta penangkapan itu dilakukan, Minggu (2/8) malam. Dijelaskannya, penangkapan berawal, petugas menerima

informasidarimasyarakatdiJalan PertempuranGangSekataMedan ada markas judi togel. Berdasarkan laporan tersebut, petugas langsung turun ke lokasi. Setibanya di lokasi, petugas curiga melihat gerak-gerik tersangka keluar masuk ke dalam rumah di Jalan Pertempuran Gang Sekata No.85 Medan. Kemudian petugas melakukan penggerebekan dan menangkap A Hung. Dari lokasi disita barang bukti berupa dua unit mesin fax, 5 kalkulator, 5 lembar kertas rekapan nomor togel, uang Rp 1.500.000 dan 3 unit HP. Sementara saat dilakukan penggerebekan, suami dan anak tersangka melarikan diri yang sebelumnya berhasil membakar

sebagian barang bukti seperti rekapan nomor togel. Kemudian tersangka beserta barang bukti diboyong ke komando untuk mendapatkan pemeriksaan lebih lanjut. Menurut Ronny, tersangka ini bukan bandar besarnya melainkanhanyasebagaipengumpul nomor rekap dan uang penjualan kupon togel untuk disetorkannya melalui transfer ke nomor rekening. “Tersangka setiap putaran mendapatkan penghasilan atau omset mencapai Rp 20 juta sekali putaran. Sekarang ini kami masih melakukan penyelidikan dan pemeriksaansekaligusmelakukan pengembangangunamembongkar bandar besar judi togel di kota Medan,” tegas Ronny. (m39)

Tekanan Pendukung Demo Anarki Pancing Sumut Rusuh Hakim Harus Beri Hukuman Setimpal Untuk Chandra MEDAN (Waspada): Ketua Ikatan Pelajar Nahdatul Ulama (IPNU) Kota Medan Tamrin Harahap menegaskan, aksi pendukung Protap jangan ngotot membela mereka para tersangka yang sudah berbuat anarki, terkait dengan aksi demo yang mengakibatkan terbunuhnya almarhum Ketua DPRD Sumut Abdul Azis Angkat. “Kalau para pendukung Protap tetap membela mereka dengan melakukan tekanantekanan seperti aksi setiap dilakukannyaprosespersidangan terdakwa, Sumut dikhawatirkan bisa rusuh,” ujarnya di Medan, Kamis (30/7). Harahap mengimbau mere-

ka agar tidak terlalu berlebihan, tetapi biarkanlah proses hukum berjalan sesuai prosedur hukum bukanmalahmelakukantekanantekanan yang bisa mempengaruhi putusan hakim. Dia juga meminta aparat berwajib agar dengan tegas menindak para demonstran yang melakukan aksi di PN setiap dilakukannya persidangan. Sebab hal itu merupakan tindakan yang tidak etis dalam proses hukum. “Apalagi ada oknum massa diduga membawa senjata tajam dalam lingkungan PN. Oknum yang membawa senjata tajam itu harus diberi sanksi tegas sesuai prosedur hukum,” tegasnya. Harahap juga berharap apa-

rat penegak hukum menetapkan hukuman yang setimpal yang dilakukan para pendukung Protap termasuk terhadap terdakwa yang juga Ketua Penggas Protap, Chandra Panggabean. Menurut Harahap, pihaknya tidakinginhakimtertekandengan upaya- upaya yang dilakukan oknumyangtidakbertanggungjawab. Apalagi kalau ada upaya hakim ingin mengkaburkan persoalan, maka kita siap mengkritisinya “Bapak hakim tidak perlu takut dengan mereka yang cobacoba melakukan tekanan, jika perlu kita juga siap menurunkan massa untuk mengawal proses hukum sesuai aturan main yang ada,” ujarnya.(m14)

Pensiunan Guru Minta PN Balige Tegakkan Keadilan MEDAN (Waspada): Seorang pensiunan guru, Humala DonganSipahutar,wargaJl.Menteng II Medan, meminta kepada majelis hakim Pengadilan Negeri (PN) Balige untuk menegakkan keadilan dalam menyelesaikan kasus yang menimpa anaknya Hasudungan Sipahutar (terdakwa-red) mantan Plt Camat Ajibata 2006. “Saya minta majelis hakim menegakkan hati nuraninya, karenaanaksayatidakmelakukan korupsi pada APBD Kec. Ajibata senilai Rp326.444.000,” ujar Sipahutar yang datang ke kantor Harian Waspada, Senin (3/8). Menurutnya, anaknya Hasudungan Sipahutar yang pernah menjabat Plt Camat Ajibata 2006 yangditahansejak27Januari2009 adalah korban. Karena, yang

melakukandugaantindakpidana korupsi adalah pemegang kas RolenSinaga(yangjugaterdakwared), tanpa sepengetahuan anaknya. Humala menuturkan, dari anggaran APBD senilai Rp326.444.000,- yang masuk ke rekening sepengetahuan Plt Camat dan Rolen Sinaga hanya sebesar Rp182.554.000,-. “Tapi uang selebihnya sebesar Rp 143.890.000,- diluar sepengetahuan Plt Camat. Cek tunai itu hanya diteken oleh pemegang kas yaitu Rolen Sinaga. Jadi anak saya tidak tahu. Anak saya hanya korban.” Selain itu, Humala melihat ada keganjilan di surat tuntutan JPU. “Pada halaman 2 dakwaan JPU menerangkan bahwa pencairan uang yang dilakukan

pemegangkasRolenSinagatanpa sepengetahuan Plt Camat. Tapi kenapa di halaman 34 pernyataannya berubah menjadi dilakukan sepengetahuan Plt camat,” terangnya sembari menunjukkan surat tuntutan tersebut. Untuk itu, Humala meminta kepada majelis hakim agar keteranganparasaksidipersidangan betul-betul menjadi pertimbangan mutlak. Dari puluhan saksiyangdihadirkanJPU,tambah Humala, tidak ada seorangpun yang memberatkan anaknya. “SayaharapkansupayaRolen Sinagabetul-betuldikenakanpasal sesuai ketentuan hukum yang berlaku. Lebih baik melepaskan seribu penjahat, daripada menahan satu orang yang tidak bersalah,” pesannya kepada majelis hakim PN Balige. (cmai)

Dua Jurtul Togel Diringkus MEDAN(Waspada):Duajuru tulis toto gelap (Togel) diringkus petugas Polsekta Medan Timur dari dua lokasi terpisah di Medan, Senin (3/8). Dari kedua tersangka, polisi menyita Rp527 ribu uang hasilpenjualan,3handphonedan beberapa lembar kertas rekap berisikannomor-nomortebakan. Kedua tersangka masingmasing Budi Prayetno, 30, warga Jalan Hitam dan Rafi Syahputra, 52, warga Jalan Prajurit Medan. Kapolsekta Medan Timur, AKPYatim Syahri Nasution, menjelaskan, tersangka Budi Prayetno ditangkap di Jalan Hitam ketika sedang memindahkan nomornomor tebakan via pesan singkat (SMS) yang terdapat di dalam handphonenya. “Dari tersangka Budi Prayetno, polisi menyita 2 HP, 2 lembar

kertas rekap dan uang Rp39 ribu,” sebut AKPYatim Syahri Nasution kepada Waspada. Sedangkan tersangka Rafi Prayetno ditangkap di dalam kamar rumahnya di Jalan Prajurit Medan Timur ketika sedang menulis nomor-nomor dari para pembeli. Dari tersangka, Rafi alias Fi’i, polisi menemukan beberapa lembarkertasrekapberisinomornomor tebakan. Nasution menyebutkan, sesuai pengakuan kedua tersangka diketahui nomor-nomor tebakan dan uang hasil penjualan Togel selanjutnya disetor kepada seorang agen yang identitasnya sudah diketahui petugas. Di tempat terpisah, warga Di Jalan Medan-Delitua Gang Damai dan Jalan STM Ujung Gang Sukateduh serta di Jalan Arda-

gusema meminta agar Kapolsekta Delitua menangkap para penjual Togel dan judi kopyok. “Kami meminta agar Kapolsekta Delitua menertibkan para penjual togel karena aktivitasnya sangat meresahkan warga,” sebut Edi kepada Waspada. Menurut Edi, selama ini praktik judi togel di Gang Damai dan Jalan Ardagusema semakin merajalela. Kanit Reskrim Polsekta Delitua, Iptu Hendrik, yang dikonfirmasi Waspada, Senin, mengatakan, akan segera menindaklanjuti informasi permainan judi togel tersebut. “Petugassegeraditerjunkanuntuk melacak keberadaan pengedar togel di ketiga lokasi tersebut,” jelas Hendrik. (cat)

Medan Metropolitan Pilkada 22 Daerah Tunggu Payung Hukum



Selasa 4 Agustus 2009

MEDAN (Waspada): Rencana menggelar pemilihan kepala daerah (Pilkada) secara serentak untuk 22 kabupaten dan kota di Sumatera Utara pada 2010 mendatang, masih menunggu payung hukum. Sebab Pemprovsu dan Komisi Pemilihan Umum (KPU) masih belum memiliki petunjuk berupaya payung hukum sebagai regulasi menggelar Pilkada serentak. Kepala Biro Otonomi Daerah Setdaprovsu Bukit Tambunan mengatakanhalituketikaditemui di ruang kerjanya, Senin (3/8). “Upaya untuk menggelar Pilkada serentak di 22 daerah itu masih menunggu adanya payung hukum dari Departemen Dalam Negeri,” ujarnya. Tambunan mengaku, secara prinsip Biro Otonomi Daerah siap menyukseskan pelaksanaan Pilkada serentak. Namun dengan catatan harus ada payung hukum untuk pelaksanaannya. “Pilkada serentak sudah pernah digelar pada 2004 lalu. Dan saat itu, ada payung hukum yangdikeluarkanDepdagri.Untuk 2010 nanti, soal payung hukum

itu mutlak harus ada. Kalau tidak, yah… tentu tak bisa dilakukan,” katanya. Rincian 22 daerah yang berpeluang menggelar Pilkada serentak itu, yakni Kota Medan, Kota Binjai, Kabupaten Serdang Bedagai, Kabupaten Tapanuli Selatan,KabupatenTobaSamosir, Kabupaten Labuhanbatu, KabupatenAsahan,KabupatenPakpak Bharat, Kota Pematang Siantar, Kabupaten Humbang Hasundutan, Kota Sibolga, Kabupaten Mandailing Natal, Kabupaten Samosir,KabupatenSimalungun, Kota Tanjung Balai, Kota Tebing TinggidanKabupatenTanahKaro. Di 17 daerah ini, masa jabatan Kepala Daerah (KDh)-nya

Mahasiswa Garda Terdepan Ubah Hak Demokrasi Rakyat MEDAN (Waspada): 11 tahun reformasi sejak 1998, mahasiswa, pemuda dan anak bangsa lainnya harus menjadi garda terdepan merubah hak-hak demokrasi rakyat. Mahasiswa juga harus turut meluruskan nilai-nilai reformasi serta mewujudkan cita-cita demokrasi. Ketua DPD Komite Nasional Pemuda Indonesia (KNPI) Kota Medan, Zulham Effendi Siregar, mengatakan itu pada pembukaan Konfercab Himpunan Mahasiswa Pemuda Alwashliyah (Himmah) Kota Medan di Aula Kampus B Universitas Muslim Nusantara (UMN) Jl. Garu 2, Medan, Rabu (29/7). Untuk itu, KNPI berharap mahasiswa kembali ke kampus secara utuh dan meningkatkan nilai-nilai akademis dan intelektualitas. “Karena ke depan kita akan menghadapi persoalan serta tantangan yang lebih kompleks,” kata Zulham berharap, apapun hasil Konfercab, merupakan hasil terbaik bagi kader Himmah, sehingga ke depan bersama KNPI dapat terus melakukan perjuangan sosial dan keumatan. “Konfercab hendaknya melahirkan ide-ide cemerlang yang nantinya bermanfaat bagi kampus, terutama mahasiswa,” hara Zulham. Konfercab kali ini dihadiri Sekda Kota Medan, Djulmi Eldin, Pembantu Rektor III UMN bidang kemahasiswaan, Kondar Siregar, Ketua Himmah Sumut, Alim Nur Nasution, Ketua GPA Medan, Mahrizal, Lurah Harjo Sari, Rodjob Hasibuan, dan para pimpinan Ormas se-Kota Medan. Sekda Dzulmi Eldin berharap melalui Konfercab dapat melahirkan sosok terbaik dalam menata organisasi, serta dapat menjalankan visi, misi organisasi sesuai amanat AD/ART organisasi. Pada Konfercab itu, Abdul Rahim Lubis terpilih secara aklamasi sebagai Ketua Himmah Kota Medan periode 2009-2011. Konfercab diikuti 14 peserta dari komisariat ditambah satu suara dari DPD Himmah Sumut. (m11)

berakhir antara Juli, Agustus, September, Oktober, Nopember dan Desember 2010. Bila Pilkada serentak digelar, maka periodesasi jabatan KDh-nya tidak bisa dikurangi dari lima tahun sejak tanggal pelantikan. “Contohnya Kota Medan. PelantikanAbdillahdenganRamli

Lubis sebagai wali kota dan wakil wali kota yang kini nonaktif itu dilakukan pada 19 Juli 2005 hingga19Juli2010.Jadi,kalaupun digelar Pilkada serentak yang waktunya dipercepat, tentunya periodesasi jabatan keduanya harus sampai kepada masa akhir tugas keduanya. Tidak bisa diku-

rangi atau ditambah,” bebernya. Sedangkan lima daerah lain yang juga berpeluang menggelar Pilkada serentak pada 2010 nanti merupakandaerahhasilpemekaran, yakni Kabupaten LabuhanbatuUtara,LabuhanbatuSelatan, Nias Utara, Nias Barat dan Kota Gunung Sitoli. (m19)

Sistem Penyelenggaraan Pilkada Perlu Diperbaiki MEDAN (Waspada): Pelaksanaan Pilkada selama ini dinilai cenderung hanya menghabiskan anggaran dalam jumlah besar, namun tidak berkualitas. Karena ituperluadanyaperbaikansistem perundang-undangan penyelenggaraan Pilkada. “Berdasarkan pengalaman selama ini, Pilkada selalu banyak menyisakan masalah. Selain menimbulkan gugatan hukum, Pilkada juga tidak jarang menyisakan konflik di masyarakat. Karenaituapabilasistemnyatidak diubah, pasti akan menimbulkan masalah baru, seperti apatisme dan biaya-biaya,” kata Anggota Komisi A DPRDSU, Abdul Hakim Siagian kepada Waspada, Senin (3/8). Siagian mengatakan, perbaikan sistem aturan perundangundangan memang membutuhkan waktu yang panjang. Namun hal ini sangat penting untuk perbaikan demokrasi ke depan. Siagian menilai, pelaksanaan Pilkada langsung selama kurang lebih lima tahun ini ibaratnya hanya memindahkan permasalahan.Sebab,jikasistempemilihan kepala daerah dilakukan DPRD

dinilai banyak masalah, maka hal yang sama juga ditemukan pada Pilkada langsung. Faktanya, sejumlah pelanggaran yang termasuk tindak pidana pemilu, seperti politik uang menjadi hal yang biasa dalam Pilkada. Padahal, praktik seperti ini tidak baik karena dapat merusak tatanan budaya masyarakat. “Politikuangjugamengakibatkan biaya tinggi seolah menjadi kewajiban dalam Pilkada. Jadi, biaya ekonomi dan politiknya tidak sebanding,” katanya Dia menambahkan, mengingat hampir di seluruh daerah di Indonesia akan melaksanakan Pilkada dalam waktu dekat, maka pemerintah harus segera merubahUUPilkada.Untuksementara, mereka dapat membuat Perppu baru untuk menjadi landasan pelaksanaan Pilkada. Secara terpisah, pengamat politik, Dadang Darmawan menilai salah satu poin penting dari regulasi peraturan Pilkada yang harus diubah adalah soal Panitia Pengawas (Panwas) yang harus diseleksi oleh Komisi Pemilihan Umum (KPU). Menurut Dadang, untuk


BERI ARAHAN: Ketua MPW PP Sumut, Anuar Shah, memberikan arahan saat menjadi inspektur upacara bendera di SMUN 5 Medan, Senin (3/8).

menjaga keindependenan, Panwas Pilkada sebaiknya tidak diseleksi oleh KPU. Tapi harus diseleksi langsung oleh Badan Pengawas Pemilu (Bawaslu) yang saat ini sudah permanen. “Tidak mungkin lembaga pengawas direkrut oleh lembaga yang akan diawasi dalam Pilkada 2010 mendatang. Ini akan mempengaruhi indepedensinya sebagai lembaga pengawas,” katanya. Untuk itu lanjut Dadang, peraturan mengenai perekrutan dan seleksi Panwas sebaiknya dirubah. Regulasi yang dibuat DPR agar direvisi untuk memperjelas keberadaan dari Panwas itu sendiri. Menurutnya masih memungkinkan direvisinya peraturan perundang-undangan yang mengatur tentang seleksi Panwas Pilkada. Mengingat masa waktu tahapan Pilkada belum dimulai. Selain itu, kata Dadang, anggaran untuk Panwas juga harusdibuatterpisahyangselama ini include (masuk) dengan anggaran KPU. Hal tersebut dimaksudkan agar tidak selalu bergantung pada KPU. (h11)

Menhut Minta Eksekusi Register 40 Sebelum 17 Agustus MEDAN (Waspada): Tim PidanaKhusus(Pidsus)Kejaksaan Tinggi Sumatera Utara (Kejatisu) melakukan pertemuan dengan unsur Muspida, Selasa (28/7), terkait akan dilakukannya eksekusi lahan register 40 di kawasan Padang Lawas Utara (Paluta) Pertemuanberlangsungsekira pukul 14.00 di gedung Kejatisu. Hadir Bupati Paluta Bachrum Harahap, Kapolres Tapsel AKBP Pranyoto, pejabat Poldasu, Kepala Biro Hukum Setdaprovsu Abdul Djalil, Asisten Pemerintahan/TataPrajaSetdaprovsuHasiholan Silaen, staf Dinas Kehutanan, Staf Badan Konservasi Sumber Daya Alam (BKSDA) Sumut.

Asisten Pidana Khusus Kejatisu Agoes Djaya menyatakan, pertemuan itu merupakan tindaklanjut dari hasil pertemuan Menteri Kehutanan dengan Jaksa Agung. Dalam pertemuan sudah disepakati eksekusi hanya dilakukan dalam bentuk pengalihan manajemen. “Kita sudah menyampaikan hasil keputusan pertemuan Menhut dan Jaksa Agung. Belum diputuskan soal tempat eksekusi akan dilakukan di mana. Ada yang menyampaikan di Medan, ada yang ingin di lokasi (Paluta),” ujarnya. Menurut Agoes, keinginan untuk mengeksekusi hutan negara yang berubah fungsi

menjadi kebun sawit itu lebih kondusif bila dilakukan di Medan. Namun, bupati Paluta menolak hal itu takut terjadi polemik di masyarakat. “Makanya,hasilininantiakan dibicarakanlagidenganpimpinan. Sebagai bagian dari Muspida kita berkewajibanmenyampaikanhal ini, tetapi tetap keputusan di tangan kami (Kejatisu). Namun, pilihannya di mana yang paling baik,” ujarnya. Agoes mengatakan, dalam pertemuan itu belum juga bisa diputuskan jadwal eksekusi. Namun, sesuai permintaan Menhut pelaksanaan eksekusi diupayakan sebelum 17 Agustus.(h05)

Lulusan FK Dan FKG Unpri Diakui Di Malaysia


KONFERCAB: Sekda Dzulmi Eldin (tengah), Zulham Effendi Siregar (kanan) dan Alim Nur Nasution saat menghadiri pembukaan Konfercab ke-12 Himmah Kota Medan, Rabu (29/7).

Kodam Peringati Israk Mikraj 1430 H MEDAN (Waspada): Prestasi apapun yang ingin diraih tidak akan diperoleh tanpa kerja keras, keuletan dan ketangguhan mental yang prima disertai ketawakalan dan kedekatan diri padaYang Maha Kuasa. Hal itu disampaikan Irdam I/BB, Kolonel Inf. Erro Kusnara, pada peringatan Israk Mikraj Nabi Besar Muhammad SAW di Balai Prajurit Makodam I/BB, Kamis (30/7). Irdam mengatakan, hal yang sangat esensial dari peristiwa Israk Mikraj adalah diterimanya perintah ibadah shalat lima waktu dalam sehari semalam karena shalat merupakan fundamental dan menjadi tolak ukur menentukan kualitas ketaqwaan seseorang. ’’Oleh karena itu shalat hendaknya menjadi sumber kekuatan moral yang dapat mencegah seseorang dari berbagai perbuatan keji dan mungkar. Oleh sebab itu sebagai umat Islam mari belajar terusuntukmenggalihikmahperingatanIsrakMikrajNabiMuhammad SAW guna menumbuhkan motivasi dan inspirasi baru dalam upaya meningkatkan keimanan dan ketaqwaan keluarga besar Kodam I/BB dalam mendukung keberhasilan tugas pokok,’’ katanya. Peringatan Israk Mikraj tersebut diisi ceramah oleh Al-Ustadz Drs. Haji Ridwan Hamid. Dalam ceramahnya mengemukakan pentingnya kaum Muslimin bersih diri dari niat dan dengki sesama, karena hidup ini harus sabar menghadapi cobaan yang diberikan Allah SWT, seperti takdir, hikmah dan musibah semua itu karena datangnya dari Allah SWT. Sebelumnya, Kabintaldam, Letkol Caj H. Irwan Nuh Batubara, dalam kata pengantarnya mengatakan, Israk Mikraj ini sebagai momentum penting untuk meningkatkan keimanan dan ketaqwaan bagi para prajurit dan keluarga besar Kodam I/BB. Sedangkan Kapendam, Letkol Caj Dr.H. Asren Nasution, MA menambahkan, memperingati hari besar keagamaan tidak hanya rutinitas dan simbolis saja akan tetapi hendaknya dapat menambah motivasi dan inspirasi baru dalam upaya meningkatkan keimanan dan ketaqwaan. Acara itu dihadiri para Asisten Kasdam I/BB, Kabalak Dam I/BB, perwakilan masing-masing satuan dalam wilayah Medan yang terdiri dari para perwira, bintara, tamtama dan PNS serta ibuibu Persit PD I/Bukit Barisan.(m34)

MEDAN (Waspada): MahasiswalulusandariFakultasKedokteran dan Fakultas Kedokteran Gigi Universitas Prima Indonesia (Unpri)mendapatpengakuandari Malaysia dan dapat berpraktek di Malaysia, karena baik dari segi kurikulummaupunprosesbelajar mengajar di Unpri telah disesuaikan dengan standart kompetensi seorang dokter dan dokter gigi di Malaysia. HaltersebutdikatakanDekan FKG, Prof. drg. Monang Panjaitan, MS didampingi Ketua BPH Yayasan, Tommy Leonard SH, DekanFK,dr.FirmanSitepu,Sp.A, Wakil Dekan I FKG, drg. Suci Erawaty, MS, Wakil Dekan II FK, dr. FreddyTambunan, Sp.PA dan staf pengajar, Ir. Bakti Alamsyah, MT, kepada wartawan di kampus tersebut, Jumat (31/7). Prof. Monang menyebutkan, dari kunjungan pada 27-29 Juli 2009 ke Malaysia, Unpri telah melakukan kerjasama dengan Fakultas Perobatan, Fakultas Pergigian, Fakultas Kasihatan dan Fakultas Komputer di Universiti Sains Malaysia (USM) dalam hal penyesuaiankurikulum,pertukaran mahasiswa dan dosen maupun dalam penelitian. Dari hasil pertemuan tersebut telah disepakati beberapa hal yakni lulusan Fakultas Kedokteran dan Kedokteran Gigi Universitas Prima Indonesia diakui dan dapat berpraktek di Malaysia, untukFakultasTeknologidanilmu Komputer program studi strata satu (sarjana) akan membuka program sandwich dimana perkuliahan untuk 2 tahun pertama di USM Malaysia dan 2 tahun selanjutnya di Unpri sehingga lulusan dari program tersebut akan mendapatkan dua gelar (double degree) dan memiliki kemampun berstandart internasional. “Program ini tentunya merupakan kerja keras dan prestasi bagi FakultasTeknologi dan Ilmu Komputer Unpri karena dapat diakui di dunia pendidikan berskala Internasional,” tuturnya. Dekan FK dr. Firman Sitepu, Sp.A menambahkan, Unpri dan USM telah menjalin kerjasama

di berbagai hal seperti pertukaran pelajar, pertukaran dosen dan pendidikan lanjutan staf pengajar S2 dan S3, pertukaran dosen, penelitian maupun misi kebudayaan, USM yang masuk posisi ke2 universitas terbaik di Malaysia ini dalam waktu dekat akan melakukan kunjungan serta mengadakanpameranhasilkaryamahasiswa Unpri-USM di kampus Unpri Jl. Sekip Medan. UnprimerupakanPerguruan Tinggi Swasta yang sangat berkembang pesat khususnya di Sumatera Utara berkat komitmen KetuaYayasan Universitas Prima Indonesia dr .I.Nyoman Ehrich Lister ,M.Kes, AIFM dalam memajukan dunia pendidikan di Indonesia, beberapa hal yang menjadi tolak ukur keberhasilan Unpriadalahlulusannyayangsaat inisudahtersebardiberbagaidaerah dan menunjukkan kemampuan maupun kompetensi di bidangnya. Selainitu,lanjutFirman,Unpri merupakan perguruan tinggi swasta yang memiliki guru besar (Profesor ) terbanyak Di SumutNAD, pengembangan dua kampus baru yaitu terletak di Jalan Sekip dan Jalan Danau Singkarak, dan UNPRI juga membuka Sekolah TK-SD-SMP dan SMA Global

Prima di Jalan Brigjen Katamso, serta dalam waktu dekat UNPRI juga membuka program studi S-2 Magister Kesehatan. Sementara itu, Ketua BPH Yayasan Tommy Leonard menambahkan, Unpri akan melakukan kunjungan lanjutan 8 Oktober 2009 mendatang untuk memantapkan kerjasama sekaligus untuk menghasilkan kesepakatan aplikasi secara nyata. Program ini diharapkan dapat meningkatkan kualitas mahasiswa Universitas Prima Indonesia. Direncanakan dalam waktu dekatini,Unprijugaakanmenjalin kerjasama dengan Universitas di Australia, China dan Singapura. “Dengan banyaknya kerjasama dengan universitas di luar negeri makaalumniUnpriakanmenjadi lulusan berkualitas dan profesional yang dibekali kompetensi keahliannya,” ujar Tommy. Sedangkan mengenai penerimaan mahasiswa baru Gelombang III, pendaftaran dibuka mulai 21 Juli hingga 20 Agustus 2009, sedangkan ujian seleksi masuk pada 22 Agustus 2009. Daya tampung untuk penerimaan mahasiswa baru Fakultas Kedokteran dan Kedokteran Gigi Unpri, masing-masing hanya 50 orang. (m41)


Dekan FKG UNpri Prof. drg. Monang Panjaitan, MS (tengah) didampingi Ketua BPH Yayasan Tommy Leonard SH, Dekan FK dr. Firman Sitepu, Sp.A, Wakil Dekan I FKG drg. Suci Erawaty, MS,Wakil Dekan II FK dr. Freddy Tambunan, Sp.PA dan staf pengajar Ir. Bakti Alamsyah, MT.

Ketua PP Sumut Irup Di SMUN 5 Medan (Waspada): Ketua Majelis Pimpinan Wilayah Pemuda Pancasila Sumatera Utara (MPW PP Sumut), Anuar Shah, menjadi inspektur upacara bendera di SMU Negeri 5 Medan, Senin (3/8). Dalam arahannya, tokoh pemudayangakrabdisapaAweng ini memaparkan tentang ketokohanparapejuangkemerdekaan dan pejuang pendidikan. Aweng juga memotivasi para siswa harus mampu memposisikandirisebagaigenerasimuda yang andal dalam mengisi program pembangunan di masa datang, sebagai tonggak estafet melanjutkan pembangunan bangsa dan Negara. “Pendidikan di jenjang SMU inilah para siswa mulai berpikiran nasionalis dan kebangsaan. Jadi

manfaatkanlah masa pendidikan SMUsebagaidasargenerasimuda untuk memulai berpikir positif dalam membangun bangsa dan negara,” kata Aweng. Pada kesempatan itu Aweng menyatakan, MPW PP Sumut memberikan beasiswa untuk 10 siswa kelas 10, 11 dan 12 dari keluarga yang kurang mampu dan berprestasi. Beasiswa dalam bentukpembiayaanuangpendidikan, pakaian, buku dan kebutuhan lainnya,hinggajenjang kelulusan. Diamenambahkan,MPWPP Sumut juga akan memberikan kesempatan kepada para pelajar untuk menjadi anggota Pemuda Pancasila, yang akan diarahkan padalembagaSatuanMahasiswa Dan Pelajar. KepalaSMUN5Medan,Salmi Effendi, mengatakan kehadiran

Ketua MPW PP Sumut dan rombongan itu sebagai inspektur upacara di sekolah tersebut, merupakan program kerja pendidikan di SMUN 5 Medan. Menurut Salmi, para pendidik sepakat mengundang tokohtokoh untuk memberikan motivasi kepada siswa. “Targetnya menjadikan siswa memiliki ilmu pengetahuan dan teknologi dengan berlandaskan iman dan taqwa,” ujarnya. Dari kalangan PP hadir pada upacara bendera ituWakil Ketua I MPW PP Sumut, Boyke Turangan,Wakil Ketua II, Firdaus Nasution, Sekretaris, Dahroel Thamin, Kordinator Pokja Humas MPW PP Sumut, Idrus Djunaidi, serta sejumlah pengurus lainnya. Juga hadir segenap guru dan pegawai SMUN 5 Medan. (m08)

Personel TNI AU Jaga Ketat Bandara Polonia Hari Bhakti TNI AU Ke-62 Jamu Anak Yatim MEDAN (Waspada): Guna mencegah teror bom, lebih kurang 209 personelTNI AU disebar untuk menjaga ketat Bandara Polonia Medan dari teror bom. Bahkanmerekayangditugaskan secara bergantian di jajaran Angkasa Pura (AP) itu berlangsung sebelum Pemilu 2009. Kemudian, pengamanan kembali ditingkatkan setelah bom mengguncang dua hotel berbintang di Jakarta 17 Juli lalu. Setiapcelahpadabagiansteril bandara maupun kawasan Lapangan Udara (Lanud) Kelapa Sawit ditutup. Komandan Lanud Medan Kol.PnbTataEndratakamengatakan, kemarin, dalam pengamanan objek vital ini, petugas sudah ada menemukan peneror bom melalui SMS. “Tersangkanya sudahdiserahkankepadaPoltabes karena penyidikan itu wewenang polisi,” ujarnya menjawab pertanyaan wartawan seusai menghadiri puncak Hari Bhakti TNI AU ke-62 di Lanud Medan bersama Pangkohanudnas III Medan

Marsma TNI Chaerudin Ray, SE dan sejumlah perwira, Rabu (29/ 7) pagi. Belum Ada Kapal Asing Bahkan Pangkohanudnas III Medan Marsma TNI Chaerudin Ray yang menjadi Irup upacara menjawab tentang pengawasan wilayah pertahanan udara III menegaskan, pihaknya terus memantau kapal-kapal asing mencoba memasuki wilayah Indonesia dari Sabang hingga ke Jambi. Hanudnas III yang berpangkalandiMedan,lanjutnya,selama 24 jam terus menerus memantau gerak-gerikkapal-kapalasingyang mencoba memasuki wilayah Indonesia. Namun hingga akhir Juli 2009, masih nihil. Begitupun menyangkut alat utama sistim persenjataan (alutsista),diamenilaisemuakebijakan Mabes TNI, sementara di Medan hanyamemanfaatkansaja.“Seberapa pun canggihnya peralatan seperti di luar negeri, jika personelnya tidak disiplin dan tidak memiliki sumber daya manusia, percuma saja Alutsista yang

canggih itu,” ujarnya. Sementara itu, Kepala Staf TNI AU Marsekal TNI Subandrio dalamkatasambutantertulisyang dibacakan Pangkohanudnas III, antara lain, meminta jajaran TNI AUdapatmempertahankannilainilai luhur seperti pelopor TNI AU,merupakannilaibersifatkekal, harus dikembangkan dan tumbuh subur dalam diri setiap prajurit TNI AU. Nilai-nilai luhur itu tetap relevan dan tidak pernah rentan oleh kondisi lingkungan strategis yang terus berkembang sesuai dengan dinamika tata hubungandalamkehidupanbermasyarakat,berbangsadanbernegara. Ditegaskan, pada masa mendatang tantangan akan semakinberatdankompleksseiring dinamika kondisi lingkungan strategis yang terus berkembang dengan cepat. Sementara itu, acara Hari BhaktiTNI AU ke-62 itu diadakan silaturahim dengan para purnawirawan maupun warakawuri, dilanjutkan pemberian bingkisan kepada anak yatim. (m32)

Dibutuhkan Perda Atasi Sarjana Pengangguran MEDAN (Waspada): Sumatera Utara membutuhkan Peraturan Daerah (Perda) yang berisikan solusi untuk mengatasi semakin meningkatnya jumlah sarjana yang menganggur usai menyelesaikan pendidikannya di perguruan tinggi. “Hal ini sekaligus untuk mendukung realisasi program pemerintah pusat yang ingin menciptakan 2 persen pengusaha di tanah air,” kata anggota Komisi E DPRDSU,UsmanHasibuan,SAg, Minggu (2/8). Usman merasa perlu menyampaikan usulan itu, karena prihatin mendengar banyaknya keluhan orangtua dan para sarjana yang baru tamat kuliah, tidak juga berhasil mendapatkan pekerjaan,padahaltelahmengeluarkanbanyakuanguntukkeperluan

kuliahnya. “Dalam konteks demikian, diperlukan kebijakan lokal yang dituangkan ke dalam sebuah Perda untuk membuat semacam alternatif solusi memberikan jalan keluar bagi para sarjana menganggur itu supaya bisa mendapatkan pekerjaan,” ujarnya. Dikatakannya,didalamPerda itumisalnyadinyatakan;bagipara sarjana yang baru saja menyelesaikan studi 1 hingga 3 tahun, diberikan bantuan modal usaha misalnya antara Rp 20 hingga Rp 50 juta, dengan agunan ijazah asli para sarjana tersebut. Dengan adanya peluang seperti ini, kata Usman, mereka yang baru saja meraih gelar sarjana itu, tidak lagi melulu hanya berpikirhendakmelamarmenjadi

pegawai negeri sipil (PNS), yang ketersediaannya selalu tidak sebandingdenganjumlahpeminat. “Dana pinjaman untuk mengatasi para sarjana menganggur ini, bila telah disepakati dapat ditampung di APBD Sumut, dengan cara dititipkan melalui PT Bank Sumut sebagai institusi yang akan mengatur teknis pengalokasian pinjaman kepada para sarjana baru tersebut,” paparnya. MelaluiPerdatersebut,berarti Sumuttelahmelakukanterobosan baru dalam menciptakan peluang tumbuhnya UKM dan para enterprenuer baru di daerah ini. Mengapa para sarjana yang kita usulkan diberi pinjaman usaha. “Pasalnya menjadi pengusaha pun dibutuhkan kecerdasan,” sebutnya.(h11)

Kajari T. Balai Dan Tebing Tinggi Diganti

Kajati: Tuntaskan Segera Kasus Korupsi Yang Ditangani MEDAN (Waspada): Kepala KejaksaanTinggiSumut(Kejatisu) membantah pergantian Kepala Kejaksaan Negeri (Kejari) T. Balai, Asahan, Miduk Hutapea, SH, terkait persoalan kasus dugaan korupsi melibatkan orang nomor satu di daerah itu. “Pergantian ini, murni pengembangan bakat dan karir dari pejabatdilembagaKejaksaandan sebagai penyegaran serta peningkatan semangat kerja,” kata Kajati Sutiyono menjawab Waspada usai acara serahterima jabatan, Senin (3/8), di gedung Kejatisu Medan. Mutasi jabatan ini, lanjut Sutiyono, tidak ada kaitannya dengan kasus yang dia tangani

saat memimpin Kejari T. Balai. Kasusdugaankorupsimelibatkan Walikota T. Balai, misalnya ditangani dengan baik. “Saat ini kami tinggal menunggu surat izin dari presiden untuk memeriksa walikota tersebut, “ tegas Sutiyono. Kata Sutiyono, jabatan Miduk Hutapea diserahkan kepada Herry Sunaryo, SH yang sebelumnya bertugas di Kejaksaan Tinggi Kepulauan Riau (Kepri). Sementara Miduk Hutapea dipromosikan jadi Asisten Pengawasan di Kejati Sulawesi Utara, Manado. Selain itu, tambah Sutiyono, jabatan Kepala Kejari Tebing TinggiDelijugadiserahterimakan dari pejabat lama, Khairul Aswan

kepada Lumumba Tambunan. Sedang Khairul Aswan dipercayakan menjabat Asisten Perdata dan Tata Usaha Negara (Datun) di Kejati Sulawesi Tenggara, Kediri. Sutiyono menegaskan, agar Kajari Tanjung Balai dan Tebing Tinggi Deli yang baru segera bekerja menuntaskan kasuskasus korupsi yang sedang ditangani baik dalam tahap penyelidikan dan penyidikan. Menurutnya, para pejabat baru agar mengoptimalisasi penanganan dan penyelesaian tugas dan fungsi kejaksaan. Hingga semua kasus-kasus yang masuk diyakini bisa dituntaskan dengan baik. (h05)



WASPADA Selasa 4 Agustus 2009

Sipirok Ibukota Tapanuli Selatan nanti bisa saja Tapanuli Selatan mekar lagi. Karena itu mungkin lebih sesuai pula bila perkantoran pemerintahan Tapanuli Selatan ditempatkan di Arse Jae Dolok – Huta Padang (pemekaran dari Sipirok). Selain pertengahan, lokasi, areal, dan perhubungan juga akan sangat mendukung. Itu contoh! Pertimbangan untuk memproyeksikan kota Sipirok menjadi pusat perdagangan, memang sudah sejalan dan terprogram dalam RUTR Kota Sipirok dari Ibukota Kecamatan menjadi Ibukota Kabupaten Angkola Sipirok tahun 1993/1994. Sipirok dirancang merupakan segitiga antarwilayah, yakni Sipirok (Angkola Sipirok) – Rantau Prapat (Labuhan Batu) - Garoga (Tapanuli Utara). Di samping Jalur lintas Provinsi, juga sebagai :

bagaimana penjelasan pihak Bappeda Tapsel. Jadi berdasarkan RUTR yang ada, jika kita memandang ke depan, adalah lebih tepat apabila perkantoran itu di Arse Jae Dolok – Huta Padang. Karena pemekaran Tapanuli Selatan (induk) sangat dimungkinkan ke Batang Toru, sedangkan yang akan datang adalah Angkola Sipirok sebagai cita-cita luhur masyarakat sejak awal. Boleh kita berkaca ke Amerika Serikat, pusat perdagangan adalah New York dan memang lebih dikenal di telinga ketimbang Washington, padahal sebenarnya adalah pusat pemerintahan. Kuala Lumpur sebagai ibukota Malaysia, hanyalah merupakan pusat bisnis, sedangkan pusat pemerintahan (kantor Perdana Menteri beserta kabinetnya) terdapat di Putra Jaya yang berjarak lebih kurang 50 km dari Kuala Lumpur, dapat dikata tidak dikenal orang, apalagi belum pernah berkunjung kesana.

Jaringan jalan Garoga – Sipirok Jaringan jalan Rantau Prapat – Sipirok (melalui Simangambat-Sipagimbar). Itu semua dirancang adalah untuk mewujudkan Tujuan Perencanaan Pembangunan yang dimaksudkan sebagai: Pemerataan pengembangan dan pertumbuhan ekonomi yang memungkinkan diperluasnya kesempatan kerja untuk meningkatkan taraf hidup masyarakat. Pemanfaatan Ruang secara Optimal dengan Potensi SDA, SDM, dan Sumber Daya Buatan. Terciptanya kehidupan dan penghidupan yang aman, tertib, lancar, sehat, dan efisien dalam lingkungan yang serasi dan daya dukung yang lestari. Penempatan perkantoran yang dipolemikkan misalnya di Maragordong dengan alasannya, di Tolang, bahkan di Arse Jae Dolok - Huta Padang sekalipun tak ada masalahnya, karena semua ada pertimbangan dan alasan masing-masing, bukan hanya pertimbangan sekarang tetapi yang berwawasan hingga waktu jangka panjang kedepan. Saat ini direncanakan akan dibangun di sekitar Desa Kilang Papan, Danau Situmba, Janji Mauli dan Desa Tolang. Alasan utama dikatakan strategis hanya dilihat sekadar letak saja, posisi pertengahan dihubungkan dengan jarak tempuh dari/ke kecamatan-kecamatan di Tapanuli Selatan. Sisi lain, status lahan, sumber air, perkembangan pembangunan, akses ke dalam maupun ke luar kabupaten, dan lain-lain, apakah mendukung belum diketahui secara mendalam. Dasar pertimbangan itu pun perlu dan harus mengacu kepada RUTR sekarang se-

Kerugian Masyarakat Secara moral masyarakat Sipirok telah menerima hasil pemekaran meskipun bukan dengan nama Angkola Sipirok. Karena itu hendaknya tidak lagi dikecewakan dengan persoalan pemindahan perkantoran. Tidak cukup fasilitas, sebenarnya bukanlah alasan. Kenapa kabupaten baru seperti Paluta dan Palas, atau kabupaten baru mekar lainnya bisa. Kantor camat, kelurahan, dan balai-balai yang ada dapat dimanfaatkan. Jangan lupa, bukankah dalam opsi Bupati yang menekankan agar Kabupaten induk Tapanuli Selatan berpusat di Sipirok karena Tapanuli Selatan (Angkola Sipirok) memiliki DP3 yang lebih lengkap menurut bapak Bupati ? Sipirok adalah opsi Bupati Ongku P. Hasibuan. Kalau pemindahan perkantoran diperlambat, bagaimana pula penganggaran perkantoran tahun 2007 dan 2008, sedangkan tahun anggaran terus beralih ? Memang bukan hanya masyarakat Sipirok yang kecewa dengan berlarutnya realisasi perpindahan Ibukota dan perkantoran Pemkab Tapanuli Selatan ini. Dari sisi kesejahteraan masyarakat, sepanjang waktu sejak Undang-Undang tentang penetapan Sipirok sebagai ibukota Tapanuli Selatan, sudah berapa persen seharusnya pertumbuhan ekonomi kota Sipirok yang terabaikan? Berapa PNS/Karyawan yang terlibat kegiatan ekonomi di daerah itu, berapa besar pengaruh positif makro ekonomi hubungan keluar dan ke dalam daerah. Sebaliknya sudah berapa besar kerugian masyarakat/daerah Sipirok karena ketidakjelasan Ibukota

Oleh Drs. H. Syamsul Bahri Ritonga, M.Si



Semoga Putusan MK Tidak Menambah Bingung Publik


ahkamah Konstitusi menurut jadwal Selasa (hari ini) mulai menyidangkan sengketa Pilpres yang diajukan Megawati - Prabowo dan Jusuf Kalla – Wiranto. Kedua pasang Capres dan Cawapres itu menuntut ‘’Pilpres ulang’’ terkait banyaknya permasalahan yang terjadi sejak pendaftaran pemilih (DPT) hingga hasil penghitungan suara yang dimenangkan pasangan Capres Susilo BambangYudhoyono (SBY) dan Cawapres Boediono dengan perolehan 73,8 juta suara (60,80 persen), sedangkan Megawati – Prabowo dengan 32,5 juta suara (26,79 persen), dan Jusuf Kalla –Wiranto dengan 15,08 juta suara (12,14 persen). Berdebar-debar jantung kedua pasangan Capres dan Cawapres tersebut berikut tim sukses dan basis massanya menunggu hasil putusan MK; apakah akan mengambulkan permohonan mereka atau menolaknya, atau mengabulkan sebagian saja. Misalnya diadakan Pilpres ulang di sejumlah daerah yang nyata-nyata terjadi kecurangan dalam proses Pilpres. Kalau gugatan Pilpres yang dilakukan serentak dua pasangan kalah itu dikabulkan, maka besar kemungkinan SBY – Boediono kena diskualifikasi sehingga pasangan Mega – Prabowo menjadi nomor satu dan JK –Wiranto menjadi nomor dua, sedangkan SBY – Boediono menjadi nomor tiga.Tapi, menurut hemat kita, kecil kemungkinan pasangan SBY – Boediono sampai dikenakan diskualifikasi, mengapa? Sebabnya, perolehan suara SBY – Boediono begitu besar (mutlak) sehingga tidak diperlukan putaran kedua Pilpres. Kalau selisih para pasangan Capres tersebut tidak begitu besar atau menang tipis, hal itu memungkinkan. Kalau pasangan SBY – Boediono sampai kena disk situasi politik akan semakin panas dan memengaruhi situasi keamanan, ekonomi, dan sosial kemasyarakatan. Oleh Intisari karena itulah, MK diharapkan mampu mengakomodir semua pihak yang bertikai memutuskan singketa Pilpres dengan Hukum harus dijalan- dan bijak sesuai hukum dan perundangan yang kan. Sepahit apa pun pu- berlaku, menggunakan hati, kejujuran. Di tusan MA dan MK semua sinilahMKtidakbolehbermain-maindengan api, karena risikonya sangat besar bagi masa pihak wajib mematuhi- depan bangsa. Sebelumnya, Mahkamah Agung (MA) nya. sudah membuat putusan yang mengejutkan sekaligus membingungkan publik karena berisi membatalkan sejumlah pasal dalam peraturan KPU 15/2009 tentang penetapan perolehan kursi anggota DPR, DPRD provinsi, DPRD kabupaten/kota, dan DPD. Pada 16 Maret 2009, MA melalui putusan Nomor 58/P.PTS/VII/13 P/HUM/TH.2009 memerintahkan KPU membatalkan dan mencabut pasal 38 ayat 2 huruf b dan pasal 37hurufbPeraturanKPU15/2009.Keduapasaltersebutmengaturtentangpenghitungan kursi anggota DPRD provinsi tahap kedua. Kemudian, 14 Mei, MA melalui putusan Nomor 59/P.PTS/VII/15 P/HUM/TH.2009 memerintahkan KPU membatalkan dan mencabut pasal 22 huruf c dan pasal 23 ayat 1 dan 3 Peraturan KPU 15/2009. Pasal itu mengatur tentang sisa suara partai politik yang diperhitungkan di penetapan kursi DPR tahap kedua. MA juga memerintahkan KPU merevisi keputusan No.259/Kpts/KPU/2009 tentang penetapan perolehan kursi parpol. Selanjutnya, pada 2 Juni, MA mengeluarkan putusan Nomor 60/P.PTS/VII/16 P/HUM/TH.2009 yang memerintahkan KPU mencabut dan membatalkan pasal 45 huruf b dan pasal 46 ayat 2 huruf b dari peraturan yang sama.Kedua pasal itu mengatur tentang sisa suara yang masuk ke penghitungan tahap kedua untuk kursi DPRD kabupaten/kota. Terakhir, pada 10 Juni, MA memerintahkanKPUmembatalkandanmencabutsertamemperbaikipasal25tentang pengalokasikan sisa kursi. Yang menarik putusan MA No.15P/Hum/2009 itu juga bersifat menyeluruh, bukan cuma menyangkut persoalan caleg DPR-RI terpilih, tapi juga caleg DPRD pada tingkat provinsi dan kabupaten/kota se Indonesia. Sehingga kalau putusan MA itu dipatuhi oleh KPU Pusat dan KPUTk-I danTk-II maka bakal terjadi‘’kekacauan’’ yang cenderung menimbulkan konflik di kalangan Parpol, caleg, maupun masyarakat. Justru itu, Keputusan Komisi Pemilihan Umum (KPU) untuk mengikuti putusan Mahkamah Agung (MA) tanpa melakukan perubahan komposisi calon legislatif (caleg) terpilih merupakan putusan yang terbilang bijak namun akal-akalan. Alasannya, putusanMAtidakberlakusurut.Tapi,sampaisejauhmanaKPUbisamengenyampingkan putusan MA itu? Hal inilah yang menjadi perdebatan para ahli hukum dan politik kita sehingga menimbulkan pro – kontra berkepanjangan. Kepastian hukum menjadi tak jelas. Mudah-mudahan saja MK yang menyidangkan sengketa Pilpres 8 Juli 2009 tidak mengeluarkan putusan yang membuat masyarakat (publik) semakin bingung dengan putusan yang multitafsir atau bertentangan dengan keadaan di lapangan. Putusan MAdanMKseharusnyamemberikankepastianhukum, tertinggi,danharusdijalankan. Bukanmalahmenimbulkanmasalahhukumbarukarenadidugasaratdenganintervensi dan tekanan politik.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

udah sejak lama ada konotasi (guyon) bahwa Tapsel itu sebagai akronim dari Tak Pernah Selesai. Istilah itu bukan hanya populer pada masa H.M. Shaleh Harahap dan Herry L. Siregar memimpin Kabupaten Tapanuli Selatan. Sebelum itu pun sebutan itu sudah selalu diucapkan orang, yang kesannya terucap apabila ada hal atau masalah yang agak pelik tak terselesaikan di daerah itu. Sekarang sebutan itu kembali lagi mencuat, terutama terkait dengan pemindahan Ibukota Tapanuli Selatan ke Sipirok setelah pemekaran. Sesuatu yang sangat menggembirakan, dua kabupaten baru mekar sebagai anak dari kabupaten induk, yaitu Padang Lawas Utara (Paluta) dengan Ibukota Gunungtua dan Padang Lawas (Palas) dengan Ibukota Sibuhuan sudah mempunyai pemimpin. Selain KPU dan DPRD yang merupakan unsur-unsur Muspida yang dipersyaratkan terbentuk sebelum Pilkada Bupati definitif. Itu artinya pejabat Bupati masing-masing kabupaten baru tersebut dapat melaksanakan tugasnya dengan baik. Apalagi Pilkada berjalan lancar, aman, dan terkendali. Saat ini kedua kabupaten ini sedang giat-giatnya menyusun RTR wilayahnya, karena ini akan dijadikan sebagai pedoman pembangunan 20 tahun ke depan. Boleh-Boleh Saja Tentang Ibukota Tapanuli Selatan, dinyatakan dalam Undang-Undang No 37 dan 38 tanggal 10 Agustus 2007 tentang pemekaran Tapanuli Selatan bahwa Kabupaten Tapanuli Selatan sebagai kabupaten induk ibukotanya adalah Sipirok. Memberikan pendapat dan saran atau yang lain tentang pemindahan dan penempatan perkantoran pemerintahan Kabupaten Tapanuli Selatan itu, meskipun Undang-Undangnya menyebutkan Sipirok ataupun di tempat lain di sekitar Sipirok sebenarnya boleh-boleh saja. Tetapi masing-masing dengan pertimbangan dan alasan yang rasional. Sipirok mestinya tidak hanya dalam radius sembilan kilometer atau sebatas kecamatan itu tok. Sejarah menjelaskan bahwa Sipirok adalah merupakan pusat dan bagian dari Kuria dengan wilayah yang sangat luas, mencakup Arse, Saipar Dolok Hole, Aek/Ulu Bilah, Padangsidimpuan Timur atau dapat juga dikatakan seluruh wilayah Angkola Dolok. Suatu saat

dengan perkantorannya itu. Pemindahan ibukota dan perkantoran diberi waktu kepada Bupati selama 18 bulan terhitung sejak UndangUndang pemekaran disahkan. Itu artinya limit waktu hingga 10 Februari 2009 sudah dilewati enam bulan saat tulisan ini diturunkan. Karena sampai hari hari dari batas waktu yang diharuskan untuk berkantor di Sipirok, belum ada kejelasan, maka masyarakat pun banyak yang mengingatkan, agar segeralah pindah dan berkantor di Sipirok, namun hingga kini ibukota tersebut masih di Padangsidimpuan. Yang dapat dipastikan adalah kapan pemerintahan Kabupaten Tapanuli Selatan berkantor di Sipirok sekali lagi adalah ketidakjelasan. Masyarakat pun banyak yang berunjuk rasa, memberi komentar, pendapat, dan saran. Ada yang mengacu kepada ketentuan yang ada, namun tidak sedikit pula yang memberikan komentar bernada sumbang, sempit dan sebagainya. Bahkan dari aparat Pemkab Tapsel terkesan hanya asal ngomong dan lepas tanggung jawab saja apabila berhadapan dengan masyarakat pengunjuk rasa. Dalam konteks ini, permasalahannya, kantor Bupati bukan mesti di Maragordong, bukan mesti di Arse atau tempat lain. Baik sekarang maupun yang akan datang, Kabupaten Tapanuli Selatan ataupun Kabupaten yang baru nantinya, di mana pun letak perkantorannya, namun nama Ibukotanya tetap Sipirok. Dari berbagai reaksi masyarakat, pimpinan daerah dalam hal ini Bupati Tapanuli Selatan sekarang kiranya perlulah mempertimbangkan faktor hati nurani. Sebenarnya yang terpenting bagi masyarakat adalah realisasi dari amanah Undang-Undang pemekaran itu. Adakah niat tulus untuk itu ? Jika ada, di mana lokasinya, kapan pindahnya ? Agar masyarakat luar Tapanuli Selatan pun tidak bingung mengalamatkan surat, ke mana ? Pemko Padangsidimpuan pun juga tidak terusik mendengar orasi-orasi yang tak berujung karena ketidakpedulian aparat tetangganya yang masih berleha-leha di rumahnya. Boleh kita mengurai Tapsel dengan Tak Pernah Selesai, tetapi dalam arti terus berjuang demi kesejahteraan masyarakatnya, karena memang perjuangan (baca pembangunan) untuk kemakmuran dilalui tahap demi tahap, maka mestinya tak pernah selesai. Tapi ada hasil. Dan ingat, tidak perlu harus demo-demo. Penulis adalah pengamat sospol dan kemasyarakatan

Kondisi Padang Lawas Yang Belum Berubah Oleh Balyan Kadir Nasution


AWASAN Barumun Raya merupakan daerah yang cakupan wilayahnya adalah mulai dari Kecamatan Sosopan, Kecamatan Ulu Barumun, Kecamatan Barumun, Kecamatan Sosa, Batang Lubu Sutam, Hutaraja Tinggi, Lubuk Barumun, Barumun Tengah dan Kecamatan Huristak. Kawasan Sembilan kecamatan tersebut kini telah menjadi daerah otonom baru (DOB) yakni Kabupaten Padang Lawas. Terbentuknya daerah ini menjadi Kabupaten Padang Lawas merupakan aktualisasi dari Undang-undang RI Nomor 38 Tahun 2007. Undang-undang ini telah menyemangati masyarakat setempat untuk berbenah mengatur rumah tangga sendiri di bawah pemerintahan baru yakni Pemerintah Kabupaten (Pemkab) Padang Lawas untuk menggapai perubahan ke arah yang lebih baik yakni makin sejahteranya segenap masyarakat di daerah ini. Pasca terbentuknya Kabupaten Padang Lawas, berbagai tahapan untuk memulai kinerja pemerintahan di daerah ini telah banyak yang dilakukan. Di antaranya terbentuknya Dewan Perwakilan Rakyat Daerah (DPRD) Palas, tersusunnya Satuan Kerja Perangkat Daerah (SKPD), bahkan telah terlaksananya Pemilihan Umum Kepala Daerah (Pilkada) Kabupaten Padang Lawas untuk memilih Bupati dan Wakil Bupati Palas sendiri. Pada 9 Februari 2009, Gubernur Sumatera Utara, H. Syamsul Arifin, SE melantik Bupati, Basyrah Lubis dan Wakil Bupati H. Tongku Ali Sutan Harahap (TSO) hasil dari Pilkada Palas yang berlangsung 22 Oktober 2008 (putaran pertama) dan 3 Desember 2008 (putaran kedua). Usai pelantikan Bupati/Wakil Bupati definitif dimaksud, masyarakat Padang Lawas terlihat lega karena harapan untuk memulai melakukan perubahan daerah ke arah yang lebih baik yang inti pokoknya untuk terwujudnya kesejahteraan masyarakat telah tertumpu kepa-

da sang Bupati dan Wakil Bupati defenitif. Awal-awal bertugasnya Bupati dan Wakil Bupati Palas banyak warga yang berkeyakinan daerah Palas akan cepat berubah sebagaimana yang diharapkan. Harapan dan keyakinan itu sebenarnya sangat wajar jika dilihat dari Bupati dan Wakil Bupati terpilih berlatar belakang birokrat berpengalaman dan pengusaha sukses yang kelak akan menyumbangkan pengalaman dan kiat suksesnya di masa sebelum terpilih menjadi pemimpin di lingkungan Pemkab Padang Lawas. Itu ditambah lagi dengan bumi Padang Lawas yang sejak dulu dikenal menyimpan potensi sumber daya alam yang kaya sehingga jika KDH dan Wakil KDHnya bertangan dingin dan beride segar, potensi sumber daya alam tersebut akan mengantarkan masyarakat Palas menjadi masyarakat yang sejahtera dan makmur. Namun apa yang terjadi setelah lima bulan pasca dilantiknya Bupati dan Wakil Bupati Padang Lawas perdana yang definitif saat ini ? Pertanyaan ini hendaknya tidak usah dijawab dengan kata-kata maupun tulisan. Jawaban yang perlu bagi masyarakat adalah adanya renungan lahirnya ide dan gagasan baru dari Bupati Basyrah Lubis dan Wakil Bupati H. Tongku Ali Sutan Harahap sebagai solusi dari kondisi Kabupaten Padang Lawas yang belum ada perubahan nyata walau usianya sudah mendekati dua tahun sejak terbentuknya menjadi kabupaten baru hasil pemekaran dari Kabupaten Tapanuli Selatan sebagai kabupaten induk. Banyak putra-putri Padang Lawas di perantauan menaruh rasa prihatin melihat kondisi Padang Lawas yang terlihat monoton, jalan di tempat dan tidak ada tanda-tanda untuk berubah. Padahal awal-awal lahirnya kabupaten tercinta ini, segenap masyarakat Padang Lawas tidak terkecuali mereka yang hidup di perantauan banyak berharap sesegera mungkin terlepas dari ketertinggalan akibat selalu dianaktirikan

sewaktu masih bagian dari Kabupaten Tapanuli Selatan. Potensi alam yang dimiliki Kabupaten Padang Lawas sangat besar dan kaya. Potensi alam tersebut meliputi sektor perkebunan, pertanian, perikanan, peternakan, kehutanan dan pertambangan. Potensi-potensi tersebut terdapat hampir merata di seluruh kecamatan se-Kabupaten Padang Lawas. Bahkan yang membuat Tapsel dulu terkenal secara nasional salah satunya adalah berkat potensi alam yang dimiliki kawasan Barumun Raya ini. Potensi perkebunan dan pertanian, misalnya terlihat seperti di Kecamatan Sosa, di wilayah Sosa Jae, di Kecamatan Batang Lubu Sutam, Kecamatan Sosopan, Kecamatan Barumun Tengah dan Kecamatan Huristak. Khusus sektor perkebunan besar jenis kelapa sawit telah membuat Kecamatan Sosa dan sekitarnya, Kecamatan Barumun Tengah, Kecamatan Huristak, Lubuk Barumun dan Kecamatan Barumun Barumun menjadi penyumbang kontribusi besar terhadap daerah Tapsel dulunya dan Padang Lawas sekarang. Di luar dari potensi di bidang perkebunan, Padang Lawas juga memiliki potensi alam yang kaya di sektor pertambangan seperti Batu Bara di Kecamatan Sosopan dan Sosa. Timah hitam di Kecamatan Batang Lubu Sutam, Ulu Barumun, Kecamatan Sosa dan Sosopan. Kemudian minyak bumi di Kecamatan Barumun Tengah (Lapangan Tonga I dan Lapangan Tonga II). Itu ditambah lagi dengan bahan galian non logam seperti kapur, marmer, granit dan batu gamping di Kecamatan Sosopan serta Pasir Kuarsa di Kecamatan Huristak dan Barumun Tengah. Namun perlu kita camkan bahwa potensi alam kaya yang dimiliki kabupaten Palas seperti disebutkan di atas dipastikan akan percuma dan tidak akan membuat masyarakat Padang Lawas sejahtera jika KDH dan Wakil KDHnya tidak “agresif” untuk melakukan perubahan dalam rangka mewujudkan pembangunan yang nyata di daerah ini. Problem kemiskinan akan tetap menjadi warna yang membelenggu masyarakat

Kabupaten Padang Lawas, jika tidak ada kemampuan berkarya dan iktikad baik dari pemimpin pemerintahan di daerah ini. Untuk itu Bupati Basyrah Lubis dan Wakil Bupati H. Tongku Ali Sutan Harahap (TSO) diimbau untuk secepatnya berbuat nyata dan mewujudkan karyanya sebagai KDH danWakil KDH Padang Lawas, berbuat melakukan perubahan guna melepaskan Palas dari ketertinggalan, kebodohan, pembangunan yang monoton untuk membebaskan daerah ini dari belenggu kemiskinan. Kuncinya adalah menjalankan program pembangunan untuk rakyat tanpa melakukan KKN. Tidak optimalnya atau gagalnya pembangunan di suatu negara guna mensejahterakan rakyat banyak disebabkan faktor korupsi. Karena itu, semua pihak/rakyat harus mengawal jalannya pembangunan di daerahnya. Semoga harapan ini terwujud, amin. Penulis adalah wartawan Waspada, pernah ikut Workshop “Media And Local Government: Corruption And Acces To Information” di Davao City, Filipina tahun 2003.

SUDUT BATUAH * JK: Jangan seperti pertandingan bola dan domino - Apalagi pertandingan panjat pinang * Gubsu: Gebyarkan nuansa Merah Putih - Merdeka! * Rahudman didesak penuhi janji - Janji manis, he...he...he


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Selasa 4 Agustus 2009


Tragedi Menimpa Remaja utama remaja / generasi muda dalam mengharungi kehidupan di masa depan.

Oleh H IrhamTaufik Umri,SH,MAP


ungguh mengejutkan head line Waspada 25 Juli 2009 yang memberitakan 63 % remaja pernah berhubungan seksual. Adalah Direktur Remaja dan Perlindungan Hak – hak Reproduksi Badan Keluarga Berencana Nasional Masri Muadz yang mengungkapkan data yang sangat memprihatinkan tersebut. Data itu diperoleh dari sebuah lembaga yang melakukan survei di 33 provinsi. Survei melibatkan responden para remaja SMP dan SMA. Empat tahun lalu DKT Indonesia mempublikasikan hasil survei remaja di empat kota besar Jakarta, Bandung, Medan dan Surabaya. Dari 474 remaja yang dijadikan responden 40 % di antaranya mengaku sudah pernah melakukan hubungan seksual pertama kalinya di rumah. Selanjutnya 75 % remaja pria merasa senang melakukan hubungan seks, sedangkan 47 % remaja wanita merasa menyesal melakukan perbuatan yang dilarang agama itu. Dari kedua survei yang berjarak empat tahun itu, data menunjukkan terjadinya peningkatkan luar biasa aktivitas seksual di kalangan remaja. Jika fenomena itu dibiarkan, dapat dibayangkan masa depan bangsa ini ter-

Face book Tak dapat dipungkiri, era globalisasi yang ditandai dengan kemajuan teknologi komunikasi dan informasi sangat berperan dan berpotensi meningkatkan jumlah remaja melakukan perbuatan yang menyimpang, terutama yang berkaitan dengan aktivitas seksual. Sekarang ini kita dengan mudahnya dapat mengakses beraneka ragam informasi dari seluruh penjuru dunia. Melalui Internet kita telah mengenal dunia maya, dunia yang membuka mata mendapatkan berbagai informasi baik yang positif bermanfaat maupun negatif yang dapat merusak moral kepribadian bangsa. Yang merusak itu tentu saja informasi baik berupa tulisan maupun gambar yang bernuansa pornografi. Saat ini untuk bermain internet bisa dilakukan di mana – mana. Alat Laptop dengan berbagai type dan harga bervariasi dari yang mahal sampai yang murah termasuk barang bekas, dapat dilakukan dengan rental (menyewa) melalui warung – warung internet yang tersebar di mana – mana dari mulai daerah perkotaan, hingga di pedesaan. Jika masyarakat yang punya kemampuan, para orang tua akan langsung membeli laptop di toko, apalagi jika anaknya terus menggoda minta dibelikan alat tersebut. Akan tetapi jika belum mampu untuk membeli, remaja dan anak muda lalu beramai – ramai pergi ke warung internet untuk bermain dengan dunia maya tersebut. Tak mengherankan mereka sangat asyik terbuai bermain internet dengan waktu berjam-jam, bahkan satu harian

mereka berada di sana. Sedangkan bagi remaja yang berkecukupan mereka punya laptop yang bisa dibawa ke mana – mana, namun mereka sering bermain di dalam ruang kamarnya menggunakan teknologi yang dapat membuka wawasan dan berkomunikasi tampa bertemu secara fisik. Komunikasi yang intens dapat dilakukan melalui “ face book ” yang lagi ngetren akhir – akhir ini. Saking ngetrennya beberapa waktu yang lalu sempat terjadi kontroversi dan polemik yang panjang di antara tokoh agama dan tokoh masyarakat terhadap face book ini, apakah diperbolehkan atau dilarang dalam hukum agama. Komunikasi melalui face book yang dilakukan para remaja sangat asyik, menyita waktu yang panjang. Dampaknya akan terjadi hubungan yang intensif di kedua belah pihak. Perkenalan di dunia maya, biasanya dilanjutkan dengan pertemuan fisik dan intim yang bisa saja diaktualitaskan ke perbuatan yang menjurus hal – hal yang ditabukan agama maupun adat istiadat. Demikian pula dengan media handphone (telefon seluler). Sama juga dengan face book, kini handphone bukanlah barang luks lagi. Hampir seluruh remaja kita telah memiliki hand phone dengan berbagai type yang diinginkan, karena harganya murah dan terjangkau. Dengan hanya 100 ribu rupiah mereka sudah bisa mempunyai handphone. Lain halnya dengan lap top yang mempunyai ukuran besar, handphone ukurannya kecil bisa disimpan di kantong dan dompet. Akan tetapi fungsi hampir sama, bisa seketika melakukan komunikasi lisan (oral) dan saling tukar sms (short message service) pesan singkat maupun saling tukar still foto serta film gambar hidup.

Baik foto dan film yang sering dikirim yang mengandung pornografi, bahkan sangat vulgar berisikan film hubungan suami istri, seperti yang pernah menggemparkan di kota Medan, di mana seorang remaja / pelajar SMP kedapatan menyimpan film porno di dalam hand phonenya. Asusila Jika ini yang terjadi tentu saja membawa pengaruh buruk bagi mereka. Tayangan pornografi yang mereka saksikan di VCD / DVD internet dan handphone jelas – jelas akan membawa implikasi terhadap jiwa, watak karakter, dan moral mereka. Kita masih ingat peristiwa mengggemparkan negeri ini terjadi di salah satu daerah, di provinsi Jawa Tengah dan Sulawesi Selatan. Beberapa orang pelajar SMP telah melakukan perbuatan asusila melakukan “perkosaan berjamaah” terhadap teman sekelasnya sendiri. Korban pingsan dan lima hari dirawat intensif di rumah sakit. Ketika diinterogasi petugas kepolisian, dengan terus terang mereka mengakui perbuatan terkutuk itu mereka lakukan usai menonton VCD porno. Faktor merusak remaja lainnya adalah “tayangan infotainment” Hampir semua stasiun televisi swasta nasional mengemas paket siaran infotainment dengan berbagai mata acara seperti: cross chek, kabar kabari, chek and richek, hallo selebriti, kasak kusuk, kiss, gossip, seleb dan sebagainya. Paket acara yang menampilkan kehidupan nyata selebritis baik artis penyanyi , presenter, artis film / sinetron maupun pelawak yang serba glamour dan perilaku aneh – aneh. Dipertontonkan artis yang hidup serumah dengan aktor tanpa diikat perkawinan yang sah, hingga punya tiga orang anak.

Kemudian perkawinan beda agama di luar negeri. Juga kawin cerai, gonta ganti suami atau istri. Ironisnya perbuatan yang dilakukan selebritis tidak mendapat sanksi dari petugas keamanan maupun sanksi moral dari ulama dan tokoh agama. Seolah – olah perilaku mereka legal, padahal sudah menyimpang dari kaidah agama maupun negara. Oleh karena selebriti merupakan “publik figur” remaja kita ikut latah meniru gaya hidup mereka. Pengawasan Fenomena kerusakan moral remaja harus segera ditanggulangi dan diantisipasi sejak dini. Kemajuan teknologi informasi jika tidak diimbangi dengan pengawasan dan edukasi akan memperparah kondisi kaum remaja. Tidak dapat dipungkiri ada orang tua yang tidak peduli dengan perbuatan dan aktivitas anak yang masih remaja. Selain mereka sibuk mencari nafkah untuk kebutuhan keluarga, ada pula orang tua berasumsi anak remaja mereka sudah dewasa dan bisa menjaga dirinya sendiri. Padahal asumsi itu keliru karena masa remaja itu adalah masa kritis bagi kehidupan mereka selanjutnya. Selain itu kontrol sosial dari masyarakat terutama jiran tetangga sudah sirna dari kehidupan globalisasi ini. Mengacu pada zaman dulu era tahun enam puluhan hingga tujuh puluhan, jiran tetangga sangat perdulli dan intens melakukan pengawasan terhadap anak jiran tetangganya. Mereka akan memberikan teguran dan nasihat, jika melihat anak – anak jiran tetangganya melakukan perbuatan-perbuatan negatif seperti, mencuri, perbuatan tak senonoh maupun asusila. Namun sekarang orang tua diam dan membiarkan saja anak ji-

rannya melakukan perbuatan-perbuatan tercela, karena mereka khawatir kalaukalau nasihat dan tegurannya tidak diterima oleh anak maupun orangtua anak jiran bahkan menimbulkan pertengkaran jirannya yang melakukan perbuatan negatif. Bertitik tolak fenomena yang menimpa remaja kita dewasa, ini sudah saatnya seluruh komponen bangsa, baik pemerintah, masyarakat, ulama, jiran tetangga terutama para orang tua melakukan tindakan preventif maupun refresif. Pemerintah segera membuat kebijakan “sex education” di sekolah dan melakukan penindakan dengan hukuman setimpal terhadap kejahatan seksual terutama yang dilakukan selebritis. Ke-mudian melakukan kontrol yang ketat terhadap blogger-blogger dan caybernet yang membuat situs internet. Selain itu Komisi Penyiaran Indonesia (KPI) juga melakukan “punishment” terhadap stasiun televisi yang menyiarkan dan menonjolkan pornografi vulgar di paket acara siarannya. Selanjutnya merevitalisasi rasa kepekaan dan kepedulian sosial jika menyaksikan perbuatan negatif yang dilakukan remaja. Last but not least, para orang tua sebagai benteng terakhir mendidik remaja di keluarganya masing – masing dengan menanamkankan nilai –nilai agama kepada anak – anaknya dari semenjak kecil hingga dewasa. Selain itu melakukan pengawasan dan kontrol yang ketat terhadap penggunaan media televisi, handphone dan internet, agar remaja kita dapat terhindar dari mara bahaya dan bencana khususnya kejahatan seksual. Penulis adalah Dosen Sekolah Tinggi Agama Islam Al – Hikmah kota Tebing Tinggi.

Omong-omong Dengan Eks Instruktur PETA Masachika Nakajima:

Pemberontakan Supriyadi Salah Jepang Usianya saat ini sudah hampir 90 tahun. Namun orang Jepang yang tinggi semampai itu masih sehat dan lincah. Ia punya kebiasaan, setiap tahun datang ke Jakarta, ikut upacara Peringatan Hari Proklamasi Kemerdekaan 17 Agustus bersama komunitas DHN 45. Baginya Indonesia punya catatan khusus dalam sejarah kehidupannya, karena lebih dari separoh usianya terkuras di Indonesia. Semula sebagai pebisnis, lalu direkrut sebagai intel tentara Jepang, bahkan instruktur PETA (Pembela Tanah Air). Akhirnya ia kembali lagi ke bisnis, setelah Indonesia Merdeka, sampai saat ini. Banyak yang menarik dari hasil omong-omong terbuka dengannya….


akajima selalu datang ke Jakarta menjelang 17 Agustus, tetapi kali ini ia sengaja terbang dari Tokyo seorang diri, terkait dengan akan diresmikannya Museum PETA di Bogor, yang rencananya akan dilakukan Presiden Susilo Bambang Yudhoyono. Namun jadwal peresmian itu diundurkan sampai waktu yang ditentukan, karena “kesibukan” presiden. Namun Nakajima tetap ceria, karena toh akhirnya ia punya kesempatan bertemu dengan mantan “murid-murid”nya selama menjadi “guru” PETA dalam kurun waktu 1943-1945, saat mana ia menjadi instruktur, khusus mata pelajaran intelijen. Salah seorang eks muridnya adalah Letjen (Pur) R. Soeprapto, yang saat ini memangku jabatan Ketua Umum DHN 45. Mantan muridnya yang rata-rata sudah berusia 80 tahun ke atas antara lain, Jenderal (Pur) Widjojo Sujono (mantanWapangkopkamtib), Letjen (Pur) Kemal Idris (mantan Pangkostrad), Letjen (Pur) Himawan Sutanto (mantan Pangdam Siliwangi) dan lain-lain. Perjalanan hidup Nakajima yang keturunan ningrat Jepang itu dan kini menjadi pemilik Cosmo Tennis Club di Tokyo, selain menjadi petani kangkung dan sayuran

lainnya, termasuk luar biasa. Tahun lalu, ia absen berkunjung ke Indonesia, karena harus melakukan operasi jantung. Ia mengenal/memahami budaya bangsa Indonesia begitu kental, karena ayahnya sejak tahun 1890-an sudah masuk ke Indonesia, sebagai “orang dagang”. Namun Nakajima tidak membantah, ketika kita sebut, bahwa banyaknya orang-orang Jepang datang ke Indonesia dengan kedok businessmen, sebelum Perang Dunia II, dalam tugas intel untuk persiapan Jepang menguasai Asia/Australia, sebagaimana Jerman/Nazi (Hitler) dan Italia (Mussolini) di Eropa pada PD II. Kenapa Supriyadi berontak? Bicara tentang PETA dengan Nakajima, sangat mengesankan. Bahkan dapat dijadikan analisa sejarah. Nakajima mengakui, bahwa PETA, atas inisiatif para pemimpin pergerakan yang disebut “Empat Serangkai” (Soekarno, Moh. Hatta, Ki Hajar Dewantara, K.H. Mas Mansjur) didukung sepenuhnya oleh kelompok Republiken dalam bentuk tulisan dengan darah oleh Gatot Mangoenpradja dan Ki Ageng Soerjomataram, yang mengusulkan kepada PanglimaTentara Jepang XVI, agar dibentuk satu kesatuan yang terdiri dari pemuda-

Calon Pemimpin Jangan Cengeng Pemilu telah berakhir. Pesta rakyat atau pesta demokrasi melalui pemilu, rakyat telah memilih pemimpinnya yang terbaik untuk lima tahun akan mendatang. Bagi yang terpilih hendaknya bersyukur kepada allah SWT dan berterima kasih kepada rakyat dan yang tak terpilih tak perlu kecewa sebab rakyat yang memilihnya demikian. Calon pemimpin haris mampu menahan diri, berjiwa besar mengakui keungulan terpilih, dengan mengucapkan “selamat” dan jangan bersifat “cengeng” dengan menvari-cari kesalahan pihak lain. Bukanlah sudah bertekad siap menang dan siapa kalah? Belum beruntung atau kalah bersaing bukan berarti memupuskan segala visi dan misi berserta rencana yang dicapai, yang kesemuanya itu bertujuan untuk mensejahterakan rakyat dan bukan untuk mensejahterakan kelompoknya atau individu. Masih terbuka kesempatan untuk untuk mengajukan kepada yang menang atau DPRRI demi rakyat. Calon pemimpin yang”cengeng” tak dapat diharapkan menjadi pemimpin yang baik atau sukses, tetapi dapat menjadi anggapan pemimpin di siang bolong. Jika benar visi dan misi beserta rencana pelaksanaan tepat untuk rakyat, walaupun gagal dalam bersaing pada pilpres, jangan ditunggu 4 setengah tahun sudah berjalan baru sekarang di beberkan, karena ada sesuatu kepentingan individu atau kelompok, dapat diduga bahwa membiarkan rakyat menderita sampai 4 setengah tahun lamanya sadangkan ia tahu cara penyelesaian tapi dipendamkannya, sama saja dengan pemerintahan yang sedang berjalan, turut bersama-sama menghancurkan rakyat. Memang terkait yang namanya politik, tetapi apakah berpolitik membiarkan rakyat menderita sampai 4 setengah tahun itu baru sekarang diungkapkan sebagai alasan agar dirinya terpilih? Hal demikian dapat dianggap sebagai pengecut, konon jika terpilih menjadi pemimpin kan bertambah terhunjamlah rakyat dalam penderitaan sepanjang masa. Rakyat sekarang tidak sebodoh dahulu lagi dalam penilaiannya. Apa lagi kalu ada wacana untuk menggagalkan pemilu atau menggagalkan hasil pilihan rakyat sudah pasti mereka akan berhadapan dangan rakyat dan negara

pemuda Indonesia secara sukarela. “Empat Sekawan” mengusulkan nama Tentara Sukarela Pembela Tanah Air (bahasa Jepang; “Boei Gyugun”) . Jepang menerima usulan tersebut, mereka memperhitungkan Boei Gyugun dijadikan “tameng” jika sewaktuwaktu digempur Sekutu, apalagi kekalahan demi kekalahan tentara Jepang sudah tergambar. Sementara para pemimpin pergerakan kemerdekaan telah memutuskan, perlunya dibentuk Kesatuan Keprajuritan untuk mengawal dan melindungi rencana kemerdekaan Indonesia. Oleh karena itu sebelum ada izin dari Tokyo (baca: PM Jenderal Toyo), latihan-latihan di Bogor dan Tangerang telah dilaksanakan secara intensif, di mana Nakajima ikut berperan. Terbentuknya PETA secara resmi, setelah turunnya Surat Keputusan Penguasa Militer Jepang Jenderal Osamu Seirei 3 Oktober 1943. Nakajima mengatakan, semangat

bushido (cinta tanah air tanpa pamrih), sengaja ditanamkan kepada anggota PETA, sehingga tidak heran, jebolan PETA yang kemudian menjadi anggota TNI, benarbenar terjamin semangat juangnya demi negara dan bangsa, bahkan melahirkan semboyan; “Hidup atau Mati!”. Siap berkorban apa saja; tanpa pamrih! Perhitungan “Empat Sekawan”, bahwa PETA sangat dibutuhkan terbukti, pada saat Proklamasi Kemerdekaan 17 Agusus 1945 dicetuskan, PETA-lah yang menjaga sekitar Jl. Proklamasi 56, bahkan pengerek Sang Saka Merah Putih – Latief Hendraningrat, adalah anggota PETA. Demikian juga ketika Rapat Raksasa 19 September 1945 di Lap. Ikada, Jakarta, memperingati sebulan lahirnya Proklamasi. “Tanpa PETA dan Heiho, mana mungkinTNI memiliki perwira-perwira yang berpengalaman tempur dan menguasai ilmu perang..,” ujar Nakajima, satu-satunya instruktur PETA yang masih hidup. “Sebagai orang intel, tentunya Anda tahu, ada latar belakang politik di balik dibentuknya PETA?” “Setelah Jepang kalah, kami sebenarnya tidak rela menyerahkan senjata kepada Sekutu. Kami lebih suka diserahkan kepada Indonesia, namun karena tidak resmi, pemuda-pemuda Indonesia lalu merebutnya dengan paksa, sehingga di banyak tempat terjadi pertempuran dengan tentara Jepang.” (Ingat“Peristiwa 13 Desember 1945 di Tebing Tinggi dan di lain kota). “Termasuk pemberontakan Supriyadi dkk (salah seorang pemimpin PETA) di Blitar?” “Bisa dikatakan demikian, tetapi pemberontakan Supriyadi itu, didorong oleh kesalahan Jepang. Supriyadi dkk diperlakukan tidak manusiawi oleh oknum-oknum Jepang yang tidak terdidik, karena banyak tentara berasal dari kampung di Jepang. Bahkan saya dapat kabar, istri seorang

akan kacau. Apakah dapat terpikirkan hal itu? Calon pemimpin harus berlajar berjiwa besar, tabah dari segala cobaan, mampu mengoreksi diri dari segala kekurangan dan yakin, keridhaan Allah-lah yang di harapkan. Mengganggu hasil pemilu yang dilaksanakan oleh rakyat dapat di katagorikan sebagai menghianati rakyat, bangsa dan negara. Oleh sebab itu calon pemimpin harus tegar, sehat rihani dan jasmani, berilmu luasdalam mensejahterakan rakyat, jujur, terpecaya, kreatif seta mampu menghormati baik kepada yang menang maupun yang kalah, dan tidak cengeng dengan mencari-cari kesalahan pihak lain, cenderung intuk mensejahterakan rakyat yang bukan teori melulu. Bila ada hal-hal yang melanggar aturan main yang sudah disepakati bersama yang tertuang dalan undang-undang pemilu, silahkan lapor kepada Bawaslu dengan cara baik dan bertanggung jawab, dan bukan rekayasa untuk memojokan pihak lain. Bila tak puas juga karena menyangkut dengan pidana silahkan lapor ke badan hukun atau kepolisian untuk ditindak-lanjuti. Kepada KPU diharapkan menjadi catatan penting dalam pelaksanaan pemilu , sebab akar permasalahan yang besar adalah pada DPS/DPT. KPU dapat mengoreksi kinerjanya mengapa sampai samrautnya DPS/DPT , sampai-sampai mengunakan KTP segala dan telah terconteng sebelum memilh. Sangat dimaklumi, KPU telah melaksanakannya dengan sungguh-sungguh, tapi sebagi manusia tak luput dari kesilapan atau kesalahan, terlalu terpercaya tanpa koreksi dan pengawasan yang ketat (lengah) dapat menimbulkan malapetaka, apalagi bekerja bukan sendirian, rambut sama hitam tapi hati mungkin berlainan. Mudah-mudahan saja, pemimpin yang berjiwa besar, berhati lapang,tidak cengeng inilah harapan rakyat ke depan demi kesejahteraan rakyat, cita-cita bekerja keras, penuh kejujuran, Insya Allah akan selalu dalam lindungan Allah SWT. Menuju keberhasilan mensejahterakan rakyat. H Muhammad Armis Peureulak, Aceh Timur

Terjepit Di Antara Dua Gedung Sewaktu penulis masih kuliah tahun 1966 di Medan dan tinggal di gubuk yang ada di pelataran Masjid Agung Jalan P. Diponegoro Medan. Saat itu masjid dalam saat pembangunan/pemancangan tiang-tiang dan penimbunan tanah pada lantainya. Setelah lebih 40 tahun lamanya Masjid Agung yang merupakan kebanggan

anggota PETA diganggu tentara Jepang. Siapa yang tidak marah….” tukas Nakajima. Akibat pemberontakan PETA di Blitar, Supriyadi kemudian menghilang sampai saat ini dan pemberontak lainnya dihukum Pengadilan Militer Jepang. Supriyadi oleh Presiden Soekarno sempat diangkat sebagai menteri, karena Bung Karno tidak yakin Supriyadi terbunuh. Bahkan belum lama ini ada orang yang mengaku sebagai Supriyadi. Lahir di Kapal Nakajima termasuk salah seorang tokoh yang berperan aktif saat membangun Hotel Indonesia (Jakarta), Ambarukmo (Yogya), Bali Beach dan Samudra Beach (Pelabuhan Ratu/Jabar), karena saat itu jabatannya adalah Direktur Taise Obayashi Kajima Corp, yang mendanai pembangunan hotel-hotel tersebut. Berarti, tidak benar jika Hotel Indonesia dibangun dengan uang Pampasan Perang. “Uang Pampasan Perang yang sudah habis, dijadikan agunan oleh Bung Karno dan baru bisa dilunasi setelah 25 tahun.” ujar Nakajima pula. Pada waktu Sekutu berada di Indonesia, banyak tentara Jepang yang ditangkap, termasuk ayah Nakajima yang kemudian ditahan di pulau Galang selama setahun, namun Nakajima sendiri berhasil “hilang” dari kejaran mata-mata Sekutu, karena ia pandai menyembunyikan dirinya di berbagai tempat, termasuk di Maluku. Laki-laki yang lahir 1 Januari 1920 di kapal “Semarang Maru” dalam pelayaran ke Jepang di saat berada di perairan Taiwan, sampai saat ini tidak memiliki anak, karena istrinya terkena kanker rahim/ payudara. Di usia kanak-kanak ia kembali ke Indonesia mengikuti ayahnya. Bahkan ia sempat sekolah Belanda. Ia pun sudah menjelajahi seluruh kawasan Nusantara dari Sabang sampai Merauke.

Oleh karena itu Nakajima dekat dengan Bung Karno, Pak Harto dan Habibie. Tak heran, jika ia sangat banyak tahu tentang budaya berbagai etnis Indonesia dan itulah sebabnya ia direkrut menjadi intel Jepang untuk melapangkan tentara Matahari Terbit itu “menguasai” Indonesia. Ditanya tentang presiden-presiden Indonesia yang dikenalnya, Nakajima menegaskan, tanpa Bung Karno, Indonesia tidak akan merdeka, namun sayang ia “buta” ekonomi. Bung Karno disebut Nakajima sebagai presiden yang tidak ada duanya di dunia, ia mampu menyatukan Negara-negara di luar bipolar, sehingga baik AS maupun Soviet Uni “takut” padanya. Itulah salah satu penyebab kejatuhannya. “Sayang, Bung Karno kurang faham ilmu ekonomi,” sambung Nakajima pula. Sementara tentang Pak Harto menurut Nakajima, termasuk pintar menyusun strategi, tetapi ia terperangkap akibat terlalu “sayang” anak-anaknya. Habibie pintar soal teknik, tetapi buta politik. Nakajima sebenarnya termasuk orang kaya di Jepang, karena ia memiliki tanah 4 ha yang ditanami kangkung dan berbagai jenis sayuran secara modern, selain memiliki 4 court tenis. Menurut pengakuannya, dialah yang membawa bibit ubi jalar Jepang yang sekarang beredar luas di Indonesia. Ia pun sempat punya kapal yang dijadikan pengangkutan pertukaran pemuda Jepang dan Negara-negara Asia. Kapal pemuda tersebut baru saja dijualnya, akibat krisis keuangan yang melanda Jepang belum lama ini. Ia pun mempunyai jaringan bisnis di Indonesia, sehingga tidak heran, bila kapan saja ia bisa terbang ke Jakarta. Saat ini sedang menggarap bisnis kulit sapi yang didatangkan dari Indonesia. Eddi Elison

umat Islam, maka idaman kemegahan masjid itu mulai pudar dengan terjepitnya di antara bangunan Sun Plaza yang belakangan berdiri di sebelahnya kantor gubernur yang dibangun bertingkat. Kebetulan penulis melakukan napak tilas pada 7 Juli 2009 yang lalu bersama istri, anak, menantu, dan cucu, shalat Ashar di Masjid Agung setelah melepas lelah di pelataran mesjid atau di bawah pohon sebelah kantor gubernur. Mata ini menatap ke arah Sun Plaza yang kalau tidak silap melingkari letter L dari utara sampai sedikit ke arah barat Masjid Agung melebihi atau tingginya di atas kubah Masjid Agung, maka “terjepitlah di antara dua gedung”. Lahirnya Masjid Agung tahun 60-an merupakan kemegahan masjid atau nomor dua dari Masjid Raya, akan tetapi saat ini mulai pudar kemegahannya karena diapit ketinggiannya oleh gedung bertingkat. Menetes air mata penulis melihat rumah/Bith Allah itu kecil, jadinya berada di tengah-tengah pusat Kota Medan. Tapi biarlah begitu adanya, asalkan kebesaran masjid atau keagungannya tidak dicabut Allah SWT, oleh karena keberadaan umat Islam yang shalat dan kegiatan lainnya masih ramai di Masjid Agung kesayangan kita itu. Penulis berangan-angan walaupun kemampuan tidak terjangkau untuk membangun Masjid Agung setara tingginya dengan gedung yang dua (Kantor Gubsu dan Sun Plaza), atau diharapkan pemerintah menjadikan/ membangun Masjid Agung menjadi Islamic Centr, jangan kecilkan keberadaan Masjid Agung, akan tetapi mari kita agungkan keberadaannya. Kalau penulis tidak salah, Masjid Agung tahun 60-an merupakan markas dari qari/qariah Medan yang menjadi qari/qariah internasional seperti Alm. H. Khualid Daulay, H Mirwan Batubara, H Fadlan Nasution, Hj Khalimatussakdiah Lubis dan lain-lain serta tempat ulama berkumpul seperti Alm. HA Thalib Lubis, Alm. H Abu Bakar Nasution, Alm. H Anas Tanjung dan lain-lain yang penulis lupa namanya pokoknya ulama besar bertaraf nasional yang ada di kota Medan saat itu. Maka, mari kita back to basic untuk mengagungkan kembali Masjid Agung itu, semoga Allah meridhoinya. H Ichsan Nasution, BBA Desa Perbaungan Labuhan Batu

14 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Carry Real Van 1.3 GRV. Thn. 97. Biru Ungu, BK Mdn Asli panjang. AC DB, lengkap. Hrg. 47,5Juta/Nego. HP. 0812 6545 1974 SUZUKI Baleno Next - G ‘04/’03, Mrh Met, BK 1 tgn. BR, VR 18”, Jok Klt, DVD, Komplit, DP 36 Jt. Angs: 3,3Jt. Sisa 30x Lagi. As. All Risk. Hub. 76700976

CHEVROLET Trooper Diesel 4.4 Thn. 89 Kondisi bagus. AC, Tape, VR, BR, PW, PS, Asli Medan. Harga 45Jt. Damai. Hub. 0812 650 8819

SUZUKI Carry Thn. 1986 W. Biru, BK Medan. Kondisi bagus. Bisa Dilihat. Hub. 0813 9712 7771

TROOPER Thn. 88/89. W. Silver met, 4x4 Diesel 5 pintu. AC, VR, Cobra Baru. PS, PW, Tape, Cantik. H. 42Jt. Nego. Hub. 0878 6886 5261

SUZUKI Carry Thn. 84. Warna merah muda. BK Panjang. Siap pakai. Harga 12 Juta/ Nego. BU. Hub. 7750 2169/ 0812 6038 7788

DAIHATSU ROCKY THN. 89 Warna hijau. Lengkap. Harga 48Jt.Hub. 0816 318 3686 TP. BU NEW DAIHATSU PROMO (DISKON + HADIAH) Xenia DP 15 Jt-an dan Angs. 2 Jt-an, Terios DP 20Jtan dan Angsuran 4 Jt-an. Luxio DP 7 Jt-an dan Angs. 4 Jt-an, Grand Max PU DP 7 Jt-an dan Angs 2 Jt-an. Hub. 0819 203 8742 / 061-77722561

DAIHATSU Espass 1.6 Real Van Dijual. Thn. 96. W. M. Met. Mulus, AC, Tape, Velg, BK asli Medan, Supra 125, 01. Hub. 0816 3123 854 - 766 134 12 DAIHATSU Espass 1.6 S. Van ‘96 Maron Met, BK Mdn, Sliding Door, AC, TP, VS, BR DP 14Jt. Angs. 1,01Jt. DAIHATSU Ceria KL + ‘02 Silver Met, BK Mdn Tgn. 1, AC, TP, VS, BR, Irit BBM, DP 13 Jt. Angs: 1,3Jt, Angs: 1,3Jt. Hub. 76700976

DAIHATSU Taft GT ‘91. Hitam, Siap pakai. Dijual Panther Hi Sporty ‘97 Hitam. Siap pakai. Hub. (061) 8220116 / 0815 306 4145 HONDA CIVIC GENIO THN.93 W. Hijau tua met, AC, Tape (sound), VR, BR, BK Medan asli (no. cantik). mesin sehat, sgt mulus, tinggal pakai. Harga 56Jt/damai. Hub. (061) 77731399

HONDA Grand Civic Thn. 90. AC, VR, BR, Tape, MP3 mulus. BK Tunggal. Harga 37Jt Nego. Hub. 76544556 - 77598346 HONDA City New - IDSI ‘04/05. HTM Met, AC, RT, DVD, Jok Klt. Full Body KIT, VR 17”. BR Baru, BK No. Pil, DP 40Jt, Angs. 4,9Jt. Sisa 25x. Asuransi All Risk. 3 thn. Hub. 76700976

ISUZU Panther ‘97 Royale W. Merah Metalic, mulus. Hrg. Nego. Hub. 061 76311 890, 0813 7619 5157 ISUZU Panther LDX Thn. 91. Asli Medan. Kondisi bagus. AC, Tape, VR, BR, Harga 41 Jt damai. Hub. 0812 650 8819 ISUZU Panther Pick Up 2004 Panther Minibus 2005 Hub. 0812 6316 7942 MERCY Belalang ‘73 Dijual. PS, BR, VR, CD, TV, Pajak + BK Panjang. 18 Juta/nego. Hub. 0812 6015 2163 Smash 2006= 6 Jt.


Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319

MITSUBISHI Kuda Diamon Diesel Thn. 2002. Coklat tua met. AC DB, Tape, VR, PS, PW, CL, Jok kulit. BK Mdn Rp. 105Jt. Hub. 0812 65942 789

SUZUKI Grand Escudo 2.0 Thn. 2004. Coklat met. Original. Plat BH Rp. 122 Jt. Hub.0816 3113 953 SUZUKI Escudo 2.0 Thn. 05/ 06 Coklatmet, BK Mdn asli Rp. 133Jt. Hub. 77863981


AVANZA (READY),RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. “Avanza DP 20 Jt-an” Hub. 0813 7512 7297 - (061) 7795 1428

TOYOTA Kijang Capsul Tipe New 1.8 EFI Th. 2004. W. Milenium Silver Tgn. Pertama. AC, Tape, BR, PR, PW, CL, Remot. Jok kulit. KM sedikit. Mulus, siap pakai. Hub. 0813 7572 1097 Mdn. TOYOTA Kijang LSX - EFI ‘02/01. Biru tua met, AC, TP, VR, BR, BK. DP 23 Jt, Angs: 3,2Jt. Toyota Kijang LGX-DSL ‘02/’01 Biru met, Jok KLT, AC DB, VR, BR, Maxiss, PW, DP 35Jt. Angs: 3,7 Jt. Hub. 76700976

TOYOTA Kijang Commando Long Thn. 90. Lampu dan Bumfer Grand Extra, Asli Medan. Hrg. 48Jt Nego. Hub. 0813 7644 7297

Rp. 91.000 Rp. 104.000

* Sistem Informasi Kependudukan (SIAK) * Sistem Informasi Keuangan Daerah * Sistem Informasi Retribusi * Sistem Informasi Geografis (tersedia Mobile Tracking Unit) * Sistem Informasi RS / klinik / pasien * Sistem Informasi Akademik / Sekolah * Website Portal Pemprov/Pemko/Dinas * Realcount Pilkada dengan SMS Informasi dan demo, Hubungi: (061) 7761 1252


ELEKTRONIK JUAL & BELI TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. Jl. Setia Budi No. 424B Dkt. Ring Road.

TOYOTA Innova V Luxury 2.0. Warna hitam. Thn. 2007. Asuransi 1 thn All Risk. Tgn. Pertama. Harga 227Jt. Hub. 0812 630 5408



HONDA Astrea Grand Kodok Dijual. Thn. 1992. Harga Rp. 3 Jt (Nego). Hub. HP. 061-77341144




Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

HARGA KHUSUS Dalam Rangka Menyambut Hut RI - 64 Kondisi Mesin Bagus Dan Drum Mulus

WASPADA Media yang Tepat untuk Iklan Anda

DICARI !!! Agen / Master Pulsa Murah (Pendaftaran Gratis) M-KIOS Dan All Operator H. 0812 37 935 675

IR 5020/6020/5570/6570 dll

PONDOK INDAH JL.GATOT SUBROTO KM. 6 KOMP. RUKO TAPIAN MAS NO.24 Tel. 061-77418000, 91344988 Hp. 08163166777, 08116046657 MEDAN










7030118 76750084

Ingin Promosikan Produk Anda Harian


Jl. H. Abd. Manaf Lubis No. 58 (061) 846.1422 Gaperta Ujung Medan Contact Person: Noni (HP: 0813.6172.7529)





Satu STNK Dan BPKB BK 3881 KI a/n. LIBERTY PARDAMUAN L. GAOL. Honda Thn. 2005. Yang menemukan Hubungi: 0816 316 7075. Diberi hadiah dan tidak dituntut.


TERCECER 1 Buah BPKB. Asli No. 2712174-B. BK 1498 YJ a/n. LENNI LISMAYANA. Jl. Dewi Sartika Kec. RT. Selatan L. Batu.


Miliki Segera....!!! Laptop, oke merk terkenal. Kwalitas terbaik, bentuk & design mantap, mewah & bergengsi, multimedia, internet wifi, bluetooth, kamera, komplit, siap pakai. Terjamin & Digaransi. Buruan...nikmati diskon gede & Bonus2nya di - Medan Mall Lt. Dsr - 0812 645 57274 Hrg. - Medan Plaza Lt. Dsr - 0812 6085 2666 Mulai - Millenium Lt. Dsr - 0813 9693 0390 - Aksara Lt. Dsr - 0813 9742 2213 - Paladium Lt. Dsr - 0812 653 44 059 - Binjai Super Mall - 0813 9798 3820





JUAL BLACK BERRY Storm 9500 Rp. 3,5 Jt Javelin 8900 Rp. 3,3 Jt, Bold 9000 Rp. 4,1 Jt Iphone 3G 16. GB Rp. 8 Jt & NOTE BOOK NOKIA ESeries NSeries GARANSI Pemesanan Diantar Telp: 0813.7034.6677

TERCECER BPKB Asli Mobil BK 1811 HF. A/n. Wanto IR. Merk/Type: Daihatsu No. Rangka: 044334. No. Mesin: 9044334. No. BPKB: 9678176-B HILANG Surat Asli Sertifikat Tanah a/n. Drs. KARMEL SIMATUPANG. Yang terletak di Jl. Vanili 1, Blok K, Nomor 70 Perumnas Simalingkar. Kelurahan Mangga, Kec. Medan Tuntungan Kotamadya Medan. Luas tanah 72 m2. Bagi yang menemukan mohon hub. 0853 6108 2129




B.KATAMSO : SAL: AIR. 08527093 3649 MURAH 0819 3340 8099: GATSU: MAJU:JAYA: GRNSI: 1 THN


WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078 NARO SERVICE Jl. Sisingamangaraja




Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725 Mobil. Sedot

Jl. Brayan Medan






Jl. Gaperta Gg. Partiasa No. 8 Bergaransi 3 Bulan




Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAS............. 1,2 Jt (4 bulan) Desain Grafis Komplie.............................500 Rb (1 bulan) web Programing (PHP, MSQL)................. 400 Rb (10 hari)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 Website:




LEBIH MUDAH BEKERJA Informasi lebih lanjut hubungi: Kampus AKFIS SITIHAJAR MEDAN

Jl. Jamin Ginting No. 2 P. Bulan - Medan (dekat Kampus USU) Telp. (061) 3008.4600 - 7784.6199 C/P: 0812.6051.835 (Sulaiman) 0813.6159.6851 (Ani)


GELOMBANG II PROGRAM STUDI 1. DIII KEPERAWATAN 2. DIII KEBIDANAN Persyaratan: - Lulusan SMA, MAN, MAS - Semua jurusan Pendaftaran: Mulai Sekarang s/d 04 Agustus 2009 Uji Tulis 05 Agustus 2009 Tempat Pendaftaran:

- BAPAK DRS. HARIS TELP. (061) 738.2285 - IBU MISNIWATI, SH HP. 0812.607.2061 0812.6008.247





Menerima Mahasiswi Baru Angkatan ke VIII T.A. 2009/ 2010 Bagi Tamatan SMA/ SMK/ ALIYAH SPK



SPECIALIST PO WER STEERING POWER Service: Berat, Bunyi, Bocor. Pasang Baru, semua jenis mobil. Hub. BULAN AUTO SERVICE Jl. T. Amir Hamzah No. 49 Telp. 8446172/7676 7270 - 0813 70128 696

Tanggal 05 Agustus 2009


Media yang Tepat untuk Iklan Anda


Mulai Sekarang s/d 04 Agustus 2009 Dari Jam 08.00 Wib s/d 15.00 Wib



Jl. Pancing/ Willem Iskandar 116 Telp. (061) 662.1202 - 662.1201








Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Telp. (061) 457.6116 - (061) 7731.3385 HP. 0812.6566.807 - 0812.6481.828 - 0813.6137.2321

Siswa/i lulusan SMA/ sederajat untuk di didik menjadi Perawat Profesional di Akademi Perawat COLUMBIA ASIA MEDAN, T.A. 2009/2010. Jaminan bekerja langsung di GLENI INTERNATIONAL HOSPITAL, bagi lulusan terbaik dan selebihnya akan direkomendasikan di seluruh Rumah Sakit di bawah naungan COLUMBIA ASIA MEDICAL SERVICES seperti di Negara Vietnam, India, Indonesia & Malaysia



Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Telp. (061) 457.6116 - (061) 7731.3385 HP. 0812.6566.807 - 0812.6481.828 - 0813.6137.2321


JUAL BLACK BERRY 3 TYPE Murah ! Bergaransi !

JOHOR AC Servis AC B. Pasang. Perbaikan Jual Beli AC. HP. 0815 308 042. (061) 77 0738011 (PAK WARDI)

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



IR 5000 Rp. 23.500.000,IR 6000 Rp. 24.000.000,TERSEDIA TYPE






TOYOTA Kijang LX Plus. Bensin 1.8 Thn. ‘03. Mulus, lengkap, Hrg. 110Jt. Hub. 0813 6141 2060

JEEP Cherokee 4x4 ‘95, 4.0 L, Jok Klt, BK Medan Asli, VR, BR 31”, AC, TP, EM, PW, Biru tua met, DP23 Jt. Angs: 2,3jt x 35. Hub. 76700916

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


TOYOTA Corolla ‘82 Dijual Cepat, Siap pakai. Warna hitam, BK Medan (TP). Harga Rp. 21 Juta (net). Hub. 0819 866 311

Toyota Hilux DC 97100. B. Up + ARB Winch Velg + Ban, Mesin, Body+ Cat keren. BK Mdn. Hub. 77110505. Jl. Let. Jend. Suprapto 4 Medan. Depan Denpom

Ingin Promosikan Produk Anda Harian

11 CM Rp. 165.000 12 CM Rp. 180.000

Stock Terbatas ! Storm 9500, 3,5Jt Javelin 8900 2,4Jt, Bold 9000 3,9Jt u/info Hub. 0817 154721 email:

TOYOTA SOLUNA 1,5 GLI Thn. 2000. Warna biru, Tangan pertama. Harga Rp. 72,5Jt. Hub. 0812 630 5408


9 CM Rp. 126.000 10 CM Rp. 140.000

Aplikasi Sistem Informasi Manajemen

TOYOTA Kijang Krista Thn. 97. Warna biru met. BK Medan, mulus, siap pakai. Jual Cepat. Komplit. Hub. 7794 0902

HONDA Tiger Thn. 2008. W. Hitam. Hub. 7624 1301


7 CM 8 CM

Selasa, 04 Agustus 2009

Ujian Tulis

Tempat Pendaftaran:

KAMPUS STIKes RS HAJI MEDAN TELP. (061) 663.7572 FAX. (061) 663.9515 JL. PANCING/ RS HAJI MEDAN (Angkot Rahayu 42/ 121)





Informasi Lengkap: 1. Dr. H. Wirsal Hasan, MPH, HP. 0819.863.979 0812.639.88388 2. Dr. Hj. Sundari Syarif HP. 0811.618.011



IZIN MENDIKNAS RI No. 14/D/O/2009 Tanggal 2 Maret 2009 Rekomendasi Pengurus Pusat PPNI No. 482/PP.PPNI/S/X/2008 Tanggal 15 Oktober 2008 Rekomendasi Kepala Badan PPSDM DepKes RI No. HK. 03.05/1/4/5652/2008 Tanggal 30 Desember 2008 Menerima Mahasiswa Baru T.A. 2009/ 2010


1. Sarjana Keperawatan (S1 KEPERAWATAN) Angkatan I 2. Akademi Keperawatan (Akper) Angkatan XVII 3. Akademi Kebidanan (Akbid) Angkatan VIII Pendaftaran Mulai Tanggal 16 Juli s/d 4 Agustus 2009

Testing Tanggal 5 Agustus 2009 Informasi selanjutnya hubungi:

Kampus STIKes Flora: Jl. Rajawali No. 24 Medan 20122 Telp. (061) 845.4406 - 845.4407 845.4408 - 845.4409 HP. 0812.650.6377



TERAKREDITASI BAN PT MENERIMA MAHASISWA BARU T.A. 2009/2010 Dengan 3 konsentrasi: 1. Komputer Akuntansi 2. Akuntansi Perpajakan 3. Akuntansi Perkantoran Tempat Pendaftaran:

Kampus Akademi Akuntansi YPK Jl. Sakti Lubis/ Pegawai No. 8 Telp. (061) 786.3988 Sp. Limun Medan Setiap Hari Kerja: 08.00-17.0 Wib Perkuliahan Pagi/ Sore dimulai Tanggal 7 September 209




Dibutuhkan Segera Pekerja LAKI-LAKI DAN WANITA 100 ORANG untuk KILANG ELECTRONICA Dengan Lokasi di SEMENANJUNG MALAYSIA 1. LAKI-LAKI/ WANITA - Perusahaan Asahi Kosai di Balakong Kuala Lumpur (Selangor) (Lk/ Wanita) - Perusahaan Nippon Wipeper Seremban (Lk/ Wanita) - Perusahaan Hitachi Kuala Lumpur (LK) - Perusahaan Electronics Sdn. Bhd Johor (Lk/ Wanita) - Perusahaan MMI Electronic Sdn. Bhd Johor (Lk/ Wanita) TOTAL PENDAPATAN RM 850 S/D RM 900 PERBULAN 2. KILANG COMPANY WANITA - Lokasi Malaka Perusahaan EIMEI ELECTRONICS SDN. BHD TOTAL MIN PENDAPATAN RM 812 - Lokasi Prai Penang SONY EMCS SDN. BHD TOTAL MIN PENDAPATAN RM 947/ BLN PERSYARATAN:

1.Diutamakan Warga Aceh (laki-laki) yang mempunyai Card Tsunami 2.Wanita/ Laki usia 18 s/d 30 Tahun 3.Pendidikan min. SLTP 4.Sehat Jasmani/ Rohani 5.Kontrak 2 tahun 6.Izin Orang Tua

Yang berminat segera datang langsung dengan membawa KTP, KK, Ijazah asli/ Copy, Pasphoto berwarna Uk. 4x6: 8 lbr, 2x3: 4 lbr, 3x4: 8 lbr ke:

PT. SAFARINDO INSAN CORPORA Jl. Mandala By Pass No. 51 (Samping Wartel Bernas) Phone: (061) 733.0684 Fax. (061) 735.9185 Email:


Bapak/ Ibu Dalam/ Luar Kota Perusahaan/ Pribadi/ Asing Hub. 0813.9792.2219

DICARI TUKANG PANGKAS Jl. Sei Wampu Simpang Gajah Mada (Lampu Merah) Hub. 0812.6484.8409 - 0816.331.912 Jaminan Tinggi


Tkg pks Muslim, Pks Full AC Ada jaminan + Bonus Hub. 0812.2078.0005


1 (satu) orang Supir, Muslim, Tdk merokok, Blm menikah, T. Tinggal sekitar Helvetia/ Gaperta Hub. 0812.6466.474 DIBUTUHKAN SEGERA

1 (satu) org Kep. Bag. Perladangan yg berpengalaman 3 (tiga) org Pegawai Bag. Perladangan yg berpengalaman - Usia: 10 thn s/d 25 thn - Khusus dari luar kota & Bersedia tinggal di perkebunan Medan Hub. 0813.9722.6929 LOWONGAN #BUTUH SEGERA#

Perusahaan bertaraf INT’L, butuh tenaga kerja P/W (17 - 39 thn) untuk posisi di kantor, Syarat: - Bawa KTP + Pas photo Uk. 3x4 (2 lembar) - Guntingan iklan ini untuk proses interview, syarat lain bisa menyusul setelah diterima Penghasilan Rp. 1,5 Jt s/d 3,5 Jt/ bln (Sesuai Posisi Anda) HUB: BPK. MIRSAL HARAHAP, SE

HP. 0813.9710.0709 Tdk Melayani SMS Alamat kantor:

Jl. KH. Wahid Hasyim No. 118 A Simpang Barat masuk dari Gatot Subroto Medan NB: Pendidikan min SMU/ sederajat, pengalaman kerja tdk diutamakan


Sebuah Perusahaan Consumers Goods membutuhkan Sales Girl Syarat 1. Minimal tamatan SMA 2. Umur max. 25 thn 3. Pengalaman diutamakan minimal 1 thn 4. Punya kendaraan roda 2 dan SIM C 5. Pas photo berwarna 3x4: 4 lbr terbaru 6. Mengenal wilayah Mdn dan bersedia keluar kota 7. Photo copy KTP terbaru: 2 lbr 8. Rajin, jujur, mempunyai motivais dalam target dan tanggung jwb pd perusahaan Bagi yang berminat antar lamaran langsung tanpa diwakili ke: Jl. Pinang Baris 247 F-E disamping Panglong “Naga Mas Jaya Medan”, paling lambat 1 minggu setelah iklan ini diterbitkan

Ekonomi & Bisnis

WASPADA Selasa 4 Agustus 2009

Sumut Infasi 1,15 Persen

MEDAN (Waspada) : Setelah Juni Sumatera Utara tidak mengalami perubahan indeks dibandingkan Mei 2009, Sumut mengalami inflasi sebesar 1,15 persen. Kepala BPS Sumut Alimuddin Sidabalok di Medan, Senin (3/7), menyatakan empat kota Indeks Harga Konsumen (IHK) seperti Medan, Pematang Siantar, Sibolga, dan Padangsidimpuan mengalami inflasi. “Inflasi 1,15 persen pada Juli dipicu kenaikan antara lain harga bawang merah, daging ayam ras, bawang putih , rokok kretek filter, ikan gembung, dan angkutan udara. Padahal pada Juni, inflasi 0 persen dari Mei 2009 yang mengalami inflasi 0,26 persen, “ katanya. Pada April, lanjutnya, Sumut masih mengalami deflasi 0,44 persen setelah, Maret, Februari dan Januari juga deflasi masing-masing 0, 35 per-sen, 0,24 persen dan 0, 15 persen. Dari empat IHK, Inflasi di Sumut terbesar pada Juli terjadi di Medan sebesar 1,20 persen, disusul Pematang Siantar 1,04 persen, Sibolga 0,97 persen dan Padangsidimpuan 0,61 persen. Dengan inflasi pada Juli, maka, pada Januari Juli, besaran inflasi Sumut sebesar 0,23 persen dan untuk yaer on year (Juli 2009 terhadap Juli 2008), inflasi 2, 31 persen. Didampingi Kabid Integrasi Pengolahan dan Diseminasi Statistik Panusunan Siregar, Sidabalok menyebutkan 16 kota IHK di Pulau Sumatera semuanya mengalami inflasi dengan tertinggi terjadi di Bengkulu 1,61 persen dan terendah di Batam 0,15 persen. (m38)

Bursa PROPERTY Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual Uk. 16x20m, 4 KT, 2 KM, Ada halaman di depan Carport, Telp, PAM, PLN, SHM alamat Jl. Perkutut No. 40 (Kpt. Muslim) Hub. 0852.7608.0789


Tasbi Blok E13, KT 4, KM 3, AC, Lengkap, SHM, 0812.6552.4994 RUKO DIJUAL/ DIKONTRAKKAN

2 (dua) pintu Jl Panglima Denai/ Amplas, LB. 17x8m, L. Halaman 20x9 (Cocok untuk loket/ bengkel mobil) Hub. 0813.9722.1002

DISEWAKAN Sebuah Toko Jl. Gedung Arca I A (Simp. Halat) Hub. 0813.6231.8208


1. Rumah di Komplek Citra Menteng Blok A-05, LT. 13x11m, LB. 11x11, 2 LT, 3 KT, 3 KM, PLN, PDAM, Keramik + Perabotan, SHM 2. Tanah di Desa Sei Rotan Deli Serdang Km. 13, Depan Kampus Akper Harapan Mama, Luas 25x275,5m NB. Khusus Muslim Serius Hub. 0812.657.8546 - (061) 7714.3458



Harga Emas Tertahan Di Rp304 Ribu Per Gram MEDAN (Waspada):Walaupun emas di perdagangan internasional naik dari 933 dolar AS per ounce menjadi 953 dolar AS per ounce, tetapi harga emas diperdagangan lokal tidak terpengaruh dan masih langgeng di level Rp304 ribu per gram. Bertahannya emas di level tersebut sejak penutupan perdagangan pekan lalu didorong rupiah yang masih bertengger di bawah Rp10 ribu per dolar AS, bahkan menguat dari Rp9. 930 per dolar AS menjadi Rp9. 910 per dolar AS, Senin (3/8).

MEDAN (Waspada) : Nasib perusahaan patungan Indonesia dan Jepang, PT Inalum pasca 2013 belum diketahui secara pasti padahal perusahaan mengoperasikan PLTA Asahan dan pabrik pele-buran aluminium di Kuala Tanjung itu bernilai strategis dan historis bagi kedua bangsa. “Perjanjian kerja sama Indonesia dan Jepang akan berakhir tahun 2013, tetapi hingga dewasa ini belum tahu secara ’terang benderang’ bagaimana dan siapa yang akan melanjutkan pengelolaan PLTA Asahan dan pabrik aluminium itu,” kata Dekan Fakultas Ekonomi Universitas Sumatera Utara (USU) Jhon Tafbu Ritonga, di Medan, Minggu (2/8). Menurut dia, pemerintah pusat mungkin sudah punya kebijakan atau rencana tentang kelanjutan perusahaan itu, tetapi pemerintah dan masyarakat Sumut tetap memiliki kepentingan yang besar terhadap kelanjutan perusahaan tersebut karena terkait dengan DIJUAL

kepentingan rakyat di daerah itu. Sehubungan itu, kata dia, Fakultas Ekonomi bekerjasama dengan Yayasan Pratama Mulya Medan bermaksud menghimpun gagasan berbagai pihak dan mencarikan solusi yang tepat untuk disampaikan kepada Pemerintah Provinsi Sumut dan pemerintah pusat serta pihak yang terkait, bagaimana sebaiknya perusahaan itu kelak, sebagai wujud kepedulian terhadap kepentingan Sumut. Jhon yang pengamat ekonomi Sumut itu menambahkan , PT Inalum di satu sisi adalah penghasil tenaga listrik dengan kapasitas cukup besar atau 603 MW, tapi di sisi lain juga pengguna tenaga listrik yang “rakus” untuk memanaskan tungku-tungku yang menghasilkan Ingot dengan kapasitas terpasang 225 ribu ton. Aluminiun yang dihasilkan dari Kuala Tanjung itu sekitar 60 persen di ekspor dan 40 per-


Rumah Permanen Uk. Tanah 10x12,5m, Bangunan 10x9m, 1.1/2 Lt, Atap cor, 3 KT, 1 RT, 1 RM, 2 KM, Dpr, Garasi, PAM, PLN 1300 W Jl. B. Katamso Gg. Perbatasan/ Perbatasan Baru Kp. Baru Medan, 270 Jt/nego Serius hub. 0812.6595.1526 (TP)

Tanah Jl. Pipa Air Bersih/ Eka Rasmi, SHM, Uk. 12x18,5m Hub. 0852.6136.1643/ 7776.8031



1 Unit R. Tinggal (2 KT, 1 KM, RT, PAM, PLN) Jl. Seto No. 3A (AR. Hakim/ Bakti), TP Hub. (061) 7794.1949/ 0813.6167.7218 RUMAH MURAH

Siap huni, LT. 15x16,5m, LB. 13,5x9, SHM, 3 K. Tdr, RT, RK, Keramik, Air, Listrik, Lingkungan aman & tenang, Jl. Amal/ Jl. Sehat II No. 1 Sunggal Tono: 7680.4669/ 0819.829.190

RUMAH VILLA DIJUAL Type 90, PLN, PAM, Telp, IMB, Full keramik, Gypsum, Pagar (baru) Jl. Eka Rasmi Msk Eka Mulya, Hrg 247 Jt Hub. (061) 787.7844 - 7791.6682 0852.9635.2311 (Ayumi)

VILLA AR RASIDA Type 60 (6x16m2), 3 KT, 1 KM, Keramik, Gypsum, PAM, PLN, Telp, SHM, IMB Jl. Eka Rasmi/ Eka Mulya Mdn Johor Hub. (061) 7793.6610 0813.7696.2999 Z-Property TANAH


Tembung Pasar IX Jl. Sidomulyo G. Padang ± 60m dr Jln besar, Uk. 15x29m Hub. 0813.6132.1130/ 414.8848

Fasilitas: 2.1/2 Tkt, SHM Pembayaran Tunai/ KPR Dijual cepat Harga hemat Discount s/d 50 Jt Pemasaran: 7708.2002/ 7692.2003/ 7687.7000 0813.6135.7031/ 0812.6564.3467

Menurut Rizal, pedagang emas Singgalang Indah di Pasar Petisah Medan, bertahannya harga emas kualitas 99,99 persen tersebut tidak merubah harga jual emas jenis perhiasan walaupun nilai transaksi perdagangan masih sepi. Harga emas perhiasan kualitas 99 persen (LM) Rp300 ribu per gram, emas 96 persen (London) Rp290 ribu per gram, 24 k (90 persen) Rp260 ribu per gram, 22 k (70 persen) Rp 210 ribu per gram, emas putih (75 persen) Rp230 ribu per gram,

sebutnya. Langgengnya harga emas di perdagangan lokal tersebut diperkuat oleh membaiknya nilai tukar rupiah terhadap mata uang asing di bawah level Rp10 ribu per dolar AS, bahkan saat ini menguat dari Rp9.930 menjadi Rp9.910 per dolar AS, ujarnya. Kestabilan harga emas tersebut akan terus bertahan seiring penguatan rupiah di pasar uang internasional, sementara itu bila melihat kondisi harga emas di pasaran internasional saat ini dalam kondisi mahal, sebutnya, Walaupun emas di perdagangan internasional naik dari 933 dolar AS per ounce menjadi 953 dolar AS per ounce, tetapi harga emas diperdagangan

lokal tidak terpengaruh dan masih tetap langgeng di level Rp304 ribu per gram, katanya. Harga pada pembukaan perdagangan di awal pekan bulan Agustus tersebut masih sama dengan kondisi harga emas internasional pada penutupan perdagangan pekan lalu, kondisi tersebut didorong sepinya transaksi, tuturnya. Nilai transaksi diperdagangan internasional tersebut juga dialami pada perdagangan lokal yang mengalami penurunan omset seiring belum pulihnya daya beli masyarakat setelah memenuhi kebutuhan sekolah pada tahun ajaran baru, jelasnya.(m40)

Nasib Inalum 2013 Masih Rawan

TANAH Dijual Jl. Roso Gg. Melati 5 Mariendal, Uk. 10x15m, Haga 43 Jt Hub. 0812.605.1602

LOKASI: JL. DURUNG - PANCING Strategis Utk hunian, Bisnis & Investasi


1.TANAH DIJUAL & Bangunan di Jl. Rumah Potong Hewan Gg. Pribadi No. 72/ 70, Lk. IX Kelurahan Mabar, Dengan Luas ± 160,625m2, Sertifikat Camat 2.TANAH Dijual Seluas ± 520m2 di Jl. Garu II Lingkungan XII Kelurahan Harjosari I Kecamatan Medan Amplas, Sertifikat Camat (dekat Perumahan Villa Harjosari I) Yang berminat serius hub: (061) 7781.1999 - 0812.6265.326 - Ibu Siahaan


Tanah dan Bangunan Luas ± 350 M2. Jl. Garu II A, No. 52, Dpn Kampus UMN. HP. 0813 7820 6626, 0813 6100 5308


Tanah kosong 19x77m, SHM di Jl. Purwosari/ Krakatau Hub. 0811649262/ TP


L. 1200m, P. 60x20m, Ada rumah Sederhana, 2 KT, 1 KM, Long elite, Strategis, 2 SHM, Bebas banjir, Pgr keliling Jl. Purnawirawan No. 55 Medan (B.U), Hrg nego Hub. 0812.9219.660 0813.8121.3084

mut Manerep Pasaribu, Ketua Otorita Asahan Efendi Sirait dan pengusaha Rahmat Shah. Topik yang akan disampaikan pembicara masingmasing adalah keberadaan PT Inalum dan Kelanjutan Kerja Sama Patungan Indonesia-Jepang, keberadaan PT Inalum dan kebutuhan pengusaha kecil menengah dan besar terhadap produk aluminium, keberadaan PT Inalum sekarang dan Pasca 2013 dan keberadaan PT Inalum dari kacamata ekonomi nasional dan internasional. Seminar dengan moderator Rektor Universitas Dian Nusantara (UDNAS) Medan Prof. Aldwin Surya dan comoderator Kepala LKBN Antara Sumut Suchyar D.H. Putra itu akan diikuti sekitar 250 peserta dari berbagai kalangan mulai cendikiawan, akademisi, pejabat instansi terkait, pengusaha dan unsur masyarakat lainnya. (m38)

Waspada/Sukri Falah Harahap

Wakil Walikota Padang Sidimpuan, Mara Gunung Harahap, disaksikan pimpinan dan pegawai BRI Cabang Padang Sidimpuan, melepas balon berhadiah pada pembukaan Pesta Rakyat Simpedes di Alaman Bolak Padang Nadimpu, Sabtu (1/8).

Nasabah BRI Sibuhuan Raih Hadiah Utama P.SIDIMPUAN (Waspada): Hilal Muktar Parinduri yang merupakan nasabah Bank Rakyat Indonesia (BRI) unit Sibuhuan, Kab.Padang Lawas, meraih hadiah utama Pesta Rakyat Simpedes berupa mobil Suzuki APV. Penarikan undian dilakukan di Alaman Bolak Padang Nadimpu pada akhir acara akbar Pesta Rakyat Simpedes,





Uk. P. 16x L. 10m, Serta Jl. Zein Hamid Gg. Manggis 55 arah T. Kuning Gang 4 mtr aspal daerah 75% Chines, Ada List dan PDAM ex bengkel, Harga Rp. 120 Jt/nego Hub. (061) 7773.1886/ Syukri


Penyakit lumpuh/ strok, kaku melangkah, kaki bengkak, sudah buang air kecil & air besar Pria/ wanita, sesak nafas, darah tinggi, sakit pula pening/ migren, asam urat, perut keras, sakit tenggorokan dll. Gangguan kejiwaan, perbuatan orang & orang halus. cara pandang tajam, bicara-bicara sendiri, selalu merasa takut, dll Hub. PAK JALAL (0852.9724.9457) Alamat: Jl. Ikhwanul Muslimin Lr. Ikhlas No. 3 Paya Geli masuk galon Gg. Jadi Atau Gg. Damai depan Asrama Abd. Hamid Jl. Binjai Km. 10


Tanah Kavlingan, Siap bangun (KSB), Uk. 15x20m (SHM) 12x26m, SK Camat di Desa Mas Kabu Kec. Beringin ± 3 Km dari Airport Kwala Namu Harga Rp. 35 Jt Hub. 0819.866.311


A. 5x15 Rp. 7 Jt, 9x15 Rp. 14 Jt, ML B. Rmh, 4,5x11 Rp. 25 Jt, 8x11 Rp. 30 Jt, TB C. Rmh, 4x12,50 Rp. 35 Jt, MR


Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di TVRi Tgl. 15 & 25 Juli 2009 Jam 20.00 WIB

Call Center: 0818 090 73481

Jl. Setia Budi No. 49 A 8223975




PERABOT SPECIALIST SOFA (REPARASI & TEMPAHAN) K. Sofa, Makan, Kantor, Jepara, Spring bed, Ganti Kain/ Kulit + Busa, NB. Terima tukar tambah sofa Ayong 662.8642 - 0813.6153.6320

Pengobatan Alat Vital H. Suhendar


Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

HarianWASPADA Tempat Iklan Anda

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan Mahar kekerasan, tambah Rp. 500 ribu kuat dan tahan lama dalam berhubungan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan

Telp. (061) 663.4220



Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB





Keterangan lebih lengkap silahkan hubungi:

* Format: JPG - TIFF (Photoshop)

Untuk keluhan dan pengaduan silahkan hubungi langsung:



TELPON : 061 - 4576602 FAX : 061 - 4561347

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhati-hati terhadap pengobatan sejenis yang mengaku-ngaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802



PROGRAM COMPUTER ELDASOFT * Utk: - Toko - Bengkel - Swalayan - Produksi - Grosir * Garansi Seterusnya Single User 1 Juta Multi User 2 Juta SEMUA COMPUTER Telp. 0888.503.8877/ 0812.350.3536



CHONG I MIN Toko obat “Makmur Raya” Jl. Surabaya No. 75 Toko Obat “BOGOR” Jl. Bogor No. 69 jam 09.00 - 12.00 17.00-18.00 wib

Ada Simpan Logam Yasin 7 Ciri2nya: Orang bongkok pikul karung dan jinjing ember (tas) kiri kanan gbr Padi dan Kapas Berminat hub. 7773.1886 Mahar Nego




Ahli penyakit dalam dan penyakit lever


Kavling Siap Bangun (KSB), Taman Sakura Indah Tj. Selamat dekat P. Melati Blok C 39, 35 Jt, Uk. 12x12m: 144m2 Hub. 0813.7620.0805 0813.7620.0806

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802


MENGOBATI: - Belum mempunyai keturunan - Tumor, Kanker payudara - Kista, Mioma, Tumor rahim Tanpa operasi, Dengan ramuan tradisional Hub. 0813.6115.0061



Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Minggu (2/8), yang digelar selama dua hari di Padangsidimpuan. Hadiah utama tersebut diserahkan secara langsung oleh Pemimpin Cabang (Pincab) BRI Padangsidimpuan Memet Nurhikmat, didampingi Asisten Manager BM Poniman, dan staf BRI lainnya, kepada perwakilan BRI Unit Sibuhuan. Selanjutnya diserahkan


Hub. (061) 457.0929 Mdn Perantara Hadiah 2,5%


Dijual kebun kelapa Sawit Seluas ± 24 Ha, Telah menghasilkan ± 18 Ton/ bulan, Surat SK Camat, Tahun Tanam 2002, Lokasi: Labuhan Batu, Peminat serius hub. Sdr. Dimas HP. 0878.6867.5275

sen untuk memenuhi kebutuhan dalam negeri sesuai perjanjian induk Indonesia-Jepang. Kalaupun total 100 persen dari kapasitas produksi itu dipasarkan di dalam negeri tetap belum mampu memenuhi kebutuhan aluminium nasional, katanya. Menurut dia, banyak sisi yang akan dibicarakan dalam seminar itu karena keberadaan PT Inalum sejak berdirinya 30 tahun lalu telah menjadi bagian penggerak ekonomi daerah dan nasional sehingga dampak positif keberadaan perusahaan tersebut sulit dirinci dan dipaparkan dengan singkat. Sementara itu Direktur Program Yayasan Pratama Mulya H.O.K.Irwansyah, mengatakan pembicara dalam seminar yang dilaksanakan pada Kamis (6/8) di Aula FEUSU itu adalah Dekan FEUSU Jhon Tafbu Ritonga, Direksi PT Inalum Nasril Kamaruddin, GM PLN Wilayah Su-





Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

Terapi hebat dan luar biasa..!! ingin besar panjang keras kuat hasil ditempat.!!! silahkan dan buktikan datang langsung ketempat praktek kami mengobati dalam waktu relatif singkat dan hasilnya bisa langsung dilihat, pada saat itu juga, bukan sekedar janji, tapi bukti dalam pengurutan kami tambah besar, panjang, kuat, tahan lama, permanen untuk selamanya... Dijamin puas tanpa efek samping no suntik, silikon alami secara tradisional, serta bebas pantangan usia, ras dan agama UNTUK PRIA: UNTUK WANITA: - Jadi Perkasa - Membersarkan payudara - Tambah ukuran panjang 13, 14, 15, 16, 17 - Belum punya keturunan 18, 19, 20 cm - Ingin cepat jodoh - Ukuran besar 2, 3, 4, 5 cm diameter - Buka aura penghasilan - Lemah syahwat, impotensi, ejakulasi dini - Pelaris usaha/ bisnis - Loyo, strouke, ambeyen, diabetes - Pelet penarik cinta - Kencing manis, asam urat, ginjal, dll KAMI MELAYANI PASANG SUSUK DAYA TARIK PENGASIHAN ALAMAT PRAKTEK MENETAP DI HOTEL AMPLAS KAMAR 03 JL. PANGLIMA DENAI NO. 1 DEPAN TERMINAL AMPLAS MEDAN BUKA SETIAP HARI JAM 08.00-21.00 WIB MAHAR RP. 500.000 BERGARANSI NO. KEJARI: 448/5/0170... HP. 0813.6246.3339 NO. DEPKES: B.099/DSI-5/07/2009 HP. 0813.7050.6877

Terapi KEJANTANAN Alat Vital Menjadi JUMBO & PERKASA LANGSUNG DITEMPAT oleh: HAJI SYAIFUDIN (Pakar Pengobatan Alat Vital) Dari Pelabuhan Ratu - Banten Pengobatan Sistem Terapi Serta Ramuan 100% Alami Proses cukup 20 menit langsung terbukti Hasilnya ditempat, Permanen untuk seumur hidup



- Besar, Panjang, Keras - Ejakulasi Dini - Lemah Syahwat - Impotensi, dll


- Memperbesar/ mengencangkan payudara dan indah - Masalah keturunan - Tersedia ramuan tradisional yang berkhasiat mengembalikan keperawanan seperti semula

Reaksi langsung berhasil ditempat

Dijamin tidak ada efek samping BUKAN JANJI TAPI BUKTI Hub Jl. SM. Raja Km. 8 Gg. Kaboja No. 3 Depan Pabrik Getah Amplas Medan Izin: DINKES No. 448/15830.IZIN:KEJATI No. B-279/DSP-5-6-2009 HP. 0813.7040.5888 - 0813.6197.6067

kepada Parinduri, karena tidak hadir. Sebelumnya, Sabtu (1/8), Pesta Rakyat Simpedes itu dibuka Wakil Wali Kota Padang Sidimpuan, Mara Gunung Harahap, yang ditandai pengguntingan pita dan pelepasan balon berhadiah ke udara. Acara penarikan undian Simpedes BRI tersebut juga dibuka Mara Gunung, disaksikan seribuan warga Tapanuli Bagian Selatan dan nasabah BRI Cabang Padang Sidimpuan yang membawahi 5 kabupaten/kota. Selain penarikan undian, Pesta Rakyat Simpedes itu juga dimeriahkan atraksi musik tradisional daerah, lomba musik band, stand bazaar, uang kaget, dan hiburan yang mendatangkan artis dan pelawak dari Jakarta. Menurut AMBM BRI Cabang Padangsidimpuan Poniman, penarikan undian seperti ini dilakukan di seluruh Indonesia. Selain mobil Suzuki, BRI juga memberikan hadiah lainnya. Seperti hadiah keempat berupa TV 29 inci sebanyak 10 unit, hadiah ketiga sepedamotor Yamaha Vega RD sebanyak 5 unit, hadiah kedua sepeda motor Yamaha Vega ZRD sebanyak 5 unit. “Untuk tahun ini, hadiah kita ada sebanyak 21 unit dengan 3 jenis untuk 21 pemenang undian nasabah BRI di Tapsel, Madina, Palas, Paluta, dan Padangsidimpuan,” sebut Poniman. Undian tersebut disaksikan yang mewakili Dinas Sosial Pemprov Sumatera Utara, Dameria, dari Polres Padang Sidimpuan, Aipda Hiras Siregar, dan Notaris, Lili Mardiah, SH. Acara itu dihadiri ratusan nasabah BRI dan seribuan masyarakat. (a20)

Medan Jadi Incaran Produk Jakarta MEDAN (Waspada): Pangsa pasar Medan yang dilatari dengan tingkat pertumbuhan ekonomi tinggi menjadi rebutan berbagai produk pakaian jadi asal Jakarta, yang dibuktikan dengan banyaknya berdiri pusat perbelanjaan modern. Hal itu diungkapkan Lely Karina, Trainer Manager Colours In dan Snoopy Baby usai acara sederhana soft opening outlet di lantai I Medan Fair Plaza Sabtu (1/8) sambil melayani konsumen yang sudah lama mengenai produk pakaian jadi khusus untuk bayi dan anak-anak balita itu. “Kalau diukur dari kualitasnya, patokan harga untuk pakaian bayi (Looney Tunes) dan Snoopy Baby) tidak mahal. Demikian pula untuk pakaian balita 3-15 tahun, colours in dan curly masih tetap berada dengan harga terjangkai oelh masyarakat,” kata Lely. (m23)

Ekonomi & Bisnis


WASPADA Selasa 4 Agustus 2009

RAPBN 2010 Rentan Inflasi


PENJELASAN RAPBN 2010: Menkeu Sri Mulyani Indrawati (tengah) didampingi Menneg PPN/Kepala Bappenas Paskah Suzetta (kiri) dan Deputi Gubernur Senior Bank Indonesia Darmin Nasution memberikan penjelasan seputar Nota Keuangan 2010 yang disampaikan presiden dalam rapat Paripurna Luar Biasa DPR di Jakarta, Senin (3/8). Rancangan Anggaran Belanja Negara (RAPBN) pada tahun 2010 mencapai Rp1.009,5 triliun atau lebih tinggi Rp3,8 triliun dibandingkan RAPBN-P 2009 dengan defisit anggaran 2010 sebesar 1,6 persen dari PDB atau Rp98 triliun.

Harga Raskin Naik Jadi Rp2.150 Per Kg Mulai 2010 JAKARTA (Waspada): Pemerintah memastikan kenaikan harga beras miskin (Raskin) atau beras bersubsidi di 2010 dari Rp1.600 per kg menjadi Rp2.150 per kg. Hal ini disampaikan oleh Menteri Keuangan sekaligus Menko Perekonomian Sri Mulyani dalam acara jumpa pers di Kantor Direktorat Jenderal Pajak, Jalan Gatot Subroto, Jakarta, Senin (3/8). “Harganya jadi Rp2.150 per kg, dari Rp 1.600 per kg dengan kuantum 15 kg,” katanya. Sri Mulyani menjelaskan subsidi beras pada 2010 mencapai Rp11,8 triliun, dengan jumlah rumah tangga sasaran

(RTS) sebanyak 17,5 juta KK dengan durasi selama 12 bulan. Tahun 2010 nanti pemerintah telah mengurangi anggaran subsidi secara keseluruhan dari Rp160 triliun di 2009 menjadi Rp144,4 triliun.( BLT dihentikan Menteri Keuangan sekaligus Menko Perekonomian Sri Mulyani juga menegaskan program Bantuan Langsung Tunai (BLT) tidak akan ada lagi mulai tahun 2010. “Tahun ini tidak ada BLT tapi adanya program PKH (Program Keluarga Harapan) dengan budget Rp1,1 triliun,” tuturnya dalam jumpa pers di Kantor Direktorat Jenderal Pajak, Jalan Gatot

Subroto, Jakar-ta, Senin (3/8). Presiden Susilo Bambang Yudhoyono sebelumnya dalam pembacaan Nota Keuangan 2010 mengatakan akan memberikan perlindungan pada masyarakat miskin atau hampir miskin (near poor). “Salah satu fungsi negara adalah memberikan perlindungan dan menyediakan jaring pengaman sosial (social safety net) kepada masyarakat lapisan bawah. Untuk itu, berbagai program pro rakyat seperti BOS, Jamkesmas, PKH, Beras Bersubsidi, BLT bersyarat, dan sebagainya akan terus diperkuat,” kata SBY. Sementara itu, Menteri

Negara Perencanaan Pembangunan Nasional/Kepala Bappenas Paskah Suzetta mengatakan pada tahun 2010 akan muncul angkatan kerja baru sebanyak 1,7 juta. “Namun lapangan kerja tersedia 1,87 juta jadi akan surplus 170 ribu lapangan kerja. Jika tidak ada pengangguran baru maka 2010 angka pengangguran bisa ditekan. Saat ini jumlah pengangguran 9,25 juta orang,” paparnya. Sementara untuk tingkat kemiskinan, Paskah mengatakan jumlah kemiskinan di 2010 diperkirakan sebesar 12-13,5 persen.(dtc)

Pemerintah Pertajam Prioritas Belanja Pusat JAKARTA (Antrara): Pemerintah akan mempertajam prioritas belanja pemerintah pusat dianggarkan sebesar Rp699,7 triliun untuk mendukung sasaran pembangunan sesuai dengan prioritas Rencana Kerja Pemerintah (RKP) tahun 2010. “Dengan peningkatan efisiensi dan efektivitas belanja pemerintah serta penerapan sistem anggaran berbasis kinerja, saya yakin belanja pemerintah dapat dimanfaatkan secara optimal untuk mencapai sasaran yang direncanakan,” kata Presiden Susilo Bambang Yudhoyono pada Pidato Pengantar RAPBN 2010 dan Nota Keuangan di depan Rapat Paripurna Luar Biasa DPR-RI, di Gedung MPR/DPR, Jakarta, Senin (3/8). Menurut Kepala Negara, prioritas belanja yang akan dipertajam meliputi delapan program. Pertama, memperbaiki kesejahteraan aparatur negara dan pensiunannya. Kedua, melanjutkan seluruh program kesejahteraan rakyat, seperti Program Nasional Pemberdayaan Masyarakat Mandiri (PNPM), dan Bantuan

Operasional Sekolah (BOS). Selanjutnya Jaminan Kesehatan Masyarakat (Jamkesmas), Program Keluarga Harapan (PKH), serta penyediaan beras bersubsidi yang tadinya disebut Raskin. Ketiga, melanjutkan pembangunan infrastruktur transportasi, pertanian, energi, dan proyek padat karya lainnya. Presiden menambahkan, prioritas keempat, mendorong revitalisasi industri dan pemulihan dunia usaha, kelima meneruskan reformasi birokrasi guna mewujudkan pemerintahan yang baik dan peningkatan pelayanan publik. Keenam, meningkatkan anggaran operasional, pemeliharaan, dan pengadaan alutsista TNI. Ketujuh, diutarakan Presiden, perlu mempertahankan anggaran pendidikan minimal 20 persen dari anggaran belanja negara. Sedangkan ke delapan yaitu meningkatkan kualitas pengelolaan sumber daya alam dan kapasitas penanganan perubahan iklim. Di sisi lain pemerintah memberi perhatian kepada tiga sektor ekonomi akan menunjang upaya pe-

mulihan ekonomi pada 2010 dengan mengalokasikan anggaran sebesar Rp61,2 triliun. “Dalam rangka menunjang upaya pemulihan ekonomi yang didukung oleh pembangunan pertanian, infrastruktur, dan energi, dalam tahun 2010, pemerintah merencanakan alokasi anggaran sebesar Rp61,2 triliun,” kata Presiden Susilo Bambang Yudhoyono. Presiden menyatakan hal itu dalam pidato Penyampaian Pengantar RAPBN 2010 dan Nota Keuangan di depan rapat paripurna luar biasa DPR di Gedung MPR/DPR Jakarta, Senin. Menurut dia, hasil (outcome) yang ingin dicapai dengan alokasi anggaran itu antara lain, tercapainya laju pertumbuhan ekonomi setidaknya 5,0 persen, dan meningkatnya investasi dalam bentuk pembentukan modal tetap bruto (PMTB) sebesar 8,5 persen. Selain itu menurunnya tingkat pengangguran terbuka menjadi 8 persen dari angkatan kerja, dan meningkatnya produktivitas dan akses UKM kepada sumber daya produk-


Pemerintah juga memberikan perhatian kepada masalah perubahan iklim dan kualitas pengelolaan sumber daya alam (SDA). Dalam rangka mendukung upaya Meningkatkan Kualitas Pengelolaan SDA dan kapasitas penanganan perubahan iklim, dalam RAPBN tahun anggaran 2010 ini, pemerintah mengalokasikan anggaran sebesar Rp4,3 triliun. Hasil yang diharapkan antara lain adalah meningkatnya kapasitas mitigasi dan adaptasi perubahan iklim, dan meningkatnya pelaksanaan rehabilitasi dan konservasi sumber daya alam melalui upaya rehabilitasi hutan, penanganan illegal logging, pengelolaan pertambangan secara berkelanjutan, dan pengendalian pencemaran lingkungan. Selain itu juga meningkatnya upaya pengelolaan sumber daya kelautan melalui pengendalian illegal fishing, dan perbaikan pengelolaan ekosistem wilayah pesisir, laut serta pulau-pulau kecil.

Rupiah Sore Menguat Tipis JAKARTA (Antara): Kurs rupiah terhadap dolar AS di pasar spot antarbank Jakarta, Senin (3/8) naik tipis 10 poin menjadi Rp9.910-Rp9.920 per dolar dibanding penutupan akhir pekan lalu Rp9.920Rp9.935, karena pelaku pasar masih membeli mata uang ini. Ekonom Standard Chartered Bank, Fauzi Ichsan di Jakarta, Senin (3/8) mengatakan, kenaikan rupiah terjadi karena investasi asing di pasar domestik masih berlanjut, akibat berkurangnya tekanan negatif dari krisis keuangan global. “Dengan makin membaiknya aktifitas pelaku asing me-

lakukan investasi baru di dalam negeri maka pergerakan rupiah akan cenderung meningkat, “katanya. Rupiah, menurut dia, pada akhir tahun ini akan bergerak naik hingga mencapai Rp9.500 per dolar, meski posisinya saat ini berada pada kisaran antara Rp9.900 hingga Rp10.000 per dolar. “Kami optimis pergerakan rupiah saat ini berada dalam kisaran yang tidak melebar terlihat dari kenaikan rupiah relatif kecil,” ucapnya. Fauzi Ichsan mengatakan, rupiah pada tahun 2010 juga akan makin membaika men-

Harga Emas Di Medan Jenis



London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp304.000 Rp290.000 Rp260.000 Rp230.000 Rp165.000 Rp100.500

MEDAN (Waspada): Pengamat ekonomi di Medan menilai dari berbagai indikator yang diumumkan Presiden Susilo Bambang Yudhoyono dalam RAPBN (rancangan anggaran pendapatan dan belanja negara) 2010 sangat rentan inflasi. Sebab berbagai indikator menunjukkan gejala kenaikan harga sudah kelihatan tanpa dibarengi kebijakan moneter yang bisa mengendalikannya, kata dia. Vincent Wijaya, pengamat ekonomi di Medan, dihubungi Senin (3/8), untuk menganalisa RAPBN tersebut. Hasilnya dari beberapa indikator yang dapat dibacanya menunjukkan akan terjadi kenaikan inflasi sepanjang tahun tersebut. Pertama, menurut dia, dilihat dari BI rate yang akan dipatok pada level 6,5 persen. Menurunnya suku bunga pasti akan mempengaruhi tingkat inflasi yang dipatok pada level lima persen, jelas-

nya. “Kalau suku bunga terlalu rendah saya yakin itu pasti akan mendorong inflasi. Harusnya dihitung-hitung di level berapa agar inflasi tak naik,” kata dia. Lagipula jika dilihat dari faktor yang mempengaruhi ekspansi kredit ke dunia usaha bukan semata-mata tingginya suku bunga, tapi pada daya beli yang masih lemah, jelas Vincent. “Saya ingat dulu suku bunga sempat 36 persen. Tapi kita mampu. Karena keuntungan paling tidak masih bisa 10 persen per bulan. Dengan rendahnya daya beli sekarang bagaimana mendapatkan untung sebanyak itu,” tuturnya. Se c a ra u m u m p i d a t o RAPBN 2010, menurut dia, masih lumrah dan sesuai tema kampanye SBY untuk menurunkan kemiskinan diiringi kenaikan pendapatan. “Namun angka inflasi sulit direm pada level 5 persen, terutama dengan acuan suku bunga dimaksud,” tandasnya. Dia mengatakan dalam RAP-

lebih baik dari negara lainnya di kawasan ini masih cukup besar, ucapnya. Namun kenaikan rupiah, lanjut Edwin Sinaga, diperkirakan tidak akan melebar jauh, karena pelaku saat ini sedang memfokuskan pada laporan nota keuangan Rancangan Anggaran Pendapatan Belanja Negara (RAPBN) 2010 oleh Presiden Susilo Bambang Yudhoyono. “Kami optimis pelaku masih mempertimbangkan laporan keuangan negara, sehingga peluang untuk membeli rupiah lebih banyak agak berkurang,”ucapnya.

Valuta Asing Di Medan

Mata Uang Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

Jual 9.920 8.225 9.664 16.748 1.389 110,43 7.230 14.523 3.300

Beli 9.910 7.925 9.287 16.305 1.283 105,88 7.000 14.123 3.000

depan. “Walau pertumbuhan ekonomi semakin tinggi berarti ada demand yang meningkat, dengan begitu ada kenaikan pendapatan dan inflasi dalam tingkat wajar.” Namun dari asumsi yang disebutkan Vincent tidak yakin target inflasi bisa dikendalikan pada level lima persen. “Malah yang saya lihat paling penting seperti anggaran infrastruktur hanya naik sedikit.” Padahal ini salah satu upaya mencegah biaya tinggi agar perusahaan juga bisa melakukan percepatan, tuturnya. “Walaupun pembangunan infrastruktur tak terlalu perhatian namun saya punya pendapat.” Proyek infrastruktur tahun depan harusnya langsung dihitung kemudian berapa biayanya kalau pendanaan dalam negeri kurang bisa langsung pinjam dari luar negeri, kata dia. “Ini juga solusi untuk membantu mendorong pertumbuhan ekonomi dan menekan biaya yang membuat cost semakin tinggi.”(m13)

Defisit Tahun Depan Rp98 T JAKARTA (Antara): Pemerintah dalam RAPBN 2010 menetapkan angka defisit sebesar Rp98,0 triliun atau 1,6 persen dari produk domestik bruto (PDB). “Jumlah ini mengalami penurunan sebesar Rp35,0 triliun, bila dibandingkan target yang direncanakan dalam RAPBN-P 2009 sebesar Rp133, 0 triliun (2,5 persen PDB),” kata Presiden Susilo Bambang Yudhoyono dalam Pidato Penyampaian Pengantar RAPBN 2010 dan Nota Keuangan di depan Rapat Paripurna Luar Biasa DPR di Gedung MPR/ DPR Jakarta, Senin (3/8). Kepala Negara menyebutkan,pendapatan negara dan hibah direncanakan mencapai Rp911,5 triliun, atau meningkat Rp38,8 triliun dari sasaran RAPBN Perubahan (RAPBN-P) tahun anggaran 2009. Sementara belanja negara direncanakan mencapai Rp1.009,5 triliun, yang berarti lebih tinggi sebesar Rp3,8 triliun dari yang dianggarkan dalam RAPBN-P tahun 2009. Untuk mencapai sasaran pendapatan negara, pada tahun anggaran 2010 mendatang pemerintah akan terus melanjutkan langkah-langkah optimalisasi penerimaan, baik penerimaan dari pajak maupun penerimaan negara bukan pajak (PNBP). Dari rencana pendapa-tan negara dan hibah yang ditargetkan mencapai Rp911,5 triliun pada 2010, penerimaan

perpajakan Rp729,2 triliun, sedangkan PNBP Rp180,9 triliun. Penetapan besaran RAPBN 2010 itu didasarkan kepada berbagai asumsi makro ekonomi yaitu pertumbuhan ekonomi sekitar 5,0 persen, tingkat inflasi 5,0 persen, dan nilai tukar rupiah rata-rata Rp10.000 per dolar AS. Selain itu suku bunga SBI 3 bulan rata-rata 6,5 persen, harga minyak mentah Indonesia di pasar internasional 60 dolar AS per barel, dan “lifting” minyak mentah Indonesia diharapkan dapat mencapai 965.000 barel per hari. “Dalam suasana ekonomi dunia yang masih belum stabil, risiko terjadinya perubahan berbagai asumsi makro pada tahun 2010 tetap harus kita antisipasi, dengan menyiapkan berbagai kontijensi,” kata Presiden. Pemerintah menetapkan

tema “Pemulihan Perekonomian Nasional dan Pemeliharaan Kesejahteraan Rakyat”, sebagai Tema Rencana Kerja Pemerintah (RKP) 2010. “Hal ini sejalan dengan tantangan global dan nasional yang masih terus berlangsung hingga tahun 2010, serta tujuan kebijakan nasional yang akan kita capai,” kata Presiden. Sesuai dengan tema tersebut, dalam RKP tahun 2010 ada lima agenda program pembangunan nasional. Kelima agenda tersebut adalah, Pertama, pemeliharaan kese-jahteraan rakyat utamanya masyarakat miskin, serta penataan kelembagaan dan pelaksanaan sistem perlindungan sosial. Kedua, peningkatan kualitas sumber daya manusia Indonesia. Ketiga, pemantapan reformasi birokrasi dan hukum, serta pemantapan demokrasi dan keamanan nasio-

nal. Keempat, pemulihan ekonomi yang didukung oleh pembangunan pertanian, infrastruktur, dan energi; dan Kelima, peningkatan kualitas pengelolaan sumber daya alam dan kapasitas penanganan perubahan iklim. Dari kelima agenda tersebut dan memperhatikan arah Rencana Pembangunan Jangka Menengah Nasional ke-2 (RPJMN ke-2), dari Rencana Pembangunan Jangka Panjang Nasional (RPJPN) 2005-2025, maka RKP 2010 disusun dengan tujuan untuk lebih memantapkan penataan kembali Indonesia di segala bidang. “Penataan dilakukan dengan menekankan upaya peningkatan kualitas sumber daya manusia, termasuk pengembangan kemampuan ilmu dan teknologi, dan peningkatan daya saing perekonomian,” kata Presiden.

Disperindag Turunkan Tim Pemantau Harga MEDAN (Waspada): Dinas Perindustrian dan Perdagangan (Disperindag) Medan akan segera menurunkan tim pemantau pergerakan harga sejumlah bahan pokok menjelang Ramadhan seiring akan meningkatnya kebutuhan masyarakat. Menurut Kadisperindag Medan melalui Kepala Tata

XL Ramadhan Rame

capai Rp9.000 per dolar yang menunjukkan investasi asing di dalam negeri akan semakin tinggi. Aktifnya asing melakukan investasi menjadi faktor utama mendukung pertumbuhan ekonomi nasional akan semakin tumbuh dengan baik, ucapnya. Sementara itu, pengamat pasar uang lainnya, Edwin Sinaga mengatakan, kenaikan rupiah saat ini karena over optimistis (keyakinan yang berlebihan) pasar. Pelaku pasar masih melihat potensi Indonesia untuk memberikan keuntungan

BN juga akan ada kenaikan gaji pengawai negeri sipil dan TNI/ Polri. Faktor ini pun otomatis mendorong inflasi sebab sebelum pengumuman kenaikan gaji saja biasanya pedagang sudah mendorong harga tinggitinggi, katanya. “Begitupula kalau kita lihat asumsi harga minyak di level 60 dolar AS per barel akan ikut mempengaruhi.” Hubungannya, kata dia, bisa dilihat dengan ketika Eropa, Jepang dan Amerika tahun depan bisa masuk tahap recovery (pemulihan) dari krisis global. Jika ini yang terjadi pasti permintaan minyak akan naik sehingga dengan sendirinya harga naik, tuturnya. Dengan hitungan seperti itu, dalam pidatonya SBY tidak menyebut apakah 2010 ada kenaikan harga bahan bakar, namun andai itu terpaksa ditempuh pemerintah inflasi pasti naik lagi, ucap Vincent. Sehingga dia melihat ada banyak faktor yang membuat inflasi pasti sangat tinggi tahun

RAMADHAN telah menjelang. PT Excelcomindo Pratama Tbk (XL) sebagai operator terbesar di Indonesia mempersiapkan berbagai layanan telekomunikasi untuk mendukung aktivitas seluruh pelanggan. Berbagai layanan XL yang dikemas melalui program XL Ramadhan Rame adalah kartu perdana Rp2.000, promo tarif murah telefon dan SMS untuk XL prabayar, paket internet murah, berbagai konten VAS (Value Added Services) dan XL BlackBerry yang inovatif dan Islami (RBT Ramadhan, Dakwah Ramadhan, BlackBerry Qur’an, SMS Infaq, dll), hingga posko mudik dan mudik bareng. Peluncuran Peluncuran Program XL Ramadhan Rame berlangsung pekan lalu di Parkir Timur Senayan, Jakarta, oleh Presiden Direktur XL Hasnul Suhaimi dan dimeriahkan GIGI, Yovie & Nuno, Vagetoz, Vidi Aldiano, Hijau Daun, Mbah Surip, Luna Maya, Raffi Ahmad, Putri Titian dan Jodi. Hasnul Suhaimi mengatakan Ramadhan merupakan bulan suci bagi umat Islam, bulan penuh kebaikan dan berkah yang ditunggu-tunggu termasuk pelanggan XL. Momentum Ramadhan juga menjadi kesempatan bagi XL untuk lebih maksimal melayani pelanggan yang membutuhkan sarana telekomunikasi selular. “Untuk itu kami menyediakan berbagai layanan yang akan memberikan manfaat lebih, tidak hanya dari sisi tarif yang semakin murah, namun juga maupun fungsi layanan yang semakin maksimal,” katanya. Mulai 1 Agustus 2009, XL menghadirkan kartu perdana XL pulsa isi Rp2.000. Dengan membeli kartu perdana baru tersebut pelanggan akan langsung bisa mendapatkan berbagai keuntungan. Ramadhan tahun ini XL akan memberlakukan promo tarif yang spesial sehingga sekarang pelanggan akan lebih cepat mendapatkan tarif nelfon Rp 0,01 sampe puas ke sesama nomor XL. Selain itu, XL prabayar juga masih akan dapat kesempatan mendapatkan promo tarif SMS yang semakin seru. Caranya mudah, pelanggan cukup mengirimkan 8 SMS dengan tarif Rp150 per SMS setelah itu mendapatkan bonus 300 SMS. Tidak ketinggalan, selama Ramadhan berlangsung pelanggan XL prabayar dan XL pasca bayar akan dapat menikmati tarif paket internet yang sangat murah. Selain itu masih banyak layanan lain.

Usaha T Shofin Azhar, Senin (3/8), tim pemantau perkembangan harga tersebut segera diterjunkan ke sejumlah pasar tradisional dan plaza di Medan dalam waktu dekat. Harga bahan pokok Indikasi pergerakan harga bahan pokok tersebut saat ini mulai terlihat, walaupun secara umum masih stabil sebagian bahan pokok mulai mengalami kenaikan diantaranya telur dari Rp800 per butir dijual Rp900 per butir, sebutnya. Diperkirakan harga kebutuhan pokok khususnya untuk kebutuhan rumah tangga akan mulai mengalami kenaikan secara bergelombang pada dua hingga satu pekan menjelang bulan Ramadhan, sebutnya. Mengantisipasi hal itu Pemko Medan melalui Disperindag akan melaksanakan pasar murah sebanyak 115 titik tersebar di 21 kecamatan dengan menitikberatkan di wilayah utara khususnya daerah berpenduduk mayoritas ekonomi lemah, tuturnya. Bahan pokok akan mengalami kenaikan cukup signifi-

kan biasanya terjadi pada harga telur ayam, mentega, tepung terigu, minyak goreng, kacang tanah, gula putih dan lainnya akibat tingginya permintaan sebagian besar warga di Medan, ujarnya. Dalam kesempatan tersebut Shofin menjelaskan pasar murah digelar akan menekan peluang para spekulan yang menaikkan harga barang untuk mengambil keuntungan ditengah meningkatnya kebutuhan masyarakat saat itu, jelasnya. Pasar Murah Pasar murah digelar sebanyak 115 titik dengan pasokan sesuai kebutuhan masyarakat seperti minyak goreng, terigu, mentega, gula pasir, telur ayam, kacang tanah dan lainnya akan dijual dengan harga dibawah standar grosir, katanya. Diharapkan pasar murah dapat digunakan sebaik-baiknya oleh masyarakat sehingga mampu menekan aksi para spekulan di pasar-pasar sehingga harga barang kebutuhan masyarakat dapat bertahan dan normal seperti hari biasa, sebutnya.(m40)

Kadin Minta Pemerintah Susun UU Pembebasan Lahan JAKARTA (Antara): Kamar Dagang dan Industri (Kadin) meminta pemerintah menyusun rancangan undang-undang pembebasan lahan pada 2010 untuk mendukung pertumbuhan ekonomi yang ditopang oleh kelancaran pembangunan infrastruktur. Ketua Umum Kadin MS Hidayat usai mengikuti rapat paripurna APBN 2010, di Senayan, Jakarta Senin (3/8) mengatakan, RUU pembebasan lahan tersebut dimaksudkan sebagai jaminan adanya kepastian hukum dalam pembangunan infrastruktur. “Harus ada kepastian hukum, kami usulkan pemerintah harus buat RUU pembebasan lahan untuk pembangunan jalan tol, pelabuhan, sehingga setelah infrastruktur menjadi proyek pemerintah, harganya di freeze,” katanya. Menyinggung anggaran tahun 2010, menurut dia anggaran infrastruktur masih dibutuhkan dalam menopang sektor riil selain itu Khusus mengenai infrastruktur tahun depan pemerintah harus sudah memetakan proyek infrastruktur yang di danai APBN dan yang dibiayai swasta. “Dulu pemerintah belum berani dan ragu, sekarang harus berani (menyusun RUU Pembebasan Lahan). Sekarang kan pemerintahnya sudah kuat,” katanya. Selain itu, kata Hidayat, untuk mendukung semua proses anggaran pemerintah tahun 2010, maka pemerintah harus meningkatkan lagi proses reformasi birokrasi termasuk dalam disiplin anggaran dengan menggunakan sistem “reward” dan “punishment”. Ia mencontohkan reformasi birokrasi dapat dilakukan dengan melakukan tindakan-tindakan menghi-langkan aspek senioritas tanpa berbasis kemampuan.

Sumatera Utara

WASPADA Selasa 4 Agustus 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:29 12:36

‘Ashar 15:58 16:11 15:59 16:06 16:06 16:02 15:59 15:55 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46



Shubuh Syuruq


19:57 20:14 19:58 20:08 20:06 19:57 19:57 19:52 20:00

04:51 05:00 04:51 04:56 04:56 04:59 04:52 04:48 04:54

05:01 05:10 05:01 05:06 05:06 05:09 04:52 04:58 05:04

Langsa 12:36 L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:31 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28

06:21 06:31 06:22 06:26 06:27 06:29 06:23 06:18 06:25

Zhuhur ‘Ashar 16:01 16:04 15:57 15:57 16:08 15:56 15:57 15:57 15:53





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:47 18:52 18:42 18:42 18:54 18:37 18:40 18:39 18:36

20:01 20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49

04:52 04:54 04:50 04:49 05:00 04:52 04:50 04:51 04:49

05:02 05:04 05:00 04:59 05:10 05:02 05:00 05:01 04:59

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:46 12:33 12:32 12:34 12:44 12:37 12:34 12:40 12:29 12:39

19:00 18:40 18:40 18:43 18:44 18:44 18:44 18:52 18:38 18:48

20:14 19:53 19:53 19:56 19:58 19:58 19:57 20:06 19:51 20:02

05:00 04:54 04:53 04:53 04:57 04:57 04:51 04:56 04:48 04:57

05:10 05:04 05:03 05:03 05:07 05:07 05:01 05:06 04:58 05:07

Tarutung 12:32 T.Tinggi 12:31 Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:38

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:25 06:20 06:19 06:30 06:22 06:21 06:22 06:19

16:11 15:58 15:58 15:59 16:02 16:02 15:59 16:05 15:54 16:04

Warga Batangserangan Demo STABAT (Waspada): Seratusan warga Kec. Batangserangan, Kab. Langkat berunjukrasa di Simpang Dolok Batagserangan, Senin (3/8). Mereka menuntut Pemkab Langkat menutup beberapa usaha galian C di Sungai Batagserangan yang secara tidak langsung menjadikan abrasi. Dalam kesempatan itu Camat Batangserangan Rizal Gultom yang memantau unjukrasa tidak dapat berbuat banyak dengan aksi yang dilakukan masyarakat. ‘’Mungkin ada kesepakatan antara pengusaha dan warga yang belum tercapai. Upaya musyawarah telah kami lakukan meskipun belum membuahkan hasil maksimal,’’ katanya. Kadis Pertambangan Kab. Langkat Iskandar menuturkan, akan membahas solusi. (a38/a01)

Cabuli Gadis Di Bawah Umur Masuk Sel BINJAI (Waspada): Pria IP alias Putra, 20, warga Dusun IV, Simpang Namo Buah, Desa Namo Ukur Utara, Kec. Sei Bingai, Senin (3/8) pukul 04:00 diringkus anggota Reskrim Polresta Binjai dengan tuduhan memperkosa. Penangkapan itu dilakukan setelah adanya laporan orangtua korban telah diperkosa tersangka dengan No. Pengaduan LP 650/VIII/2009 /SPK-C tertanggal 2 Agustus 2009, korban diperkosa tersangka di rumah tersangka pada tanggal 1 Juli 2009 lalu. Kapolresta Binjai, AKBP Roberts Kennedy melalui Kasat ReskrimAKP MuhamadTaufik ketika dikonfirmasi membenarkan. Menurut Kasat, terjadinya pencabulan yang dilakukan tersangka kepada korban, saat siang di mana orangtua korban maupun orang tua tersangka tidak berada di rumah. Di mana, jarak rumah tersangka dengan rumah korban hanya 30 meter, begitu dilihatnya korban bermain-main lalu dipanggil. Setelah dibujuk rayu korban dengan diiming-imingi uang Rp 1.000 dan diajak nonton “VCD porno” setelah nafsu birahi memuncak langsung memperkosanya. (a04)

Terlibat Narkoba Tiga Pria Diamankan BINJAI (Waspada): Sat Narkoba Polresta Binjai, dipimpin KBO (Kaur Bin Ops) Iptu Arnold, Minggu (2/8) pukul 02:00 meringkus tiga pria terlibat kasus narkoba. Ketiga pria itu, HU, 23, warga Desa Sei Penjara, Kec. Kuala, Langkat dan RA, 43, warga Jalan Imam Bonjol, Gang Melati, Kel. Setia, Kec. Binjai Kota dan MY, 24, warga Simpang Marcapada Pantai SB, Kel. Bakti Karya, Kec. Binjai Selatan. Guna pengusutan, selanjutnya tersangka bersama barang bukti 1 paket shabu seharga Rp500.000 diamankan di balik terali besi tahanan narkoba Polresta Binjai. KapolrestaBinjaiAKBPRobertsKennedymelaluiKasatNarkoba AKP Eko Hartanto ketika dikonfirmasi membenarkan. (a04)

Agen Togel Dan Bandar Diringkus BINJAI (Waspada): Anggota Reskrim Polresta Binjai di bawah pimpinan Kanit Judi Susila, Ipda AktaWijaya P, Senin (3/8) pukul 13:30 meringkus bandar togel, SB alias Ipul, 43, warga Jalan Saman Hudi, Kel. Berngam, Kec. Binjai Kota. Tersangka diringkus di salah satu warung kopi di Jalan Samanhudi, Kel. Berngam, Kec. Binjai Kota. Sementara Z, 44, warga Timbang Langkat, Kec. Binjai Timur sebagai agen togel diringkus pada hari yang sama juga dari salah satu warung. Kapolresta Binjai KBP Roberts Kennedy melalui Kasat Reskrim AKP Muhamad Taufiq ketika dikonfirmasi membenarkan.(a04)

Wabup DS Lepas Kirab Satgas Tangkal Nafza LUBUK PAKAM (Waspada): Wakil Bupati Deliserdang H Zainuddin Mars melepas kirab Satgas Tangkal Nafza (Narkotika, Psikotropika dan Zat Adiktif lainnya) Kwarda Gerakan Pramuka Sumut, di Taman Pramuka Lubuk Pakam, Senin (3/8). SatgasTangkal Nafza dilepas keberangkatannya secara estafet menuju Kab. Serdang Bedagai untuk selanjutnya menuju Kota Pinang, Kab. Labuhanbatu Selatan (Labusel). Zainuddin Mars yang juga Wakil Ketua Mabicab Pramuka didampingi Ka Kwarcab Deliserdang Drs H Azwar S, MSi menekankan, agar anggota Pramuka benar-benar bebas dari narkoba danharusmampu sebagaikaderpenyuluhditengah-tengahgenerasi muda untuk menjelaskan tentang bahaya narkoba. (a05)

HUT Ke-64 RI Jadi Momentum Perubahan LUBUK PAKAM (Waspada): Wakil Bupati Deli Serdang H Zainuddin Mars minta panitia peringatan HUT ke-64 RI Kab. Deliserdang mempersiapkan acara agar jauh lebih baik dari tahun lalu. “Saya tidak ingin peringatan hari bersejarah bagi bangsa ini dibuat asal-asalan,tapi jadikanlah peringatan itu menjadi momentum introspeksi diri” tegas Wabup H Zainuddin pada rapat panitia peringatan HUT RI ke 64 dihadiri unsur Muspida serta para Kepala Dinas sejajaran Pemkab Deliserdang di aula Cendana kantor bupati di Lubuk Pakam, Jumat (31/7). Menyangkut pameran pembangunan yang mulai dibuka 7 Agustus mendatang,Wabup juga minta agar pameran bisa bermanfaat bagi masyarakat termasuk memberikan informasi yang dibutuhkan. (a05)

Zhuhur ‘Ashar 15:57 15:56 15:54 16:01 15:59 15:55 15:57 15:54 15:54 16:04




Shubuh Syuruq

18:39 18:41 18:35 18:42 18:43 18:39 18:40 18:36 18:35 18:51

19:53 19:54 19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05

04:52 04:49 04:52 04:59 04:54 04:48 04:51 04:51 04:51 04:54

05:02 04:59 05:02 05:09 05:04 04:58 05:01 05:01 05:01 05:04

06:23 06:20 06:22 06:29 06:24 06:19 06:21 06:21 06:21 06:24

Tubrukan Beruntun Di Jalinsum T. Morawa, 2 Tewas

Gadis Kurang Waras Tewas Tenggelam Di Galian C SEI RAMPAH(Waspada): Warga Desa Sei Nagalawan, Kec. Perbaungan,Kab.SerdangBedagaidihebohkandenganpenemuan sesosok mayat wanita yang tewas tenggelam di dalam kolam bekas galian C, Jumat (31/7) sekira pukul 19:00. Mayat perempuan yang ditemukan itu adalah Arbaiyah, 38, gadis kurang waras warga desa setempat. Menurut informasi yang diperoleh melalui Salamah, 90, ibukandungkorbandidampingisuaminyaTalib,93,menceritakan, seperti biasa dirinya pergi bekerja di kilang batu milik A Huat yang berada tidak jauh dari kediaman mereka. “Biasanya korban tinggal di rumah bersama ayahnya, karena penglihatan serta pendengaran suamiku (ayah korban-red) terganggu. Pada waktu itulah mungkin Arbaiyah tidak terpantau oleh ayahnya. Arbaiyah memanfaatkan kelengahan ayahnya itu kemudian pergi dari rumah”. Begitu aku pulang, ujar ibu korban yang sudah lanjut usia itu, dari tempat bekerja sekira pukul 17:30, dia tidak melihat putri ke tiga dari tujuh bersaudara itu yang memiliki penyakit gangguan saraf. Karena korban tidak kelihatan kemudian dia berusaha untuk mencari Arba’iyah di rumah tetangga dan keluarga, namun putrinya tidak berhasil ditemukan. Akhirnya korban ditemukan berada di dalam sumur bekas galian C di desa setempat tidak sudah tidak bernyawa lagi. Kapolsek Perbaungan AKP Syahril yang dikonfirmasi melalui Kabag Bina Mitra AKP Syamsul Bahri Lubis, Senin(3/8) membenarkan .(a07)

06:31 06:24 06:24 06:23 06:27 06:27 06:22 06:27 06:18 06:28


GETEK: Warga Kota Kisaran dan sekitarnya, masih menggunakan getek untuk menyeberangi Sungai Silau dengan tarif harga Rp 500 per kepala dan Rp 100 bagi sepeda motor. Menurut mereka, menggunakan geteklebih cepat sampai di tujuan dari pada harus memutar melalui jembatan. Foto direkam, Senin (3/8).

Polres Nias Gagalkan Pencurian Patung Berusia Ratusan Tahun GUNUNGSITOLI (Waspada): Polres Nias melalui petugas Polsek Mandrehe, Sabtu pagi (1/ 8) sekira pukul 04:00 menggagalkan pencurian benda purbakala berupa patung berusia ratusan tahun. Polisi mengamankan truk yang sedang mengangkut patung di kawasan jalan raya Kecamatan Mandrehe. Kapolres Nias melalui Kasat Reskrim, AKP RA Purba kepada Waspada, Senin (3/8) mengatakan, upaya pencurian benda purbakala berupa patung batu dengan nama Gulo Tuhamaokho tingginya mencapai 2 meter lebih digagalkan saat diangkut

truk milik SG warga Mandrehe. Saat truk mengangkut patung yang diambil dari ladang lokasi megalitikum di Desa Lauru Mazingo, Kecamatan Mandrehe Barat, Nias, petugas yang mendapat informasi dari masyarakat langsung melakukan pencegahan dengan mengamankan truk termasuk sopir dan tiga orang kernet. Dari pengakuan sopir truk dan kernetnya di Mapolres Nias terungkap mereka hanya disuruh majikannya berinisial SG alias Ama Linda untuk mengambil patung dan dibawa ke sebuah gudang milik majikan mereka yang terletak di ibu kota Kecamatan Mandrehe dengan bayaran Rp5 juta. Polisi yang mendapatkan keterangan dari sopir dan kernet sebagai saksi langsung menangkap SG dan saat ini ditahan di Mapolres Nias.

Dari hasil penyelidikan polisi , patung tersebut rencananya akan dijual kepada salah seorang kolektor di luar daerah Nias dengan harga mencapai miliaran rupiah. Akhir-akhir ini upaya pencurian khususnya batu-batu megalitikum di Nias semakin meningkat mengingat harga yang ditawarkan oleh calon pembeli cukup menggiurkan. Sementara dari informasi lainnya menyebutkan sejarah patung batu Gulo Tuhamaokho disebut-sebut merupakan sosok seorang raja adat sehari dan merupakan nenek moyang marga Gulo. Selama ini patung dijadikan sebagai lambang kesatuan rumpun marga Gulo. Diperkirakan patung Gulo Tuhamaokho telah berusia 400 hingga 600 tahun. Sedangkan keturunan Gulo Tuhamaokho masih berdomisili di 13 desa di Kec. Mandrehe. (a35)

Sistem Administrasi Kependudukan T. Tinggi Tertinggal TEBINGTINGGI ( Waspada): Walikota H Abdul Hafiz Hasibuan, mengakui saat ini Pemko Tebingtinggi masih berada dalam posisi transisi perubahan sistem administrasi kependudukan yang semula berbasis SIMDUK menuju implementasi Sistem Informasi Aplikasi Kependudukan sesuai UU No.23 Tahun 2006 tentang Adminsitrasi Kependudukan jo Perpres No.25/2008. Hal itu diakui Walikota H Abdul Hafiz Hasibuan, dalam nota jawaban atas pandangan umum fraksi DPRD atas RP.APBD TA 2009, Senin (3/8), dalam sidang paripurna DPRD. Pengakuan itu, terkait dengan pertanyaan fraksi DPRD tentang tidak validnya data kependudukan di Kota Tebingtinggi, khususnya pada pemilu legislatif dan pilpres yang lalu. Dikatakan, ketertinggalan pelaksanaan SIAK itu terkait dengan belum sempurnanya penggunaan perangkat teknik on line, baik di kelurahan maupun di kecamatan yang tersambung dengan Dinas Kependudukan dan Catatan Sipil. Pun demikian, (secara ma-

nual) aplikasi SIAK berstandar nomor induk kependudukan (NIK) dan kartu keluarga 16 digit, telah dimulai pendataannya secara berjenjang mulai dari kelurahan hingga ke kecamatan. “Dengan model ini secepatnya akan diperoleh data kependudukan yang valid, terperinci dan terpelihara dan tidak ganda,” kata Walikota. Walikota menyatakan sistem itu sendiri belum sempurna, karena banyak data yang belum diperbarui secara baik. Alasannya, perangkat on line untuk itu belum tersedia dan terpasang di kelurahan maupun kecamatan yang bersambung dengan Dinas Kependudukan dan Catatan Sipil. Walikota, berjanji sistem itu akan sempurna pada 2010 menunggu bantuan stimulus perangkat keras dan lunaknya dari Depdagri. Terkait hal itu, Ketua Komisi II DPRD H Wan Gunadi menyatakan, persoalan data kependudukan itu sangat penting. Karena itu Pemko Tebingtinggi harus memprioritaskan penyempurnaan administrasi kependudukan. “Kita akan dukung sepenuh-

nya,” kata dia. Sementara Kadis Kependudukan dan Catatan Sipil Eliyas Tarigan, dalam suatu kesempatan, mengakui minimnya anggaran yang disiapkan Pemko Tebing Tinggi untuk dinas itu. Menurut dia, administrasi kependudukan merupakan tonggak pemerintahan yang langsung berhadapan dengan masyarakat. Jika urusan lain orang masih bisa sabar, tapi kalau urusan KTP, KK dan akte orang cepat komplain. Tapi dengan dana yang terbatas, akan banyak kendala yang dihadapi. Eliyas Tarigan menyontohkan, pagu anggaran yang disiapkan untuk Dinas Kependudukan dan Catatan Sipil pada 2010, hanya sekira Rp460 juta lebih saja. Padahal, jika berpijak pada anggaran berbasis kinerja, minimal dinas itu harus memiliki pagu anggaran mencapai Rp670 juta. “ Dana itu tak pakai uang minum,” jelas dia. Diakui pula, pelaksanaan SIAK untuk Kota Tebing Tinggi telah terlambat lebih dari satu tahun. Karena, daerahdaerah lain sudah melaksanakan sistem itu jauh sebelumnya.(a08)

Cinta Ditolak, Pria Lajang Nekad Gantung Diri SEI RAMPAH (Waspada): Bila seorang perempuan cintanya diputus lelaki, banyak yang nekat mengakhiri hidupnya. Tetapi bagaimana dengan seorang lelaki yang cintanya ditolak pacarnya nekad bunuh diri, mungkin hal itu jarang kali terjadi. Hal itu yang dilakukan Rano, 19,warga Dusun XIII Meteran, Desa Firdaus,Kec.Sei Rampah, Kab.Serdang Bedagai. Dia nekat gantung diri dengan menggunakan seutas kain panjang di kamar tidurnya,Senin (3/8) sekira pukul 10:00 karena cintanya ditolak Maya,19, warga Dusun II, Desa Cempedak Lobang, kecamatan yang sama. Menurut keterangan yang Waspada peroleh, Senin (3/8), diketahuinya Rano telah tergantung di dalam kamar tidurnya saat adiknya Restu,10, mau masuk ke dalam rumah, tetapi pintu rumah terkunci dari dalam. Karena tidak bisa masuk Restu mencari akal dan masuk melalui pintu jendela rumah. Begitu dia masuk lalu menjerit sebab melihat abangnya Rano telah tergantung dengan menggunakan selendang. Mengetahui kejadian itu Restu langsung membuka pintu dan memberitahukannya kepada jiran tetangga dan orang tuanya. Ibu Rano yang mengetahui anaknya telah kritis tergantung itu lalu menjerit histeris sehingga mengundang masyarakat datang ke rumah korban untuk mengetahui apa yang terjadi. Saat itu juga Rano dilarikan ke Rumah Sakit Umum Sultan Sulaiman di Firdaus diberikan pertolongan sebab saat baru dimasukkan ke ruang

ICU, jantung Rano tidak berdenyut lagi dan telah berhenti. Namun berkat bantuan paramedis dengan melakukan berbagai upaya akhirnya jantung Rano berdenyut kembali. Hingga pukul 15:00 kondisi Rano masih tidak sadarkan diri. Tidak Mencintai Maya, wanita teman Rano saat ditemui Waspada di Rumah Sakit Umum Sultan Sulaiman mengakui mereka sudah berkenalan selama lima bulan atas bantuan seorang teman. ‘’Tetapi bagi saya hal itu hanya perkenalan biasa bukan ada menjalin hubungan cinta,’’ katanya. Namun yang anehnya, kata Maya, Rano tetap menanyakan kepadanya apakah dia sudah

dilamar. ‘’Kalau sudah mau dilamar saya siap melamarnya,’’ kata Maya menirukan ucapan Rano. Ditanya bagaimana nanti kalau Rano sembuh apakan Maya mau menerima cintanya, saat itu Maya mengeluh dengan mengatakan kepalanya pusing. Sebab, kata Maya bagaimana untuk menerima seorang laki-laki kalau kita memang tidak mencintainya. Ny Istila, Ibu Rano mengakui jika anaknya ada berhubungan dengan Maya. Belakangan keduanya bertengkar hingga putus hubungan. Namun menurut Istila, Rano tetap bersikeras mencintai Maya hingga akhirnya peristiwa itu terjadi. (a07)

Waspada/Eddi Gultom

DIRAWAT: Rano pria lajang yang mencoba bunuh diri di dalam rumahnya, Senin (3/8), hanya karena cintanya ditolak Sabtu (1/8) malam oleh Maya wanita kenalannya. Gambar ini direkam, Senin (3/8).

TANJUNGMORAWA (Waspada): Dua pengendara sepeda motor yang yang diketahui sebagai pasangan suami istri tewas dalam insiden tubrukan beruntun di Jalinsum Km 22, 5 DusunVII DesaWonosari, Tanjung Morawa, 6 penumpang Suzuki Carry mengalami luka-luka. Keterangan yang dihimpun, Senin (3/8),peristiwa maut ini terjadi pada Minggu malam (2/8) sekira pukul 18:30, antara bus penumpang Galan Trans dengan sepeda motor dan mobil minibus Suzuki Cary. Dua korban tewas, Hermansyah, 34, warga Jalan Karya Lingkungan III, Kecamatan Rambutan Tebingtinggi bersama sang istri Nuraini,36. Korban luka-luka adalah penumpang Suzuki Cary, Reza, 8, warga Dusun VI, Desa Citaman Jernih, Perbaungan bersama ibunya, pengemudi Suzuki Cary Ruslan,46, Alamsyah, 46, Kewati,35, dan Eva, 11, semuanya warga Perbaungan. Informasi yang diperoleh, bus penumpang Gala Trans BK 7626 LT melintas dari arah Tebingtinggi menuju Medan . Diduga, Gala Trans

yang melintas dengan kecepatan tinggi hendak melewati bus penumpang yang ada didepannya mengambil jalur kanan. Saat yang bersamaan, dari arah yang berlawanan pengendara sepeda motor Suzuki Smash BK 2508 SW yang dikendarai Hermansyah boncengan dengan istrinya Nuraini yang sedang melintas tidak dapat dielakkan lagi dan langsung menubruk pengendara sepeda motor tersebut. Usai menubruk sepeda motor, Bus Gala Trans juga menabrak mobil minibus Suzuki Carry yang membawa rombongan 8 penumpang yang disebut dari Belawan, serta menubruk pohon yang ada di pinggir jalan. Sedang pengemudi bus penumpang Gala Trans dikabarkan kabur. Jenazah Nuraiani selanjutnya dievakuasi ke RSU Josua Lubuk Pakam, bersama 4 penumpang lainnya, sedang Reza bersama ibunya dilarikan ke RSU Sari Mutiara Lubuk Pakam. Kapolres Deliserdang AKBP Mashudi yang dikonfirmasi melalui Kasat Lantas AKP Efendi Sirait membenarkan. (a06)

Dua Penderita Chikungunya Di Langkat Tewas Kadiskes: Akibat Gangguan Jantung STABAT (Waspada): Dua penderita Chikungunya Abdur Rahim, 56, warga Kel. Bingai, Kec.Wampu, Kab. Langkat tewas di kediamannya Senin (3/8) siang. Korban sejak sepekan silam menderita demam akibat tertular sejumlah tetangga yang menderita penyakit chikungunya. Sebelum meninggal, Rahim tidak dirawat ke rumah sakit karena faktor ekonomi keluarga dan minimnya upaya pencegahan/pengobatan dari petugas instansi terkait. Sepekan sebelumnya warga Kec.

Batangserangan, Jaswadi, 70, juga meninggal dunia diduga kuat terinfeksi chikungunya. Beberapa hari sebelum meninggal korban bersama sejumlah tetangga silih berganti menderita demam yang disimpulkan petugas kesehatan kecamatan terserang chikungunya. Kadis Kesehatan Langkat dr Indra Salahuddin membenarkan tewasnya Jaswadi, Minggu (2/8). Namun dia membantah akibat penyakit chikungunya yang diderita korban, melainkan gangguan pada bagian jantung. ‘’Kami telah cek, tewasnya korban akibat gangguan bagian jantung,’’ katanya. Dalam dua pekan terakhir chikungunya menyerang kesehatan masyarakat di beberapa kecamatan. (a38)

Polres Dairi Ciduk 9 Tersangka Curanmor Dan Baterai Mobil SIDIKALANG (Waspada): Polres Dairi menciduk sembilan tersangka sindikat pencurian sepeda motor dan baterai mobil dari tempat berbeda, Sabtu (1/8). Seminggu sebelumnya polisitelahmengamankanduapelaku kriminal yang sama. Kapolres Dairi, AKBP Marzuki melalui Kabag Binamitra,Kompol RamastenPurbadidampingiKaUrbin Reskrim, Iptu Banuaran Manurung kepada Waspada, Senin (3/7) mengatakan, dari 9 tersangka, tujuh di antaranya berstatus pelajar kelas II dan kelas III salah satu SMA di Sidikalang. Menurut Manurung, SC,17 dan SS,18 keduanya warga Pasar Lama Sidikalangtersangkapelakucuranmor jenis YamahaVega BK 1788 CC milik M.Aritonang. Sepeda motor itu dicuri dari depan rumah korban pada 22

Juli 2009. Sedangkan tersangka lainnya berinisial RS,17 dan YP,17 keduanya pelajar salah satu SMA di Sidikalang, mencuri sepeda motor jenis Honda Kharisma BK 3889 K, dari garasi rumah korban Br Boang Manalu 14 Mei 2009 malam. Kedua sepeda motor diamankan sebagai barang bukti. Sementara, MG,16, RS,16 dan AR,16 pelajar SMA, ketiganya warga Sidikalang adalah tersangka pencuri 1 buah baterai mobil merk GS. Ketiganya kepergok pemiliknya, warga Jalan Tigalingga,Senin(27/7).Pemilikbaterai langsung menghubungi polisi dan pelakunya diciduk. Pelaku lain PS,16, Res,16 dan FP,16 melajar kelas II SMA di Sidikalang, mereka tersangka pencuri 2 baterai merk GS pada 27 Juli 2009. Ketiganya warga Sidikalang. (a28)

Asyik Menceritakan Keburukan Orang, Tiga Pegawai KUA Dilabrak Keluarga Mempelai LUBUKPAKAM (Waspada): Asyik ngerumpi memburukkan keluarga calon pengantin, tiga pegawai KUA Lubuk Pakam dilabrak seorang warga yang baru usai menyaksikan akad nikah yang dipimpin Ka KUA Lubuk Pakam. Senin (3/8). Kericuhaniniberawaldarikedatangan orang tua kandung calon mempelai ke KUA Lubuk Pakam, Jl Diponegoro Lubuk Pakam. Saat itu tiga pegawai KUA itu, N Br H, Y Br H dan seorang temannya yang juga pegawai, terkesan layas melihat keluarga calon mempelai wanita. Taklamakemudian,KaKUALubuk Pakam pun tiba langsung mempersilahkan keluarga kedua mempelai yang sejak lama menunggu masuk ke dalam ruangan khusus untuk melaksanakan akad nikah yang berjalan lancar. Usai akad nikah, lantas keluarga mempelai wanita pun duduk di ruang tamu. Saat itu pulalah tiga pegawai KUA itu terus ‘menggosip’ dengan berbahasa daerah. Tanpa disadarinya, ternyata salah seorang keluarga mempelai wanita mengerti berbahasa daerah yang digunakan tiga pegawai KUA itu. Hal ini pun membuat pria yang sebagai saksi dalam akad nikah tadi bangkit dan menunjukkan sikap rasa tidak senangnya melihat ulah ketiga pegawai KUA. “Sejak dari awal kami datangkalianbertigasudahmenggosip dan memburuk-burukan keluarga mempelai wanita Percuma kalian pegawai di Depar-temen Agama namun perilaku kalian tidak sesuai, malah asyik menceritakan keburukan orang, kalian pikir kalian sudah bagus kali,” tandas pria tadi geram. Mendengar ucapan ini, N Br H pun menjawab, “kami juga kawan bapak itu (orang tua mempelai

wanita-red),” jawabnya tanpa beban bahkan terus saja menyudutkan keluarga mempelai wanita dengan berbahasa daerah. Jawaban ini langsung ditimpal keluarga mempelai wanita.” Ibu ngaku kawan, tapi kawan kok malah dijelekjelekkan, ibu aparat seharusnya netral, kok malah provokator dan memancing suasana keruh, kerja aja yang bagus sudah, ke kantor malah menggosipkeburukanorang,”tandaskeluarga mempelai wanita. Ternyata kericuhan ini terdengar Ka KUA, langsung keluar dari ruang kerjanya dan berupaya meredakan amarah keluarga mempelai wanita yang saat itu juga bersama keluarga mempelai pria, bahkan dua pria pegawaiKUApunturutmeredakansuasana. Parahnya lagi, ketika pria yang berang itu mengajak keluarga pulang guna menghindari emosi yang memuncak, malah N Br H dengan angkuhnya mengatakan, “lebih cepat bagus.” Mendengar itu keluarga mempelai wanita akhirnya kembali terpancing marah dan mengatakan, “ibu perempuan pake jilbab tidak pantas saya lawan karena saya laki-laki, tunjukkan sikapibusesuaiprofesisebagaipegawai Departemen Agama,” kata pria itu sembari meninggalkan KUA Lubuk Pakam. Tokoh agama dan pemuda Deliserdang Akhiruddin menyesalkan ulah tiga wanita pegawai KUA Lubuk Pakam.” Aparat seharusnya pengayom, bukan menceritakan keburukan orang lain apalagi ada warga yang hendak melaksanakan akad nikah di kantor KUA,” katanya. Dia meminta Depag Deli Serdang menindak perilaku bawahannya yang sangat merusak citra Departemen Agama, apalagi menyangkut marwah orang lain.(a06)


WASPADA Selasa 4 Agustus 2009

23 Kizashi Meluncur

Transaksi IIMS Rp 1,7 T Transaksi di ajang Indonesia International Motor Show (IIMS) 2009 yang berlangsung di Jakarta International Expo (JIExpo), Kemayoran, Jakarta 27 Juli sampai 2 Agustus, mencapai target yang ditetapkan, dengan nilai Rp 1,7 triliun. “Dalam hal transaksi, IIMS kali ini mencatatkan total angka mencapai Rp 1,731 triliun,” ungkap ketua pelaksana IIMS 2009 Johnny Darmawan, Minggu (2/8), yang merupakan hari terakhir gelaran. Dengan hasil tersebut, pameran IIMS 2009 kali ini memang agak turun dibanding tahun lalu, tahun 2008 lalu, IIMS mencatat transaksi sekitar Rp 1,8 triliun. Namun hal ini terbilang menggembirakan mengingat ekonomi RI masih terkena dampak krisis global. “Dan dapat dipandang sebagai catatan dan prestasi tersendiri di tengah krisis ini,” ungkap Johny tentang pameran yang diikuti oleh 21 merek mobil, 7 merek motor serta 120 aksesoris kendaraan. 237 Ribu Pengunjung Sementara, meski melebihi jumlah tahun lalu, pengunjung IIMS 2009 belum melewati target yang ditetapkan panitia. Hingga pukul 18.00 WIB, hari terakhir IIMS pada 2 Agustus 2009, jumlah pengunjung yang datang ke ajang otomotif terbesar di Indonesia ini telah mencapai 237.687 orang, masih kecil dibanding target panitia sebanyak 250.000 orang. “Angka pengunjung ini lebih besar dari tahun lalu, tapi memang lebih kecil dari target yang kita tetapkan di 250.000,” ujar Johnny. Namun meski tidak mencapai target, Johnny menilai IIMS sudah cukup sukses. Apalagi melihat angka pengujung ini jauh lebih tinggi dari tahun lalu, padahal ketika akan dilaksanakan, tempat kegiatan di Kemayoran yang jauh dari pusat kota serta situasi ekonomi yang sedang anjlok menimbulkan banyak keraguan. Padahal baru kali ini sejak pertama kali dilaksanakan, IIMS menampilkan industri roda dua dan beragam aksesoris pendukung otomotif serta konser musik di acara ini. Terlebih bila kita bandingkan angka pengunjung harian IMS tahun ini dan tahun lalu. “Bila dulu di JCC pengunjung harian hanya bisa 24.000, di IIMS kali ini bisa menembus angka 35.000. Ini merupakan sebuah prestasi,” tandasnya. (h09)

Honda Manjakan Komunitas Matik Dunia Matik Honda

Honda, pemimpin pasar sepeda motor di tanah air, kembali menggelar acara sebagai ungkapan terima kasih kepada konsumen yang telah mempercayai pilihan terhadap pabrikan berlogo sayap berkepak ini. Para komunitas pemakai sepeda motor skutik (Skuter Otomatik) diundang pihak Astra Honda Motor bersama main dealer di seluruh tanah air, ke Jakarta menyaksikan sederetan artis top dalam rangkaian peluncuran skutik Vario Techno CBS akhir pekan lalu. Para wakil klub yang berangkat tak ayal, pasti merasa beruntung

menyaksikan aksi panggung Agnes Monica, Duo Maia, D’Massive, The Titans serta Afgan dan Cinta Laura di acara yang mereka hadiri ‘Dunia Matik Honda’. Sekitar 63 klub motor matik Honda dari seluruh Indonesia, mulai dari Banda Aceh hingga Jayapura tampak begitu bersemangat menyaksikan peluncuran motor varian teratas skutik Honda ini di Integrity Convention Center Mall Mega Kemayoran, Jakarta Minggu (2/ 8). Acara peluncuran Honda Vario CBS Techno ini sendiri juga dibarengi dengan peluncuran wajah baru dari skutik Honda

yang telah ada yakni New Beat dan New Vario. Para komunitas klub motor matik ini, semuanya diterbangkan dari kota asal, dan setibanya di Jakarta diinapkan satu malam di salah satu Hotel berkelas di Jakarta, semuanya dengan gratis tentunya. Peluncuran motor yang bulan lalu telah diperkenalkan ke media ini, tampak meriah. Apalagi ke-63 klub yang sengaja diundang ini hadir dengan sekitar 228 anggota mereka. Mereka adalah wakilwakil dari komunitas pengguna motor Honda Beat dan Vario. Dari Medan, tampak hadir wakilwakil dari klub HVC (Honda Vario Club), Vanatik, serta De’Beatless.

“Acaranya luar biasa. Kapan lagi bisa jumpa langsung artisartis papan atas beraksi di atas panggung. Apalagi, yang tampil semuanya punya hits, enggak heran kalau kami-kami tadinya histeris,” ungkap seorang pengunjung. Anak-anak klub, yang berbaur dengan ratusan siswa SMU yang juga ikut diundang, terlihat larut setiap kali artis mereka melantunkan lagu. Apalagi para vokalis tersebut tak segan menyambangi mereka berjabat tangan dari panggung. Acara berdurasi 60 menit yang juga disiarkan live RCTI ini seperti berlangsung begitu singkat. Namun, hampir semua yang hadir tampak puas dengan

aksi-aksi yang telah mereka nikmati. “Ini pengalaman yang tak terlupakan. Terima kasih untuk Honda, timpal M. Afandi dari De’Beatless dan Jaka (Vanatik). Semua anggota klub yang hadir di tempat berlangsungnya acara tampak begitu antusias menyaksikan prosesi peluncuran motor matik terbaru Honda itu. “Hadirnya komunitas ini merupakan bentuk apresiasi kami terhadap mereka, karena Honda sangat peduli dengan komunitas-komunitas pengguna motor Honda yang ada,” ucap Marketing Manager CV Indako Trading Co Leo Wijaya SE, MBA didampingi Gunarko Hartoyo. # Armansyah Th

Acura ZDX:

Kombinasi Style, Peforma Dan Teknologi

Waspada/Armansyah Th

Aksi menawan grup band d’massive yang mengisi acara Dunia Matik Honda di ICC, Kemayoran, Jakarta Sabtu (1/8) malam mendapat sambutan meriah dari komunitas Klub Matik Honda.

Acura ZDX hadir dengan tiga tipe yaitu ZDX, ZDX Technology dan ZDX Advance yang paling mewah. Untuk pasar Amerika Serikat, ZDX mengkombinasikansistempenggerak roda canggih Super Handling All WheelDrive(SH-AWD)denganmesin 3.7 literV6 yang memproduksi 300hp dan torsi 366Nm. Bersama Honda’s excellent SHAWD atau Super Handling All-Wheel Drive, Acura ZDX di AS akan ditenagai dengan mesin V6 3,7 liter berdaya 300PS yang mampu menghasilakan torsi 366Nm. ZDXmengkombinasikansisistyle, peforma dan kecanggihan teknologi sports coupe empat pintu dengan fleksibilitas dan commanding pressence SUV. Prototipenya hadir di ajang pameran New York International Auto Show 2009. Versi produksinya mempertahanakan fitur-fitur utama prototipe seperti panoramic glass roof, handle pintu

belakang yang tersembunyi dan fender besar. Bukan hanya tampilannya saja yang dipoles, tapi juga peformanya. Mesin aluminium yang ringan mampu memproduksi daya akselerasi menggetarkan dengan torsi besar di putaran rendah dan menengah. Daya produksi mesin dikelola gearbox 6-speed matik –dikendalikan lewat paddle shifter di kolom kemudimenghasilkan harmoni antara efisiensi dan peforma. SH-AWD mengkombinasikan peforma handling terbaik dengan kemampuan beroperasi disemua musim. Alloy wheel standar berdiameter 19 inch dengan 7 palang. Inilah diameter wheel paling besar di keluarga Acura. Interiornya –seperti layaknya mobil mewah- ZDX menampilkan kesempurnaan tertinggi. Semua bagianinteriordibalutkulityangdijahit tangan seperti kemudi, dashboard,

Honda Vario CBS Techno

Skutik Yang Paling Aman Dan Nyaman Tabir Honda Vario baru yang selama ini menjadi tanda-tanya akhirnya terjawab, karena PT Astra Honda Motor (AHM) telah meluncurkan skuter otomatik (skutik) premium mereka itu, Vario CBS Techno.


Sekali lagi, Honda kembali membuktikan, kalau pabrikan ini selalu terdepan dalam penerapan fitur dan teknologi. Skutik teranyar mereka ini memang sudah dilengkapi fituryang tidak dimiliki para kompetitor, utama-

Kenali Busi Palsu

Maraknya peredaran busi palsu di pasaran kini membuat konsumen harus semakinwaspada. Karena membeli busi palsu itu sesungguhnya merugikan, terutama bila dilihat secara kualitas. Berikut beberapa tips agar konsumen mampu mengenali busi palsu. Sangat sulit untuk mengenali asli tidaknya sebuah busi dari kemasan luarnya saja, jadi konsumen pun harus jeli melihat dan membedakan dari fisik busi itu sendiri. Bagian pertama yang harus diperhatikan, adalah ring busi, dimana ring busi palsu itu mudah dan dapat terlepas. Padahal kalau busi asli bagian ring itu tidak dapat lepas. Bagian kedua yang paling mudah dilihat adalah warna keramik busi. Bila busi asli memiliki warna gading pada keramiknya, tidak begitu pada busi palsu. Sebab biasanya busi palsu memiliki warna keramik yang lebih muda, bahkan cenderung memutih. Yang palsu warnanya lebih muda dan bahkan ada yang putih. Bagian lain yang mampu menjelaskan bahwa busi asli adalah kode produksi busi yang ada di tubuh busi itu. Karena bila busi asli harus ada kode produksinya, yang palsu biasanya tidak ada. Lebihlanjut,bagianlainyangdapat menjadi patokan yakni ada di cetakan yang ada di keramik. Bila busi itu palsu biasanya tulisan di keramik lebih tebal dan kadang tidak simetris. Sementara pada busi asli itu tidak terjadi. Dan yang terakhir, disarankan membeli busi pada distributor besar dan resmi. (h09/bg sumber)

nya Combi Brake System (CBS). Combi brake system adalah cara pengereman yang memudahkan pengendara mengantisipasi segala situasi jalan dengan nyaman. Fitur ini berada di roda belakang yang bila tuas rem belakang ditarik, maka daya pengereman tidak hanya didistribusikan ke roda belakang, namun juga sebagian akan disalurkan ke roda bagian depan. “Dengan mengaplikasi teknologi CBS membuat membuat varianVario Techno menjadi paling aman dari semua skutik yang ada saat ini,” sebut Gunarko Hartoyo dari CV Indako Trading Co (main dealer Honda), yang menemani media Sumut selama peluncuran di Integrity Contenvion Center, Mall Mega Kemayoran, Jakarta Sabtu (1/8) malam. Dengan adanya fitur CBS, maka sistem pengereman pada Vario Techno kini lebih praktis dan nyaman, karena tangan kanan pengendara bisa bebas dan leluasa memainkan selongsonggas,tanpaperlumemikirkan tugas pengereman pada roda depan. Varian baru ini, menurutnya, adalah varian ‘pelengkap’ Honda dimana di pasaran sebelumnya Honda sudah memiliki Vario dan Beat, yang pada hari bersamaan juga tampil dengan wajah baru. Menurut Leo Wijaya SE, MBA, kasta tertinggi dariVario ditawarkan dengan harga menarik, karena tidak berbeda terlalu jauh dengan bandrol Vario CW.“Untuk informasi lebih jelas

anda bisa menyambangi dealerdealer dan show-room Honda terdekat,” sebut Marketing Manager CV Indako Trading Co, ini. Soal spesifikasi, selain penerapan fitur Combi Brake System padaVario CBS Techno, motor ini juga mengusung konsep lain yang terbilang cerdik yakni Hi Tech & Hi Grade Sporty. Vario juga dianggap juga memiliki tingkat kenyamanan dan keamanan yang tinggi dengan fitur yang berkelas, karena telah dilengkapi dengan sistem pengereman yang merupakan pertamaditerapkandiIndonesiayakni parking brake lock, slide stand. Selain itu, secara desain, motor yang dilepas dengan harga 15 jutaan ini terlihat sangat sporty dengan desain lampu depan ganda yang berkarakter tegas dan agresif. Begitu pula dengan garis tegas di bodi yang pada akhirnya bermuara ke lampu belakang alias tail lamp yang dibuatdengandesaintajamyangtidak kalah agresif dan futuristik. Panel indikator yang diaplikasi di motorinipunbakalmembantumemperkuat imageVario CBSTechno sebagai motor eksklusif. Terlebih panel indikator tersebut juga memiliki disain yang modern namun tanpa mengurangi sisi ergonominya. Vario CBS Techno tersedia dalam lima pilihan warna yakni element black, integra white, acura silver, odyssey violet, dan clarity red. Berbekal Vario CBS Techno, dan juga dibarengi refreshing pada Vario

Waspada/Armansyah TH

SUPER CAR: Para pengunjung antusias menyaksikan jejeran super car Ferrari pada hari terakhir IIMS di (JIExpo), Kemayoran, Jakarta, Minggu (2/8).

Suzuki akhirnya meluncurkan sedan mid-sized terbarunya Kizashi yang dipastikan menjadi rival berat Toyota Camry. “Dalam mengembangkan dan memberikan nama pada model terbaru kami, kata Kizashi memiIiki makna sesuatu yang hebat telah datang. Saat ini Kizashi telah hadir dan kami berharap nama serta produknya akan semakin menguatkan image Suzuki untuk memberikan produk terbaik di masa depan,” ujar Preiden American Suzuki Kevin Saito, pekan ini. Sedan sport ini menggunakan platform dari mobil konsep Suzuki Kaizashi yang pertama kali diperkenalkan ke publik dunia dua tahun lalu. Mobil yang diproduksi di pabrik Suzuki terbaru di kota Sagara, Jepang, ini mengusung mesin 2.4-liter DOHC inline empat silinder. Sedan berdimensi 4.650 mm x 1.820 mm x 1.480 mm ini memiliki fitur-fitur keamanan seperti delapan standar airbag, ESP, anti-lock brakes, projector beam headlamp, dan tyre pressure monitoring system. Kizashi juga dipastikan akan diproduksi untuk versi hybrid dalam waktu dekat. (h09/inc)

dan Beat, Honda sepertinya kini lebih siap bersaing di pasar skutik, satusatunya segmen yang hingga kini belum mereka kuasai. (h09)

Acura ZDX mempertahanakan fitur-fitur utama prototipe seperti panoramic glass roof, handle pintu belakang yang tersembunyi dan fender besar. Bawah, untuk versi yang lebih mahal, sudah ditambahi sisten navigasi yang dikendalikan suara.

panel-panel dan center console. Interior yang kaya sentuhan kulit berkualitas tinggi ini melahirkan kesan hangat dan mengundang, menciptakan ruang kokpit yang intim untuk pengemudi dan penumpangnya. Fleksibilitas dan serbaguna membuat ZDX memudahkan pemiliknya. Kursi-kursinya bisa mengakomodasi lima penumpang dewasa sekaligus mempertahankan ruang space lapang dibelakang kursi kedua. Ruang kargo bisa diperluas untuk memuat barang-barang berukuran panjang, seperti tas golf dengan cara melepas panel samping di dinding ruang kargo. Tambahan lagi, ruang penyimpanan dibawah lantai. Fitur-fituryangditanamtermasuk koneksi Bluetooth, power tailgate dan

sistem audio berkekuatan tinggi. Sistem audio-nya bisa memutar CD, radio AM/FM dan radio satelit XM serta dilengkapi USB Interface untuk iPod. Pada versi yang lebih mahal, ditambahi sisten navigasi yang dikendalikan suara, Acura surround premium audio system, multi-view rear camera. Untuk versi teratas, masih ditambah dengan teknologi blid-spot information yang menggunakan sistem radar untuk mendeteksi objeklainyangtidakterlihatdarispion, juga Collision Mitigating Braking System dan Adaptive Cruise Control (ACC). Acura belum mengumumkan harganya, cuma memberi indikasi antara SUV Acura MDX dan sedan mewah Acura RL. (h09/mkc)

Waspada/Armansyah TH

HondaVario CBS Techno, sudah dipajang di arena IIMS 2009 Jakarta, dan selalu menarik perhatian pengunjung.

Selasa 4 Agustus 2009

MUI Diharapkan Tingkatkan Eksistensi Dan Kualitas Umat SIMALUNGUN (Waspada): Bupati Simalungun, HT Zukarnain Damanik, mengharapkan keberadaan MUI (Majelis Ulama Indonesia) dapat meningkatkan kualitas dan eksistensi umat Islam di Kab. Simalungun. Harapan itu dikemukakan Zulkarnain Damanik saat pengukuhan Dewan Pengurus (DP) MUI Kab. Simalungun masa khidmat 2009-2014 di gedung MUI Simalungun jalan Sang Naualuh, Minggu (2/8). Dikatakan, umat Islam di daerah ini mencapai 57 persen dari jumlah penduduk yang ada. Karena itu, eksistensi umat Islam diharapkan dapat lebih meningkat kualitasnya, baik dalam bidang keagamaan dan bidang pembangunan daerah. “ Saya berharap, kepengurusan MUI dan jajaranya agar terus berupaya meningkatkan ilmu pengetahuannya sehingga dalam melakukan pembinaan kepada umat bukan hanya sebatas pengetahuan ilmu agama saja, akan tetapi umat tersebut nantinya dapat turut berperan dalam mengisi dan mewarnai pembangunan,” tandas bupati seraya menyatakan pihaknya akan memberikan dukungan kepada MUI sepanjang kegiatan-kegiatan yang dilaksanakan untuk kepentingan umat dan mensejahterakan masyarakat. Sementara Ketua MUI Sumatera Utara, Prof DR Abdullah Syah, MA, dalam sambutannya menyatakan MUI sebagai wadah berkumpulnya para tokoh-tokoh agama, ulama dan para cendikiawan untuk membicarakan maupun membahas permasalahan-permasalahan yang terjadi maupun yang dihadapi ditengahtengah masyarakat, khususnya bagi umat Islam. Dia juga mengharapkan DP MUI Kab. Simalungun agar terus meningkatkan pe-ngetahuannya dibidang keagamaan sekaitan dengan pelaksanaan tugasnya dalam membina umat. Menurutnya, dengan ilmu pendidikan yang dimiliki para pengurus, MUI diharapkan akan memberikan peningkatan kualitas umat di daerah. “ Jadikan MUI ini bermanfaat bagi umat di daerah Kabupaten Simalungun,” ujar Abdullah Syah. DP-MUI Kab. Simalungun masa khidmat 2009-2014 yang dikukuhkan ketua MUI Sumatera Utara Abdullah Syah, antara lain Ketua Umum H Abdul Halim Lubis, SHI, Wakil Ketua Drs H Abdul Halim Porang Harahap, H Ichwanuddin Nasution, LC, Drs Darjat Purba, H Bustaman Ganie, SE, Drs H Muslim Lubis, MM, Hj Siti Aminah Lubis, Drs H Jumsadi Damanik, SH, MHum. Sekretaris Umum Drs Junaidi, MPd, Wakil Sekretaris Sakoanda Siregar, SAg, Dra Hj Hidayah Herlina Gusti, Drs Nasaruddin Lubis, MH, Amrisyam,Sag. Sedangkan Bendahara Umum Drs Arsyad Husein Damanik dibantu Drs H Nasril Jambak. Kepengurusan DP MUI Kab. Simalungun juga dilengkapi dengan susunan komisi-komisi terdiri dari komisi fatwa, komisi dakwah, dokumentasi dan informasi, komisi pendidikan, komisi ekonomi dan kepedulian sosial, komisi ukhuwah dan kerukunan antara umat beragama, komisi pemberdayaan perempuan dan keluarga sakinah serta komisi hubungan luar negeri dan antar lembaga. Tampak hadir dalam acara pengukuhan tersebut unsur muspida, para pejabat dijajaran Pemkab Simalungun, para pengurus MUI Kecamatan se-Kab. Simalungun. (a15)

Kasus BLK Tobasa Dua Tahun Lebih Mengendap Di Kejari Balige BALIGE(Waspada): Penanganan kasus dugaan tindak pidana korupsi atas dana ganti rugi bangunan Balai Latihan Kerja (BLK) Aek Natolu, Kec.Lumbanjulu, Kab.Tobasa sebesar Rp1,2 miliar dari APBD 2006 yang dibayarkan Dinas Tenaga Kerja dan Transmigrasi Pemkab Tobasa kepada Yayasan Nairasaon, sudah 2 tahun lebih mengendap di Kejaksaan Negeri Balige. Berbagai keterangan yang dihimpun Waspada, Senin( 3/ 8) menyebutkan, penanganan kasus dugaan korupsi pembayaran ganti rugi bangunan BLK Tobasa oleh aparat kejaksaan telah mencapai 2 tahun lebih, tapi hingga sekarang belum ada satupun pejabat Pemkab Tobasa dijadikan tersangka. Perkembangan terakhir penanganan kasus BLK Tobasa, pihak kejaksaan sudah mendatangkan tenaga ahli dari Dinas Tarukim Provinsi Sumut menghitung secara detail harga bangunan yang sepantasnya karena kuat dugaan telah melakukan tindakan mark up dan harga sebenarnya telah disampaikan. Namun, sebenarnya masalah pokok atas kasus BLK Tobasa bukan seputar persoalan berapa harga ganti rugi bangunan, melainkan yang dipermasalahkan DPRD Tobasa adalah lokasi tanah berdirinya bangunan merupakan kawasan hutan negara sehi-ngga anggaran ganti rugi bangunan pada APBD TA.2006 sebesar Rp1,2 miliar dibatalkan. Rapat paripurna DPRD Tobasa memutuskan dana Rp1,2 miliar menjadi dana cadangan dan tidak bisa digunakan sampai ada kepastian hukum mengenai status tanah lokasi berdirinya bangunan BLK. Tapi setelah pengesahan APBD 2006 oknum Kadis Tenaga Kerja dan Transmigrasi Herijon Panjaitan langsung membayarkan dana ganti rugi bangunan. Lembaga DPRD Tobasa akhirnya membentuk panitia khusus (pansus) untuk mengusutnya. Kepala Kejaksaaan Negeri Balige Timbul Pasaribu, SH saat dikonfirmasi Waspada seputar tindak lanjut penanganan kasus BLK Tobasa, hanya mengatakan kasusnya masih dipelajari dan langsung pergi masuk ke ruangannya. (a33)

Sat Narkoba Polres Samosir Tetap Pantau Peredaran Narkoba SAMOSIR (Waspada) : Satuan Narkoba Polres Samosir terus memantau peredaran Narkoba di wilayah hukum mereka. ‘’Satuan Narkoba Polres Samosir yang dibentuk Agustus 2008 tetap melakukan penyelidikan daerah yang dianggap rawan peredaran narkoba,’’ kata Kasat Narkoba Ipda D Sinaga kepada Waspada, Kamis (30/7). Menurutnya, hasil operasi yang dilakukan Polres Samosir dan Polsek, terungkap 8 kasus terkait penggunaan Narkoba jenis Ganja dengan berat masing-masing 8 gram dan telah diproses. Dalam proses pengembangan, kendala sering dijumpai pemakai tidak menyebutkan sumber didapatnya Narkoba itu sehingga mata rantai jaringan peredaran narkoba terputus. ‘’Saat ini, Sat Narkoba Polres Samosir telah memiliki alat tes psikotropika,’’ sebut Sinaga. Ipda D.Sinaga yang mantan Kanit Reskrim Polres Aceh Tamiang itu juga sering memberikan penyuluhan di warung-warung agar warga menjauhi Narkoba yang berakibat buruk. (c10)

Ruislagh SMAN 4 Rugikan Negara Dan Langgar Peraturan

Waspada/Edoard Sinaga

KELUARKAN MOBILER: Para siswa SMA Negeri 4 mengeluarkan mobiler dari ruangan gedung di Jalan Gunung Sibayak, Kota Pematangsiantar, Senin (3/8) dan membawanya ke Jalan Pattimura.

Siswa SMAN 4 P. Siantar Ambil Paksa Mobiler P. SIANTAR (Waspada): Aksi penolakan pemindahan proses belajar mengajar (PBM) di SMA Negeri 4 dari Jalan Patimura ke Jalan Gunung Sibayak, Kota Pematangsiantar kembali berlanjut, Senin (3/8). Sebanyak limaratusan siswa SMANegeri4yanghampirempat hari menunggu pengembalian mobilerkesekolahJalanPatimura sesuai hasil kesimpulan rapat kerja/dengar pendapat di DPRD Sumatera Utara dengan Muspida Sumut dan Pematangsiantar, Kamis (30/7) di Medan mendatangi sekolah di Jalan Gunung Sibayak yang disebut sebagai lokasi pengganti SMA Negeri 4 Jalan Pattimura dan mengambil paksa sejumlahmobileryangdipindahkan dari Jalan Patimura. Ketika para siswa itu tiba di Jalan Gunung Sibayak dengan berjalan kaki dari Jalan Jalan Pattimura mulai pukul 09:30, pintu gerbang dikunci dari dalam hingga para siswa berteriak-teriak meminta pintu gerbang dibuka danmobilermerekadikembalikan ke Jalan Pattimura. Namun, permintaan itu tidak disahuti hingga para siswa beramai-ramai mendobrak pintu gerbang sekolah

di Jalan Gunung Sibayak yang dikunci dan dijaga sejumlah aparat kepolisian serta sejumlah petugas Satpol PP Pemko beberapa pri tidak dikenal. Saat itu seorang pria yang dikenal bernama SukosoWinarto dengan menggunakan pengeras suara mengatakan sebagai salah seorang orangtua siswa dan bila hendak mengambil mobiler agar berurusan dengan walikota. UcapanSukosoitumembuatpara siswa meneriakinya hingga Sukoso kembali bergabung dengan beberapa pria tidak dikenal. Sesudah berjuang sekira satu jam, para siswa berhasil mendobrak pintu gerbang sekolah dan memasuki sekolah di Jalan Gunung Sibayak. Aksi para siswa itu turut menjadi tontonan warga di sekitar sekolah itu. Selanjutnya mobiler berupa meja dan kursi serta papan tulis dikeluarkan para siswa dari aula dan sejumlah ruangan belajar di gedung sekolah di Jalan Gunung Sibayak. Salah seorang siswa SMA Negeri 4, Muhammad Midun mengemukakan para siswa mengambil kembali mobiler dari sekolah di Jalan Gunung Sibayak yang sebelumnya diambil Pemko dan dpindahkan ke sekolah Jalan Gunung Sibayak. Mobiler yang diambil dari gedung Jalan Gunung Sibayak

rapkan pemerintah, telah dilaksanaknnya dengan sukses. Berhasil menjalin kerjasam dengan pemerintah, swasta dan sipil. Danrem mengharapkan, kiranya Danyon baru bisa lebih meningkatkan keberadaanYonif 23/RW sepeninggal Letkol Inf Edi Hartono atau minimal bisa mempertahankannya. “Terus jaga kekompakandan jaga kondusifitas diantara satuan samping, pemerintah, legislatif, swasta, dan masyarakat. Paling utama, kekompakan prajurit dan pemebnahan mental spiritual mereka,” pesan Danrem. Paling ditekankan Danrem ialah, menciptakan jiwa Korsa yang sehat dan menjunjung tinggi dedikasi juang yang tangguh. Memegang teguh disiplin keprajuritan dengan berdasarkan Sapta Marga dan Sumpah Prajurit. Usai Sertijab, keluarga besar Yonif 123/RW menampilkan berbagai macam tarian dari berbagai etnis. Kemudian atraksi prajurit dalam menghadapi musuh dan kolone senjata serta

selanjutnya dibawa para siswa denganmenggunakanempatunit truk ke gedung SMA Negeri 4 di Jalan Pattimura. Pihak Pemko Pematangsiantar yang dihubungi wartawan, melalui Asisten I Jhonson Simanjuntak mengatakan terkait aksi pengambilan mobiler dari lokasi di Jalan Gunung Sibayak, pihaknya sudah membuat laporan ke Polresta Pematangsiantar. Ketua Komite Sekolah Djarusdin Sitio yang dihubungi di SMA Negeri 4 Jalan Pattimura menegaskan para siswa tidak ada melakukan penjarahan mobiler sekolah dan yang sebaliknya yang menjarah dari Pemko, sedang para siswa melakukan tindakan itu, karena mobiler itu milik SMA Negeri4yangdibelimelaluiAPBN dan anggaran Komite Sekolah seraya menunjukkan register bangku dan meja siswa, meja guru dan papan tulis seperti tertulis di meja dan bangku siswa serta meja guru yang pengadaannya beragam mulai tahun 1992, 2002 dan terakhir tahun 2005. Di pihak lain,Wakil Ketua KomiteSekolahSMANegeri4Jansen Napitu mengharapkan Gubsu H Syamsul Arifin, SE turun tangan menuntaskan masalah yang terjadi di SMA Negeri 4 hingga PBM di sekolah itu tidak terlalu lama terkatung-katung.(a14)

UPK Namohalu Diduga Selewengkan Dana PNPM R2PN GUNUNGSITOLI (Waspada): Unit Pengelola Kegiatan (UPK) Program Nasional Pemberdayaan Masyarakat Rehabilitasi dan Rekonstruksi Pulau Nias (PNPM R2PN) Kecamatan NamohaluEsiwa,didugamelakukan penyelewengan dalam penyaluran dana PNPM R2PN yang bernilai Rp16 miliar lebih kepada desa penerima manfaat yang dilaksanakan oleh Tim Pelaksana Kegiatan (TPK). Hal ini ditegaskan Ketua Tim Riset Lembaga Swadaya Masyarakat (LSM) Nias Corruption Watch (NCW) Kabupaten Nias Martin S. Buaya, Sabtu (1/8) setelah melakukan invetigasi ke lapangan di Kecamatan Namohalu Esiwa. Dijelaskan, dugaan kuat penyelewenganpenyalurandana PNPM R2PN miliaran rupiah di Kecamatan Namohalu Esiwa, ditemukannya pada salah satu TPK di Desa Namohalu yang membidangipendidikanpembangunan gedung SMP Negeri 1 yaitu TPK tidak memiliki gambar kerja (Bestek), pencairan dana terlambat karena UPK meminta pengertian kepada UPK supaya

urusan cepat, hak TPK untuk membayarhargabahankesuplier diambil alih oleh UPK. Halinisangatjelassangatmelanggar dari aturan yang ada, tetapi perlakuan UPK tersebut sepertinyatidakterdengarkepada Fasilitator pendamping baik FT dan FK, PJOK Kecamatan yang memiliki tanggung jawab dalam pelaksanaan program PNPM R2PNyangbertugassebagaipembimbing dan pengawas. Lanjut Martin S. Buaya, dugaan penyelewengan penyaluran dana oleh UPK kepada TPK desa kemungkinan besar dilindungi oleh pihak-pihak yang betanggung jawab pada program PNPM R2PN di Kecamatan Namohalu Esiwa. Ketika hal ini, dikonfirmasi sejumlah wartawan kepada Sekretaris TPK Desa Namohalu bidang pendidikan Natalius Harefa didampingi Ketua TPK dan Bendahara, Sabtu (1/8)), membenarkan, terlambatnya proses pencairan dana kepada mereka karena UPK meminta pengertian kepada mereka. Diakuinya juga, sampai saat ini mereka sebagai pengurus TPK

Mayor Inf Benni Satria Danyonif 123/RW Baru P.SIDIMPUAN (Waspada): Mayor Infantri Benni Satria menjadi Komandan Batalyon Infantri 123/Raja Wali yang baru, menggantikan Letkol Inf Edi Hartono yang dipromosikan menjadi Dansecata A Rindam I/BB di Pematang Siantar. Serah terima jabatan dari Danyon lama kepada yang baru dilaksankan dalam satu upacara militer dipimpin Danrem 023/ Kawal Samudera, Kolonel Inf SWidodo, di lapangan Makoyonif 123/RW di Padang Sidimpuan, Sabtu (1/8). Mayor Inf Benni Satria saat ini memiliki seorang istri, 2 putri dan sebelumnya menjabat WadanYonif 142 di Jambi. Dia lulusan Akademi Militer tahun 1992 atau setahun di bawah Letkol Inf Edi Hartono yang digantikannya. Danrem 023/KS, Kolonel Inf S Widodo, dalam amanatnya mengatakan, Danyon yang lama telah menunjukkan tugas yang baik sebagai komandan. Berbagai kegiatan yang tujuannya menjadikan prajurit lebih baik, sebagaimana diha-


Sumatera Utara


kemampuan beladiri. Hal yang membuat acara itu semakin berkesan ketika Kapolres Madina AKBP Engkos Kosasih bertindak selaku pembawa acaranya. Suasana gembira, haru dan mengesankan, mampu ciptakannya. Hadir bersama Danrem, Kasrem 023/KS Letkol Inf Kamistan AD, Kasi Pers Letkol CAJ

Ardo Lingga, Danden Kibang Letkol CZI Irfan, Dandem Pom Mayor CPM G Sipahutar, Danden Pal Mayor CPL Aritonang, Dandim 0212 Letkol Inf Togar PRL Pangaribuan, Dandim 0206 Letkol Inf Rahman, Dandim 0211 Letkol Inf Maruli Ritonga, Dandim 0213 Letkol Inf H. Sinaga dan Kasdim 0210 Mayor Inf K Panjaitan. (a20)

Waspada/Sukri Falah Harahap

SALAM KOMANDO: Danrem 023/KS Kolonel Inf S Widodo melakukan salam komando usai serahterima jabatan Danyon 123/RW dari Letkol Inf Edi Hartono (kanan) kepada Mayor Inf Benni Satria (kiri).

tidak memiliki modul dalam pelaksanaan kegiatan PNPM R2PN yang diberikan oleh UPK atau PJOK Kecamatan. Tentang pembayaranhargabahankepada suplier bukan mereka yang melakukannya tetapi langsung UPK karenahalitusesuaipetunjukUPK dan Fasilitator kepada mereka, dan yang mereka terima hanya kelebihan dana yang dibayarkan kepada suplier oleh UPK. Dari Rp600 juta lebih plafon dana yang dialokasikan pada pembangunan gedung SMP Negeri 1 Namohalu Esiwa, sampai saat ini yang dicairkan oleh UPK dan Fasilitator kepadaTPK hanya Rp90 juta. Progress pekerjaan yang dicapai hanya sampai pada pemasangan pondasi dan tiang besi yang belum dicor. Ketua UPK Sochinasi Gea yang dikonfirmasi via telefon selularnyatentangprosespembayaran dimaksud mengatakan, sesungguhnya yang melakukan pembayaran adalah TPK karena TPK tidak ke Gunungsitoli dan mereka minta tolong makanya UPK yang melakukan transfer uang ke rekening suplier. (a35)

PEMATANGSIANTAR (Waspada): Tindakan Pemko dan DPRD Kota Pematangsiantar serta badan usaha PT Detis Sari Indah (DSI) terhadap proses pelaksanaan tukar menukar (ruislagh) atas aset pemerintah yakni tanah dan bangunan SMA Negeri 4 dan SD Negeri 122350 di Jalan Pattimura merugikan keuangan negara, sebab semua proses pelaksanaan ruislagh mulai dari tahap awal bertentangan dengan peraturan perundang-undangan dan hukum yang berlaku. Keadaan itu dan terganggunya proses belajar mengajar (PBM) para siswa SMA Negeri 4 dan SD Negeri 122350 mendorong lima Advokat Kota Pematang Siantar yakni Sarbudin Panjaitan, SH, MH, Riduan Manik, SH, MH, Dame Pandiangan, SH, MH, Sarles Gultom, SH, MH dan Binaris Situmorang, SH, MH menggugat Pemko, DPRD dan PT DSI ke Pengadilan Negeri (PN) setempat. Seperti diungkapkan kelima Advokat itu kepada wartawan, Senin (3/8). Gugatan sudah didaftarkan ke PN Pematang Siantar, Senin (3/ 8) dengan nomor pendaftaran 34/G/2009/PNPMS. Menurut Panjaitan dan rekannya, dalam ketentuan Pasal 41 Undang-undang (UU) RI nomor 31 tahun 1999 tentang pemberantasan korupsi yang sudah diubah dengan UU nomor 20 tahun 2001 jelas-jelas ada diatur peran serta masyarakat membantu upaya pencegahan penyimpangan keuangan negara dan secara hukum, siapa saja warga masyarakat termasuk para Advokat ada hak melakukan tindakan hukum dalam bentuk apapun termasuk mengajukan gugatan ke PN demi menjaga keamanan keuangan termasuk aset negara. “Kami dan warga masyarakat mengetahui pada 20 Desember 2005 PT DSI mengajukan surat permohonan mengadakan ruislagh terhadap tanah dan bangunan SMA Negeri 4 dan SD negeri 122350 di Jalan Pattimura kepada Pemko sesuai surat PT DSI nomor 14/DSI-05 tanggal 20 Desember 2005 dengan melampirkan data bangunan sekolah yang terletak di Jalan Gunung Sibayak, Jalan Sisingamangaraja dan Jalan Medan simpang terminal Tanjung Pinggir sebagai tukar tanah dan bangunan SMA Negeri 4 dan SD Negeri 122350,” papar Panjaitan. Kemudian, lanjut Panjaitan, PT DSI mengajukan surat susulan mengadakan ruislagh lagi kepada Pemko sesuai suratnya nomor 15/DSI06 tanggal 14 Agustus 2006 dan pada 14 Desember 2006, Pemko mengajukan surat permohonan persetujuan tukar menukar barang Pemko kepada DPRD sesuai surat Pemko nomor 425/ 8772/XII/2006 tanggal 14 Desember 2006. “Atas surat permohonan persetujuan tukar menukar barang Pemko itu, DPRD memberikan persetujuan permohonan tukar menukar barang milik Pemko berupa tanah dan bangunan SMA Negeri 4 dan SD Negeri 122350 di antara Jalan Pattimura, Jalan Merdeka dan Jalan Sutomo seluas 24.621 M2 seharga Rp 34.956.967.000, sesuai surat DPRD nomor 425/4055/DPRD/ IV/2007 tanggal 17 April 2007.” Dalam Juni dan Juli 2009, lanjut Panjaitan, masih dalam proses perencanaan ruislagh terhadap tanah dan bangunan SMA Negeri 4 dan SD negeri 122350, Pemko sudah melakukan pemindahan tempat PBM para siswa SMA Negeri 4 dan SD Negeri 122350 ke bangunan yang sudah disediakan PT DSI sebelumnya di Jalan Gunung Sibayak dengan cara paksa dan tekanan terhadap para siswa serta para guru. “Sampai gugatan ini dilaksanakan di PN, para siswa SMA Negeri 4 dan SD Negeri 122350, para guru, orangtua, Komite Sekolah dan para LSM yang ada di Pematangsiantar menolak PBM ke tempat lain dan sebagai reaksi nyata terhadap penolakan pemindahan PBM itu, para siswa, para guru, orangtua, masyarakat dan LSM sudah melakukan unjuk rasa besar-besaran di sekitar SMA Negeri 4 dan SD Negeri 122350 di Jalan Pattimura, Jalan Sutomo, Jalan Merdeka, ke kantor DPRD dan walikota, bahkan ke DPRD Sumut dan kantor Gubsu, karena proses pelaksanaan ruislagh tidak disetujui seluruh elemen masyarakat termasuk kami. Dan masalah keberatan pelaksanaan ruislagh sudah menjadi masalah nasional hingga menjadi objek liputan media cetak dan elektronik,” papar Panjaitan. Menurutnya lagi, tindakan atau perbuatan Pemko, DPRD dan PT DSI terhadap proses pelaksanaan ruislagh akan merugikan keuangan negara, sebab semua proses pelaksanaan ruislagh mulai dari tahap awal bertentangan dengan peraturan perundang-undangan dan hukum yang berlaku. “Bila ruislagh tetap dilakukan, bila dilihat dari aspek ekonomisnya, negara/ Pemko akan mengalami kerugian besar.” Rugi Besar Panjaitan dan rekannya menyebutkan yang menjadi kerugian besar dialami negara/Pemko bila ruislagh tetap dilaksanakan yakni harga tanah per meter yang disetujui DPRD Rp 1.032.000 per meter dengan menggunakan harga menurut nilai jual objek pajak (NJOP) tahun 2006 hingga total harga tanah seluas 24.621 M2 dikali Rp 1.032.000 sama dengan Rp 34.956. 967.000, padahal menurut data di Kantor Pajak, NJOP tahun 2007 atas tanah SMA Negeri 4 dan

SD Negeri 122350 sudah naik menjadi Rp 2.352. 000 per meter dan bila dijumlah harga per meter dikali luas tanah menjadi Rp 57.908.592.000. “Dapat dilihat, selisih harga tanah SMA Negeri 4 dan SD Negeri 122350 tahun 2006 dan tahun 2007 sudah mencapai Rp 22.951.625.000. Jumlah inilah yang menjadi kerugian negara/Pemko, belum lagi dihitung selisih nilai harga tanah itu berdasarkan NJOP tahun 2008 dan tahun 2009.” Selain itu, lanjut Panjaitan, belum lagi dihitung kerugian selisih harga antara nilai harga barang pengganti dari PT DSI yang terdiri dari tanah dan bangunan di tiga tempat dan bangunan sekolah kesehatan di atas tanah RSUD Dr. Djasamen Saragih, masih jauh nilai harga tanah dan bangunan SMA Negeri 4 dan SD Negeri 122350. “Padahal, prinsip ruislagh menguntungkan negara atau setidak-tidaknya nilai harga barang yang ditukar dan barang penukar seimbang. “Bila dilihat dari mekanisme proses pelaksanaan ruislagh terhadap tanah dan bangunan SMA Negeri 4 dan SD Negeri 122350 yang dilakukan Pemko, DPRD dan PT DSI sudah bertentangan dengan PP RI nomor 6 tahun 2006. Buktinya, PT DSI meminta dan menunjuk langsung tanah dan gedung SMA Negeri 4 dan SD Negeri 122350 yang akan diruislagh. Padahal, menurut ketentuan syarat-syarat ruislagh seharusnya Pemko yang mencari atau menetapkan developer pengganti aset yang akan diruislagh.” Kemudian, lanjut Panjaitan dan rekannya, PT DSI secara pribadi yang menunjuk tenaga penaksir harga tanah dengan menggunakan tenaga dari PT Sucofindo sebagai konsultan, padahal seharusnya Pemko yang menetapkan tim independen sebagai tenaga ahli penaksir yang terdiri dari pejabat dari Pemko, konsultan dan Dirjen Pajak/Kantor Pajak setempat dengan SK walikota. Tapi itu belum dibentuk, namun PT DSI sudah melakukan penaksiran terhadap barang penukar dan yang akan ditukar.” Selain itu, sesal Panjaitan, DPRD memberikan persetujuan ruislagh dengan menyetujui harga Rp 34.956.967.000, padahal menurut ketentuan setiap izin prinsip yang dikeluarkan DPRD hanyalah sifatnya setuju atau tidak tanpa mencantumkan harga nilai tanah, karena pelaksanaan penaksiran tanah yang akan diruislagh dan barang penukarnya baru dapat ditentukan sesudah izin prinsip dari DPRD dikeluarkan, kemudian tim penaksir dibentuk dengan SK Pemko. “Dari surat-surat yang dibuat Pemko, DPRD dan PT DSI tentang proses pelaksanaan ruislagh dan tindakan pemindahan paksa para siswa SMA Negeri 4 dan SD Negeri 122350 sudah nampak ada indikasi persekongkolan tujuan melakukan penyimpangan terhadap ruislagh tanah dan bangunan itu dan berakibat kerugian negara/Pemko,” cetus Panjaitan. Menurut Panjaitan dan rekannya, alasan dan pertimbangan ruislagh terhadap tanah dan bangunan sudah diatur dalam Pasal 54 (1) PP nomor 6 tahun 2006 tentang pengelolaan barang milik negara/daerah, dimana ada tiga pertimbangan pelaksanaan yakni memenuhi kebutuhan operasional penyelenggaraan pemerintah, optimalisasi barang milik negara/daerah dan tidak tersedia dana dalam APBN/APBD. “Bila ditelaah pertimbangan itu dengan proses yang sudah dilakukan Pemko, DPRD dan PT DSI jelas-jelas tindakan yang dilakukan Pemko, DPRD dan PT DSI sudah bertentangan dengan peraturan dan hukum yang berlaku dan melawan hukum.” Menurut Rooseno Harjowidigdo, peneliti hukum Pusat Pembinaan Sistem dan Prasarana Hukum BHPN Departemen Kehakiman RI, lanjut Panjaitan dan rekannya, alasan ruislagh yakni terkena planologi, belum dimanfaatkan secara optimal (idle), menyatukan aset yang lokasinya terpencar guna memudahkan koordinasi dan efisiensi, memenuhi kebutuhan operasional pemerintah sebagai akibat pengembangan organisasi serta dana untuk keperluan memenuhi kebutuhan departemen/lembaga tidak tersedia dalam anggaran. “Bila ditelaah pendapat peneliti hukum itu, pelaksanaan ruislagh yang dilakukan Pemko, DPRD dan PT DSI sudah bertentangan dengan prinsip ruislagh, antara lain salah satu butir ketiga di atas sudah dilanggar Pemko, DPRD dan PT DSI, karena aset penukar terpencar di Jalan Gunung Sibayak, Jalan Sisingamangaraja dan dan Jalan Medan,” papar Panjaitan dan rekannya. Pemko, DPRD dan PT DSI tidak tranparan melakukan rencana ruislagh dan tidak sesuai dengan mekanisme ruislagh yakni pengajuan usul ruislagh dari walikota ke DPRD, persetujuan DPRD, menerima atau menetapkan developer pengganti aset yang akan diruislagh dan bersedia dibebankan biaya rapat, honorarium tim, transportasi dan lain-lain atas kesepakatan bersama, penetapan pembentukan tim independen dari walikota dengan SK, menetapkan jadwal waktu penaksiran terhadap barang yang akan diruislagh dan barang pengganti, dimana tim independen mulai bekerja selambat-lambatnya dalam waktu tiga bulan sudah selesai melaksanakan tugasnya membuat SK pelaksanaan tukar menukar yang dilengkapi dengan rincian volume fisik aset yang akan dilepas dan aset pengganti seperti dimuat dalam berita acara penaksiran.(a14)

Sumatera Utara


WASPADA Selasa 4 Agustus 2009

Akibat Kemarau, Warga Paluta Serbu Sungai Batangpane GUNUNG TUA (Waspada): Musim kemarau melanda wilayah Padanglawas Utara, khususnya wilayah Padang Bolak sehingga Sungai Batangpane menjadi andalan warga menutupi kebutuhan air setiap hari. Demikian pantauan dan informasi dihimpun Waspada di Gunung Tua selaku ibukota

Waspada/Syarif Ali Usman

KUPAK-KAPIK: Kondisi jalan Sibuhuan Julu sepanjang 1.600 m dan lebar 4 m tersebut tiap ruas kupak-kapik tidak beraspal lagi.Kemudian badan jalan berlubang bagaikan rawa sehingga menyulitkan kendaraan untuk melintasinya. Foto direkam, Sabtu (1/8).

Jalan Baru Sibuhuan Julu Menanti Perbaikan SIBUHUAN ( Waspada): Jalan Baru Sibuhuan Julu yang Kec. Barumun panjang 1.600 meter dan lebar 4 meter, sudah sejak lama rusak dan sulit dilalui kendaraan. Padahal bila jalan itu diperbaiki akan dapat mengurangi kemacetan yang selalu menghambat pengguna jalan di Pusat Pasar Sibuhuan. Pantauan Waspada, Sabtu (1/8), jalan sepanjang 1.600 m dan lebar 4 m itu tiap ruas kupak-kapik tidak beraspal lagi, kemudian badan jalan berlubang bagaikan rawa. Hal itu diperparah lagi dengan gundukan tumpukan pasir penutup

lubang, namun tidak diserak menjadikan pengendara sulit melaluinya. H Ayub Husein Lubis, 50, warga setempat yang dijumpai di sekitar jalan itu mengatakan, kerusakan jalan sejak sekitar tahun 2006, ketika pembangunan jembatan beton yang menghubungkan jalan lintas Sibuhuan-Gunung Tua. Dikatakannya, seluruh kendaraan yang akan melintas melalui jalan itu termasuk truk-truk yang bermuatan puluhan ton, padahal jalan tersebut adalah jalan kelas tiga, akibatnya kerusakan jalan itu sangat parah.

Kemudian untuk menutupi kerusakan jalan berupa lubang yang melebar, pihak pengusaha truk menutupinya dengan sirtu, sayangnya tidak diserakkan, akhirnya menjadikan gundukan hingga sekarang. Wakil Bupati Padang Lawas H Ali Sutan Harahap (TSO) yang dijumpai di Sibuhuan usai acara pelatikan Lembaga Karatedo Indonesia cabang Padang Lawas mengatakan, dalam tahun ini jalan tersebut akan diperbaiki. “Beberapa ruas jalan akan diperbaiki tahun ini, termasuk seluruh jalan lingkar yang berada di Sibuhuan,” ujar Wakil Bupati.(csap)

Terjadi Di Tapsel

6 Balita Tewas Terpanggang, Dikunci Dalam Rumah ANGKOLA BARAT (Waspada): Enam anak usia lima tahun ke bawah (Balita) tewas terpanggang ketika rumah papan dua pintu ukuran 5 X 6 meter milik mereka di Dusun Aek Sabatang Menek, Desa Rianiate, Kec. Angkola Barat, Kab.Tapanuli Selatan, terbakar hingga ludes dan rata dengan tanah. Para korban, Lesman Laia, 5, Darmiwati Laia, 4, Anisman Laia, 3, dan Putrisiah Yani Laia, 0,5 (6 bulan), anak pasangan Fatolosa Laia dengan Tiberia Zebua. Kemudian Fenida Laia, 5, dan Janida Laia, 3, anak pasangan Elipati Laia dengan Arina. Plt Kepala Desa Rianiate, Ali Basri Hasibuan, mengungkapkan itu kepada Waspada di Batang Toru, Kab.Tapsel, Senin (3/ 8). Disebutnya, kebakaran terjadi Sabtu (1/8) pukul 17:30, dan korban dimakamkan Minggu (2/ 8) pukul 18:00. Semua korban bersepupu kandung. Saat kejadian, mereka dikunci di dalam rumah, karena orangtua mereka pergi ke ladang. Sedangkan neneknya yang ditugasi menjaga para korban, pergi mencari kayu bakar. Kondisi para korban sungguh mengenaskan, mayatnya

sudah jadi arang di atas puingpuing rumah yang berada di puncak Bukit Barisan itu. Posisi mayat keenam korban ditemukan tepisah antara satu sama lain. Kerugian materil mencapai Rp 10 Juta. “Aparat desa dan pihak kepolisian dari Polres Tapsel telah turun ke lokasi yang harus ditempuh dengan bejalan kaki selama 3 jam. Selain identifikasi, juga telah dilakukan otopsi oleh paramedis yang bertugas di Desa Rianiate,” katanya. Ditanya tentang sumber api, Plt.Kepala Desa mengaku belum mengetahuinya secara persis. Hingga kini, menurut laporan diterimanya, orangtua para korban masih bermukim di lokasi. Sementara seorang personil Polres Tapsel yang turut ke lokasi menceritakan, kondisi keenam korban sungguh mengenaskan. “Jenazahnya sudah menyerupai arang,” kata personil yang menolak ditulis identitasnya itu. Disebutkan, berdasarkan keterangan keluarga, sejak pagi orangtua para korban sudah berangkat ke ladang. Mereka dititipkan kepada neneknya yang juga tingal di rumah itu.

Namun sore harinya, nenek para korban meninggalkan mereka di dalam rumah dengan kondisi pintu dikunci. Sementara sebelumnya dia memasak makanan untuk babi piaraan mereka dan lupa memadamkan api tungku. Api diperkirakan berasal dari tungku itu. Tidak bisa dipastikan apakah api menjalar ke dinding dapur, atau dimainmainkan para korban. Nenek korban terkejut, saat pulang mencari kayu bakar sudah melihat rumahnya diselimuti api. Dia tidak mampu memadamkan api, akibat tenaga yang kurang dan ditambah tidak adanya sumber air di sekitar lokasi. Kemudian diapun menjemput orangtua para korban di ladang, dan menceritakan kejadian itu. Hingga kini, orangtua korban masih shock atas kejadian itu. Mereka tidak menyangka, semua anak-anak mereka tewas terbakar di dalam rumah. “Di lokasi, tidak ada rumah lainselainrumahmilikduakepala keluarga yang bersaudara kandung itu. Untuk ke lokasi, harus melalui Desa Bukkas, Kec. Angkola Selatan. Kemudian mendaki denganberjalankakisekira3jam,” sebut sumber. (a20)

Penataan Pasar Sibuhuan Mendesak SIBUHUAN (Waspada): Penataan Pasar Sibuhuan sebagai sentral ibu kota Kabupaten Padang Lawas harus segera dilakukan dan ini perlu dukungan semua pihak karena kondisinya selama ini sangat semrawut. Demikian Ketua Majelis Ulama Indonesia (MUI) Kabupaten Padang Lawas, HM Arjun Akbar Nasution, BA pada acara temu ramah di Koramil 08/ Barumun, Jumat (31/7) malam yang dihadiri Bupati Basyrah Lubis, Wakil Bupati Ali Sutan Harahap,Sekdakab,SyahrulMulia Harahap, para Kabag, camat, OKP, LSM, insan pers, alim ulama dan tokoh masyarakat.

Dikatakan, Padang Lawas sejak mekar dari Tapanuli Selatan sudah semakin berkembang, seperti Pasar Sibuhuan sebagai pusat perbelanjaan telah semakin ramai. Namun, begitu kita menelusuri Pusat Pasar Sibuhuan, sangat disesalkan masih saja tidak terlepas dari kesemrawutan. Maka pada kesempatan ini, kita berharap kerjasama dan dukungan semua pihak, termasuk Danramil yang baru, Kapt Inf. Syafaruddin Hasibuan, untuk kemajuan daerah Padang Lawas banyak hal yang perlu dibenahi, termasuk penataan pusat pasar, pemeliharaan dan pelestarian

sungai yang selama ini didapati berbagai jenis ikan kini populasinya semakin rendah. Ketua DPRD Padang Lawas Syarifuddin Hasibuan, diwakili Ahmad Yuspan Pulungan juga menyampaikan, untuk membangun Padang Lawas sangat erat kaitannya dengan keterlibatan semua pihak. Bupati Padang Lawas, Basyrah Lubis juga sangat berharap dukungan dan dorongan semua pihak untuk membangun Padang Lawas yang maju dan berkembang, sejajar daerah kabupaten lain di Sumatera Utara. (a32)

Pengawasan Objek Vital Diperketat P.SIDIMPUAN (Waspada): KapolresTapanuli Selatan, AKBP Pranyoto Harahap menegaskan, pihaknya terus melakukan pengawasan ketat terhadap sejumlah ojek vital di wilayah hukumnya. “Pengawasan semakin diperketat lagi pasca bom Jakarta,” kata Kapolres yang wilayah hukumnya meliputi tiga kabupaten, Tapsel, Paluta dan Palas, Sabtu (1/8). Dijelaskan, pihaknya memiliki skala prioritas dalam per-

ketatan pengawasan ini. Seperti pengawasan ekstra ketat terhadap perusahaan pertambangan emas di Batang Toru yang melibatkan warga negara asing (WNA). “Ini demi mengantisipasi dan menjaga kondusifitas di wilayah hukum kita, pasca ledakan bom Jakarta sangat perlu, terlebih bagi objek vital yang tempat kerjada dan kunjungan WNA,” ujarnya. Pranyoto mengaku, sejauh ini belum satupun ditemukan

teror bom di wilayah hukumnya. Baik pada tempat umum dan objek vital. Meski demikian, pihaknya terus menjalin koordinasi dengan seluruh jajaran dan masyarakat. Sementara pantauan di tambang emas PT Tiger Gold Agincourt Resources Batang Toru yang mempekerjakan WNA, serta di Tor Sibohi Nauli Hotel penginapan pilihanWNA, pengamanannyaterusditingkatkan. Baik dari pihak Polres Tapsel maupun perusahaan. (a20)

DPRD Sahkan LKPJ Bupati Madina 2008 PANYABUNGAN (Waspada): DPRD Kab. MandailingNatal mensahkan Laporan Keterangan Pertanggung Jawaban (LKPJ) Bupati dan Pertanggungjawaban Pelaksanaan Anggaran Pendapatan dan Belanja Daerah ( PP-APBD) 2008 dalam sidang paripurna, Jumat (31/7). LKPJ dan PP-APBD menjadi Peraturan Daerah (Perda) Madina 2009, setelah lima dari enam fraksi menyetujui yang dituangkan dalam pendapat akhir fraksi-fraksi, sedangkan F-PKS tidak setuju.

Kelima fraksi yang menyetujui yakni FPPB melalui juru bicaranya Hj Riadoh Rangkuti, F Partai Golkar dibacakan Ir M Amin Daulay, F PBR disampaikan Bahri Efendi Hasibuan, F PAN Plus dibacakan H Sutan Parluhutan Nasution dan F Bersatu disampaikan H Ahmad Solih. Dalam keputusan DPRD Madina yang dibacakan Sekwan Drs MYusuf, MSi dijelaskan, pertanggungjawaban pelaksanaan APBD Madina TA 2008 berupa laporan keuangan yang memuat

laporan realisasi anggaran, neraca, laporan arus kas dan catatan atas laporan keuangan, kemudian laporan keuangan juga dilampiri dengan laporan kinerja dan iktiar laporan keuangan BUMD/perusahaan daerah. Wakil Bupati Hasim Nasution mengucapkan terima kasih kepada DPRD Madina khususnya panitia anggaran yang telah kerja keras dalam melaksanakan rapat-rapatnya mulai LKPJ dan PP-APBD TA 2008 disampaikan 16 hingga 31 Juli 2009. (a24)

Kab.Paluta dan Kec.Padang Bolak, Minggu (2/8). Sumur warga sudah kekeringan dan kini mereka berbondong-bondong ke Sungai Batangpane. Air sungai yang sebelum kurang diperhatikan itu, kini menjadi primadona untuk memenuhi kebutuhan air warga. Seperti air minum dan

MCK (mandi, cuci, kakus). Masnita Br Rambe, 32, warga Gunung Tua, yang hendak pulang dari sungai mengatakan, musim kemarau beberapa pekan ini, air sumur di rumahnya kering. Sehingga dia dan keluarganya rutin mandi di sungai. Bahkan untuk keperluan air minum dan memasak pun

mereka gunakan air sungai. Hal senada diungkapkan Parlin Siregar, 30, warga Desa Huta Lombang. Katanya, mereka juga memanfaatkan air Sungai Batangpane untuk keperluan MCK dan sebagainya. “Sejak musim kemarau ini, air sumur kami habis. Sehingga kalau hanya untuk mandi saja,

saya dan keluarga terpaksa ke SungaiBatangpane.Untukkeperluan minum, kami beli dari depot air minum isi ulang,” sebutnya. Sejak musim kemarau ini, aktivitas warga di Sungai Batangpane ramai . Mulai pagi hingga sore, ada saja orang yang mandi, cuci, dan kakus serta mengambil air. (csp)


Selasa 4 Agustus 2009

B. Aceh, Sigli, Bireuen, Lhokseumawe

Rp4 M Dana Jamkesmas Sabang Belum Cair

Untuk Mendapatkan Informasi Wisata, Kunjungi Anjungan Sabang BANDA ACEH (Waspada): Untuk memperoleh informasi tentang wisata bahari, banyak didapati di anjungan Kota Sabang. Terbukti dari sekian banyak pengunjung yang menyaksikan materi di stand pameran Sabang, di antaranya banyak yang bertanya seputar informasi wisata. Pertanyaan tersebut sangat relevan kalau dikaitkan dengan potensi Sabang yang dominannya wisata bahari, wisata pantai dan wisata sejarah. Untuk mendapatkan informasi lengkap dapat diperoleh di anjungan Sabang. Sejak dibukanya pameran yang merupakan salah satu kegiatan materi Pekan Kebudayaan Aceh (PKA) V dimulai 1 Agustus lalu, anjungan Sabang termasuk salah satu anjungan paling banyak dikunjungi pengunjung. Sekretaris Disbudpar Sabang, Mariani, S.IP yang ditemui di anjungan Sabang, Minggu (2/8) sore membenarkan, banyak pengunjung menanyakan informasi seputar wisata Sabang dan hasil kerajinan yang ditampilkan Dekranas Sabang. “Ketika berada di Sabang pengunjung dapat menyaksikan beberapa objek wisata seperti wisata pantai, taman laut pulau Rubiah (wisata bahari), wisata sejarah (benteng peninggalan Jepang). Sedangkan souvenir bisa memilih hasil kerajinan tangan Dekranas langsung ke dapur produksi di Ujong Karang,” sebut Mariani didampingi pengurus Dekranas Sabang, Cut Nur Aini.(b29)

WH Bireuen Tangani 41 Kasus Khalwat BIREUEN (Waspada): Sejak Januari hingga akhir Juli 2009 kantor Wilayatul Hisbah (WH) Kabupaten Bireuen telah menangani sebanyak 41 kasus khalwat. Demikian Jamaluddin Kepala Satuan Polisi Pamong Praja, Wilayatul Hisbah, dan Pemadam Kebakaran melalui Komandan WH Tgk. Usman Kelana, Kamis (30/7). Menurut Komandan WH itu, dari 41 kasus khalwat yang ditangani pihaknya selama tujuh bulan terakhir ini, kasus khalwat dominan para pelaku dari Kecamatan Peudada. Terkait berapa pelaku khalwat yang telah dinikahkan, Usman mengatakan, untuk proses nikah, itu sesuai kesepakatan orang tua dan perangkat gampong para pelaku. “Selama ini urusan apakah para pelaku khalawat sudah dinikahkan apa belum, laporannya tidak pernah Wilayatul Hisbah terima dari para aparat gampong pelaku,” ujarnya. Soal berapa kasus khalwat yang sudah diserahkan ke pihak Makamah Syariah, hingga kini belum ada satupun, karena, diakui Komandan WH itu, semua kasus diproses di tingkat gampong yang bersangkutan.(cih)

Sekda Tegur Mantan Kadisnaker Soal Mobil Dinas ACEH UTARA (Waspada): Sekdakab Aceh Utara Syahbuddin Usman menegur Diauddin, mantan Kadis Sosial, Tenaga Kerja dan Mobilitas Penduduk, Kamis (29/7), karena selain dinilai bobrok juga belum mengembalikan mobil dinas. Sekdakab melayangkan surat teguran resmi langsung kepada Diauddin berisi peringatan, agar mengembalikan mobil dinas karena habis masa pemakaian dan akan dipergunakan Syaifuddin, Kadis Tenaga Kerja dan Mobiltas Aceh Utara yang baru. “Memang benar mobil itu belum dikembalikan, karena itu saya melayangkan surat teguran agar dikembalikan, sebab akan digunakan Kadis baru,” ucap Sekda kepada Waspada melalui telpon seluler. Bukan hanya itu, selama menjabat Kadis, Diauddin juga menyisakan kebobrokan. Hal itu diungkapkan Kepala Dinas Tenaga Kerja dan Mobilitas Penduduk Aceh Utara, Syaifullah Daud, SE. Sementara Diauddin mengaku tidak mengembalikan mobil dinas tersebut karena masih berlaku masa pemakaian sesuai berita acara ditandatangani Sekdakab Aceh Utara, Syahbuddin Usman, M.Si. (b15)

Laut Pidie Jaya Dan Pidie Dikuasai Orang Luar MEUREUDU (Waspada): Kekayaan laut Kabupaten Pidie Jaya meliputi tujuh dari delapan kecamatan yakni Jangka Buya, Ulim, Meurah Dua, Meureudu, Trienggadeng, Pante Raja dan Bandar Baru disinyalir dikuasai orang luar, sehingga nelayan lokal makin terpinggirkan. Hal sama dialami nelayan Kabupaten Pidie, meliputi tujuh dari 23 kecamatan masing-masing Glumpang Baro, Kembang Tanjong, Simpang Tiga, Kota Sigli, Pidie, Bartee dan Muara Tiga (Pidie). Keterangan diperoleh, Kamis (30/7), pihak luar yang menguasai perairan laut Pidie Jaya dan Pidie menggunakan peralatan canggih seperti kapal-kapal dilengkapi alat tangkap modern. Sementara masyarakat nelayan masih menggunakan peralatan sampan dan alat tangkap ikan apa adanya, sehingga kalah bersaing dalam menangkap ikan di tengah lautan. Munir, salah seorang warga nelayan Pidie Jaya menjelaskan, potensi laut Pidie Jaya dan Pidie, menyimpan banyak komoditas mulai dari jenis ikan, udang dan kepiting. “Laut Pidie Jaya dan Pidie cukup kaya karena di sana ada ikan kerapu berpotensi untuk ekspor, udang kelong, swallow bahkan lobster,” ujarnya. Menurutnya, sudah lama pihak luar menguasai laut Pidie Jaya dan Pidie, bahkan tidak jarang mereka menggunakan pukat harimau. Para nelayan sudah menyampaikan persoalan ini kepada pihak terkait, namun pemerintah tidak dapat berbuat, apalagi nelayan asing tersebut dilengkapi peralatan canggih.(b21)

Polisi Pantau Pengamanan Sampai Ke Desa BANDA ACEH (Waspada): Aparat kepolisian di Aceh terus memantau keamanan dan mewaspadai setiap ancaman sampai ke desa-desa, sehingga kondisi Aceh yang sudah kondusif dapat terus dipertahankan. Penegasan itu disampaikan Kapolda Aceh Irjen Pol Drs. Adityawarman, SH, MH usai menghadiri peringatan Isra Miraj 1430 H di Masjid Lingke, Banda Aceh, Kamis (30/7). “Kita terus melakukan pemantauan pengamanan sampai tingkat desa walaupun saat ini situasi Aceh sangat kondusif,” ujarnya. Disebutkan, meski peristiwa bom bunuh diri terjadi di Jakarta, namun kewaspadaan di daerah tidak boleh lengah. Menurutnya, kejadian bom bunuh diri di Hotel Ritz Carlton dan JW Marriot harus menjadi perhatian semua pihak untuk lebih waspada. “Kita hendaknya selalu berikhtiar dan memohon kepada Allah SWT agar selalu mendapat lindungannya.” Menyinggung soal bom bunuh diri dalam pandangan sebagian orang yang menyebutkan mati syahid dan masuk syurga, kata Kapolda, itu pernyataan yang menyengsarakan orang lain dan pekerjaan sia-sia. (b09)


Waspada/M Jakfar Achmad

DO’A BERSAMA: Ketua Himpunan Ulama Daerah Aceh (HUDA) Provinsi Aceh, Tgk. H. Ibrahim Bardan alais Abu Panton (kanan), Prof. DR. Tgk. H. Muhibuddin Waly Al-Khalidy alias Buya Muhibuddin Waly (dua dari kanan) dan Bupati Aceh Utara, Tgk. Ilyas A. Hamid (tiga dari kanan), saat do’a bersama dipimpin Buya Muhibuddin Waly, usai pembukaan Mubahasah ulama Aceh, di kompleks masjid raya Bujang Salem Krueng Geukueh, Aceh Utara, Minggu (2/8) malam.

Keputusan Mubahasah Ulama Soal Aliran Sesat

Pemerintah Aceh Siap Back Up KRUENG GEUKUEH, Aceh Utara (Waspada): Bupati Aceh Utara Tgk. Ilyas A. Hamid atas nama Pemerintah Aceh, atau selaku tuan rumah menegaskan, bahwa keputusan hasil Mubahasah ulama se Provinsi Aceh adalah pegangan resmi Pemerintah Aceh.

“Pemerintah Aceh siap membackup dan menindaklanjutinya,” tegas bupati sebelum acara iftitah (pembukaan) Mubahasah perdana ulama Aceh, di kompleks Masjid Raya Bujang Salem Krueng Geukueh, Minggu (2/8) malam. “TNI/Polri wajib mendukung hasil keputusan Mubahasah ulama Aceh ini. Khusus Aceh Utara, saya sudah berkordinasi dengan Dandim dan Kapolres, akan menindak tegas terhadap oknumoknum yang menyebarkan faham sesat, atau faham-faham lainnya menyangkut akidah kalau tidak sesuai dengan hasil keputusan pembahasan ulama Aceh pada Mubahasah ini,” tegas Tgk. Ilyas A. Hamid. Kata dia, secara nasional akhirakhir ini banyak faham-faham gila yang memutarbalikkan ajaran-ajaran hukum syari’at, sampai banyak pula orang-orang gila yang mengaku dirinya nabi. “Sekarang kalau ada yang gila menyampaikan faham-faham yang bertentangan dengan hukum syari’at, saya

harapkan jangan gila pula orang yang mendengarnya,” pinta Bupati Aceh Utara. Tidak Boleh Diam Sementara Ulama kharismatik Aceh, Tgk. H. Mustafa Ahmad alias Abu Paloh Gadeng menyerukan, ulama Aceh tidak boleh diam memberantas aliran (faham) sesat. Aliran maupun faham sesat (syubhat) kini terasa tumbuh pada beberapa tempat di Provinsi Aceh, karenanya ulama dituntut bertekad (bertindak) memberantasnya, sebut Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Utara itu dalam pidato Mubahasah tersebut. Mubahasah ulama Aceh, sebelumnya tidak pernah digelar di tanah Serambi Mekah. Kalau pun ada, hanya sebatas Muzakarah (ulang-ulang kaji) menyangkut hukum-hukum syariat terkait warisan dan munakahah (nikah). Namun pada momentum ini sudah menuntut penyelenggaraan mubahasah yang sangat strategis dan urgen di bidang akidah, jelas Ketua MPU Provinsi Aceh, Prof. DR. Tgk. H. Muslem Ibrahim, MA kepada Waspada sebelum penyelenggaraan acara Mubahasah. “Saya terkejut ketika Buya Muhibuddin Waly (Prof. DR. Tgk. H. Muhibuddin Waly Al-Khalidy) berbicara lewat telefon selular, seraya menyampaikan informasi tentang faham-faham sesat yang mulai berkecambah di Aceh. Dalam pembica-

raan itu beliau membaca sepotong hadist yang maksudnya, jika bid’ah sudah lahir pada suatu daerah dan para ulama berdiam diri, Allah SWT akan melaknat penghuni daerah tersebut, termasuk para ulamanya,” sebut Abu Paloh Gadeng. Berangkat dari tanggungjawab itulah MPU Aceh Utara, kata Abu Paloh Gadeng, menggagas acara perdana Mubahasah para ulama se Provinsi Aceh, karena fenomena selama ini di dalam masyarakat Aceh muncul faham-faham sesat, memplesetkan terjemahan hukum-hukum syari’at, thariqat dan hakikat yang mengancam kerusakan akidah umat. Menurut Abu Paloh Gadeng. Mubahasah membahas atau mengkaji khusus terhadap tiga hal tadi, yaitu Syari’at (jalan/sumber hukum Islam), Thariqat (jalan/tasawuf yang membedah aliran hati) dan Hakikat (ajaran sebenarnya terhadap kemurnian akidah). Dalam pidato iftitahnya itu, Abu Paloh Gadeng juga mengharap jangan ada yang salah tafsir terhadap penyelenggaraan Mubahasah. “Maksud dan tujuan Mubahasah bukan mencari persaingan dan bukan menyebar perdebatan. Tapi sematamata untuk meluruskan pemahaman-pemahaman, menyangkut syari’at, thariqat dan hakikat agar tetap berada dalam koridor ahlussunnah wal jama’ah,” demikian Abu Paloh Gadeng.(b10)

Polisi Amankan Pencuri Dan Barang Bukti BIREUEN (Waspada): Anggota Kepolisian Bireuen melalui tim Merak berhasil menciduk tersangka dan barang bukti berupa satu unit sepedamotor di kawasan Desa Sarah Sirong, Kecamatan Jeumpa, Kabupaten Bireuen. ”Tersangka berinisila Naz, 33, mengaku warga Desa Nicah, Kecamatan Peusangan, Kabupaten Bireuen, berhasil diciduk anggota kita dari tim Merak Polsek Juli, tidak berlangsung lama hanya memakan waktu tiga jam saya,” kata Kapolres Bireuen AKBP T. Saladin, SH melalui Kabag Ops Polres Bireuen AKP Yoga Prasetyo, Sik. Senin (3/8). Menurut Yoga, sepedamotor Supra Fit BL 6468 ZE yang dicuri tersangka adalah milik korban Zakaria, 39, warga Desa Bukit Mulia, Kecamatan Juli, Kabupaten Bireuen. Kronologisnya, hilangnya sepedamotor itu pertama sekali diketahui istri korban Darmiati, 29. Saat itu ia baru saja pulang dari pasar. “Darmiati saat itu melihat sepedamotornya sudah tidak ada di dalam rumah, sedangkan kondisi rumah dengan keadaan jendela samping dan pintu belakang terbuka,” kata Kabag Ops Polres Bireuen itu. Mengetahui itu, Darmiati langsung melaporkan kejadian itu kepada suaminya. Oleh korban (Zakaria-red) langsung melanjutkan laporan kehilangan itu ke pihak Polsek Juli. Menerima laporan itu, sejumlah anggota Polsek yang tergabung dalam tim Merak langsung meluncur ke lokasi dan melakukan pengembangan saat itu di lokasi kejadian. “Identitas pelaku terbongkar setelah korban mencurigai salah seorang tetangganya, kecurigaan korban semakin beralasan saat korban mendatangi rumah orang tua tersangka dan tersangka juga tidak berada di tempat,” ucap Yoga mengulangi perkataan Zakaria. Ketika anggota tim Merak mela-

kukan pengembangan, informasi dari warga jika tersangka berada di rumah abang sepupunya, di Desa Sarah Sirong, beberapa kilometer arah selatan dari lokasi kejadian, dan tim mengarah ke sana. “Akhirnya kita menciduk tersangka bersama barang bukti sepedamotor korban yang telah dipermak tersangka. Saat itu juga tersangka dan barang bukti langsung dibawa ke Polsek Juli,” ujar

Yoga lagi. Berdasarkan pengakuan tersangka, sejak tiga hari sebelumnya tersangka sudah mengintai rumah korbannya, saat rumah korban sepi tersangka langsung melancarkan aksinya itu. Tersangka juga mengaku masuk kerumah korban dengan cara mencongkel jendela samping dan mengeluarkan sepmor dari pintu belakang.(cih)

SABANG ( Waspada): Senilai Rp4 miliar dana Jaminan Kesehatan Masyarakat (Jamkesmas) Sabang yang telah dialokasikan dalam APBK Sabang tahun 2009 sampai akhir Juli belum dicairkan. Abdul Muthalib, SE anggota DPRK Sabang dari Panitia Anggaran mengatakan, pihak Pemko Sabang telah menyampaikan draf Peraturan Walikota Sabang yang mengatur tentang tata cara dan mekanisme serta kriteria penerima bantuan dana Jamkesmas. Sebenarnya proses pencairan dana bantuan kesehatan sudah terlambat, padahal pengesahan anggaran sudah final Maret lalu. “Namun demikian kita harapkan kepada tim eksekutif untuk mempercepat proses pembuatan Perwal (Peraturan Walikota Sabang), sebab masa anggaran sudah berlalu tujuh bulan tinggal beberapa bulan lagi sudah mati anggaran,” sebutnya lagi. Kepala Bagian Hukum Setda Kota Sabang, Muslim, SH mengatakan jum’at (31/7) siang, pihaknya sudah mempersiapkan draf Perwal dan setelah berkunsultasi dengan

anggota DPRK Sabang, selanjutnya konsep tersebut dimatangkan, sehingga dalam waktu relative singkat bisa disosialisasikan oleh SKPD bersangkutan. Soal pengelolaan dana Jamkesmas senilai Rp4 miliar tersebut, menurut Muslim ditangani langsung pihak RSUD Sabang. “Sebelum direalisasikan supaya disosialisakan lebih dahulu,” katanya. Direktur RSUD Sabang, dr. Sugono dalam perjalanan dari pelabuhan Balohan – Ulee Lheue Banda Aceh dengan kapal cepat Expres Bahari, Minggu (2/8) pagi mengatakan, jika Perwal sudah final, pihaknya akan terus mensosialisasikan kepada masyarakat dan segera diimplementasikan. Menyangkut dengan pelayanan medis di RSUD Sabang, menurut, dr. Sugono akan terus ditingkatkan, tapi selama ini pihaknya terbentur dengan Perda (Peraturan Daerah) yang menetapkan besarnya jasa pelayanan medis senilai Rp7.500/pasien. Angka itu tidak sesuai lagi dengan perkembangan saat ini dan Perda tersebut harus segera direvisi kembali.(b29)

LHOKSEUMAWE (Waspada): Pemko Lhokseumawe menurunkan 17 cabang seni yang akan bersaing di Pekan Kebudayaan Aceh (PKA) V, sedangkan sekitar cabang seni lainnya hanya unjuk tampil. Sejumlah rombongan kesenian utusan Lhokseumawe itu akan berangkat besok. Selebihnya pada tahap kedua dan ketiga, kata Kasubdin Pariwisata Dinas Perhubungan, Budaya dan Pariwisata Lhokseumawe, Hasbullah saat ditanyai Waspada, Kamis (30/7). Empat cabang seni yang ikut serta itu di antaranya merupakan andalan, yaitu cabang seudati, meuzike, dala-I dan meurukon. Sedangkan pemenang I duta wisata akan bertindak sebagai penerima tamu presiden, yang direncanakan

akan membuka pekan kebudayaan itu pada 2 Agustus 2009. Dalam perhelatan akbar itu juga akan diperlombakan acara adat perkawinan masing-masing daerah. Meskipun di Aceh, kata Hasbullah, masing-masing tempat memiliki adat dan tata cara yang berbeda-beda. Perlombaan itu penting guna mengenalkan adat masingmasing daerah kepada khalayak. Salah satu sanggar tari yang sebelumnya menyatakan batal ikut PKA, berubah pikiran setelah mendapatkan sokongan dari Dewan Kesenian Lhokseumawe (DKL) dan pemerintah setempat. “Kita akan meramaikan pekan kebudayaan itu,” kata Syamsuddin, Pengurus Sanggar Seuneumah Nanggroe.(b12)

LHOKSEMAWE ( Waspada): Dalam menjalankan Operasi Militer Selain Perang (OMSP) di wilayah Korem 011/Lilawangsa, Danrem merekrut 100 warga usia produktif untuk dilatih keterampilan. Para pemuda dari Aceh Utara dan Kota Lhokseumawe itu selama tiga bulan akan mengembangkan kewirausahaan. Danrem 011/LW, Kolonel Inf Bachtiar, S.IP pada pembukaan pelatihan keterampilan, Senin (3/8) menegaskan, salah satu tugas TNI adalah membantu tugas pemerintah daerah. “Pasal 7 ayat (2) yaitu tugas pokok TNI dalam rangka Operasi Militer Selain Perang (OMSP), salah satu tugasnya adalah membantu tugas pemerintah daerah,” tegas Danrem dihadapan Bupati Aceh Utara dan Wakil Walikota Lhokseumawe di gedung KNPI Lhokseumawe. Dia menyebutkan, kondisi jajaran Korem 011/LW saat ini, masih ditemukannya masyarakat belun memiliki bekal ilmu pengetahuan dan keterampilan untuk bisa bekerja. Seperti keterampilan bidang pertukangan, perbengkelan dan las litrik. “Dengan latar belakang tersebut maka Korem berserta jajaran-

nya selaku komando kewilayahan yang mempunyai tugas pokok melaksanakan pembinaan teritorial, merasa terpanggil untuk membantu pemerintah daerah,” jelasnya. Danrem mengharapkan setelah mereka selesai mengikuti pelatihan akan memiliki skill untuk bisa terjun ke dunia pekerjaan. “Pelatihan ini sebagai modal dasar meningkatkan pendapatan keluarga,” tambahnya lagi. Sementara Bupati Aceh Utara Ilyas A. Hamid dan Wakil Walikota Lhokseumawe Suaidi Yahya secara bergantian membenarkan tingginya jumlah pengangguran akibat kurangnya keterampilan. “Kita sangat terbantu dengan adanya pelatihan yang dilakukan untuk meningkatkan keterampilan pemuda,” sebut bupati. Sementara Wakil Walikota Lhokseumawe, Suaidi Yahya menyebutkan, Pemko masih kekurangan sarana untuk bisa meningkatkan keterampilan pemuda. Di antaranya belum memiliki BLK (Balai Latihan Kerja-red). “Sebab itu dengan digelarnya pelatihan keterampilan dalam Operasi Militer Selain Perang, sangat membantu tugas pemerintah daerah.”(b17)

BIREUEN (Waspada): Seorang warga Desa Abuek Usong, Kecamatan Jeumpa, Kabupaten Bireuen menemukan mayat laki-laki warga Desa Pulo Lawang di pematang sawah, Senin (3/8). Keterangan yang diperoleh, korban bernama Ilyas Abubakar, 55, warga setempat, yang berprofesi sebagai petani sawah dan pedagang ikan. Dugaan warga, korban meninggal akibat tersengat kabel listrik telanjang, yang dipasang petani untuk menyetrum hama tikus. Korban yang memiliki tiga anak pertama ditemukan sudah tidak bernyawa oleh warga, yang sekaligus melaporkannya ke Polsek Jeumpa. Selain mengevakuasi kor-

ban ke rumah sakit, polisi juga mengamankan beberapa barang bukti dari lokasi kejadian. “Kami tidak tahu kejadiannya, menurut cerita, korban malam itu pergi ke sawah untuk mengairi sawahnya,” kata Aiyub dan Sulaiman, warga yang sedang melayat di rumah korban. Sementara Kapolres Bireuen AKBP. T. Saladin, SH melalui Kapolsek Jeumpa Iptu Shaiful Anam, mengatakan pemilik perangkat listrik itu Ismail, 45, warga Desa Mon Mane, sedangkan pemasang setrum hama tikus Alamsyah, 45, warga Desa Abuek Usong. “Kasus ini masih dalam pemeriksaan,” terang Kapolsek Iptu Shaiful Anam.(cih)

Lhokseumawe Turunkan 17 Cabang Perlombaan Seni Di PKA

Korem 011/LW Latih Keterampilan 100 Warga

Warga Temukan Mayat Di Sawah

Budaya Tiupkan Spritualitas Hidup

Waspada/Irham Hakim

BERI KETERANGAN: Kabag Ops Polres Bireuen AKP Yoga Prasetyo, Sik didampingi seorang anggota tim Merak Polsek, memperlihatkan barang bukti sepedamotor dan Naz tersangka curanmor di halaman Polres setempat, Senin (3/8).

LHOKSEUMAWE (Waspada): Berbagai peningkatan kesejahteraan dan bidang-bidang lain tak bisa menafikan budaya, sebagai pembangkit spritual kehidupan. Sebuah bangsa tidak bisa menafikan budaya, sebab dengan budayalah segala kemegahan tercipta. Saat budaya maju, bidang-bidang keilmuan juga maju. Hal ini dibuktikan bahwa hanya negara maju sajala memiliki budaya tinggi. Sebagaimana pernah dialami Aceh masa lalu, pada zaman Iskandar Muda yang megah, Aceh memiliki ahli sastra kaliber internasional, sebagaimana Hamzah Fansuri,

yang hingga kini karya-karyanya masih diteliti di berbagai perguruan tinggi. Hanya sebuah bangsa yang tidak menghargai kebudayaan saja yang terus mengalami kemerosotan, hidup tanpa spiritualitas, ungkap Prof. DR. Zainon Ismail saat berkunjung ke kawasan Budaya Paloh Dayah, Lhokseumawe baru-baru ini. Selain mengungkapkan hal itu, dia juga amat mendukung gerakan seniman dan berbincang-bincang berbagai persoalan mengenai perkembangan seni, di Muenasah Paloh Dayah, Muara Satu Lhokseumawe. (b12)


Langsa, Kualasimpang, Kutacane, Singkil


Selasa 4 Agustus 2009

Dua Rumah Warga Musnah Terbakar KUTACANE (Waspada): Dua rumah warga Kampung Baru, Kecamatan Badar, Agara, Senin (3/8) musnah terbakar, kendati tak menimbulkan korban jiwa, namun sebagian besar harta benda milik korban tak bisa diselamatakan.

Waspada/Ali Amran

KEBAKARAN: Api terlihat tengah membakar rumah Umar dan Hasan, dua pegawai Dinas Pengairan Pemkab Agara, warga desa Kampung Baru Kecamatan Badar, Aceh Tenggara, Senin (3/8).

Kuasa Hukum Minta Tersangka Kasus Jembatan Dibebaskan KUALASIMPANG (Waspada): Arif Padillah, SH kuasa hukum Ir. Albm, kuasa direktur PT. Mitra Agung Indonesia yang jadi tersangka kasus dugaan KKN pembangunan jembatan rangka baja Simpang Kiri, Kecamatan Tenggulun, Kab. Aceh Tamiang, minta penyidik (Polres Aceh Tamiang) membebaskan tersangka dari tahanan. “Saya sudah dua kali melayangkan surat keberatan penahanan terhadap klien saya, yaitu melalui surat no. 03/PH-A/VII/2009 pada 21 Juli 2009 dan surat no. 05/PH-A/ VII/2009 pada 29 Juli 2009, namun sampai kini klien saya masih ditahan, sedangkan kesalahannya belum jelas,” katanya. Dalam pengusutan kasus proyek jembatan Simpang Kiri itu, tambahnya, terkesan ada dugaan tebang pilih. Seharusnya semua yang terlibat harus ditangkap, sedangkan klien saya belum jelas kesalahannya tetapi sudah ditahan, saya mohon klien saya dibebaskan,” papar Arif Padillah kepada Waspada, Minggu (2/8). Arif menjelaskan, penyidik tidak memberi penjelasan bukti permulaan yang cukup sebagaimana disebut pada Pasal 17 KUHA Pidana terhadap penangkapan dan penahanan. Sedangkan Kasat Reskrim Polres Aceh Tamiang, AKP Muliadi, SH dan Kapolres

Aceh Tamiang, AKBP Drs. Hariyanta melalui surat No. Pol: B/1514/VII/2009/Reskrim dan Surat No. Pol: B/1548/VII/2009 Reskrim, menyatakan penangkapan dan penahanan terhadap tersangka telah memenuhi prosedur sesuai Pasal 17, 18, 20 dan Pasal 21 KUHAP. Kapolres dalam suratnya kepada Arif Padillah menyatakan, saat penangkapan penyidik telah memperoleh data/keterangan/bukti: Laporan Polisi No Pol: LP/19/III/ 2009 tanggal 17 Maret 2009, BAP saksi-saksi termasuk saksi ahli dari BPKP Perwakilan NAD dan Tim Teknis USU (Universitas Sumatera Utara) Medan, dan BAP Ir. Alberto Mawardi sebelum ditetapkan sebagai tersangka terlebih dahulu sudah diambil keterangan sebagai saksi. Selain itu bukti berupa kontrak, rekening Koran, progress, SP2D beserta lampirannya, PHO berseta lampirannya, dan bukti surat lainnya. Laporan Survey Tim Teknis USU tanggal 6 Mei 2009, dan laporan perhitungan kerugian Negara dari BPKP Perwakilan NAD tanggal 22 Mei 2009. Menurut Kapolres, dari data-data dan keterangan tersebut, maka penyidik berkesimpulan penangkapan telah dilakukan berdasarkan bukti per mulaan yang cukup.(b24)

Children Center Darul Amanah Diresmikan MEULABOH (Waspada): Wakil Bupati (Wabup) Aceh Barat Fuadri, MSi meresmikan gedung Children Center atau Pusat Kegiatan Anak Darul Amanah di Desa Peunaga Pasi Kec. Meureubo, Kab. Aceh Barat, Minggu (2/7). Gedung itu merupakan pusat program perlindungan anak dijalankan basis masyarakat dan basis center. Gedung yang diresmikan itu, dibangun Yayasan KKSP bersama Terre des Hommes (TDH) Germany. Usai peresmian yang dengan pengguntingan pita, Wabup Fuadri meninjau fasilitas klinik, perpustakaan, Taman Pembacaan Al-Quran (TPQ), Taman Kanakkanak (TK), tempat bermain, lapangan olahraga dan radio komunitas Suara Gampong. “Gedung ini akan memberikan manfaat yang besar dan akan terlihat hasilnya pada puluhan tahun ke depan,” ujar Fuadri didampingi Syamsul, Manager Operasional KKSP. Dikatakan Wabup Fuadri, gedung itu tidak hanya digunakan untuk anak-anak, masyarakat juga dapat menggunakan fasilitas itu untuk kegiatan kemasyarakatan dan keagamaan yang memberi manfaat bagi masyarakat. Manager Operasional KKSP Syamsul menyatakan, pembangunan Children Center merupakan bagian dari komitmen KKSP program kemanusiaan yang dilaksanakan sejak tsunami. Dalam pelaksanaannya, andil

masyarakat sangat besar, mulai dari tahapan perencanaan hingga pemberian nama, berdasarkan kesepakatan masyarakat. “KKSP dan TDH Germany hanya memasilitasi. Kehadiran CC ini diharapkan dapat mendukung upaya mempromosikan perlindungan dan pemenuhan hak-hak anak di daerah Aceh Barat dan Nagan Raya yang pernah terimbas konflik bersenjata dan bencana tsunami,” sebutnya. KKSP yang konsen dalam program perlindungan anak, ujar Syamsul, berupaya keras mendukung upaya masyarakat yang membutuhkan layanan terbaik bagi anak, termasuk membangun pusat kegiatan anak yang lengkap sehingga anak tidak hanya belajar dan bermain, namun anak juga dapat berkreativitas sesuai dengan minat dan bakatnya. Untuk mendukung hal itu juga ada perpustakaan keliling, layanan konseling keliling dan klinik keliling terutama untuk anak-anak yang sudah berjalan saat ini. “Pusat kegiatan anak ini juga dilengkapi dengan radio komunitas yang nantinya menjadi media kampanye untuk mempromosikan perlindungan anak bagi masyarakat Meureubo sekitarnya dan sebagai media pemersatu dan pengontrol atas kebijakan-kebijakan pemerintah daerah dalam pembangunan di daerahnya,” ujar Syamsul. (m10)

Tari Kreasi Baru Nol Kilometer Sabang Tampil Memukau Di Taman Budaya BANDA ACEH (Waspada): Untuk mengisi kegiatan Pekan Kebudayaan Aceh (PKA) V Banda Aceh, panitia menyelenggarakan lomba tari kreasi baru di gedung pertunjukan Rakyat Taman Budaya Banda Aceh, Senin (3/8) pagi. Dari puluhan sanggar tari yang tampil dari Kab/Ko di Aceh sejak pagi hingga sore hari, Sanggar Nol KM (Kilometer) Sabang di bawah pimpinan Ny. Munawar Liza Zainal tampil memukau penonton. Sanggar Tari ini memegang nomor undian 13 setelah sanggar tari dari Langsa yang mengantongi nomor undian 12. Sanggar tari Nol KM Sabang tampil dengan judul tarian bantai-bantai (mantal-bantal). Dari komentator master of ceremony acara lomba, judul bantai-bantai yaitu perpaduan musik tari dengan menggunakan bantal kecil sebagai alat musik tradisional. Tari ini terwujud berdasarkan inspirasi yang memasukan tari tradisi seudati, lawet, tulotulo, ratoh dan anggok yang merupakan musik dan tari tradisional pada zaman dahulu kala. Musik tradisi yang tumbuh melalui perpaduan bantai (bantal) dengan alat musik tradisi menjadi sebuah musik dan tari kreasi yang dikemas apik oleh koreografer Teuku Admiral. Koreografer Teuku Admiral mengatakan kepada Waspada, pihaknya telah berupaya maksimal agar tim Sabang bisa tampil prima dan Alhamdulillah mendapat sambutan hangat dari penonton. Pihaknya optimis masuk 5 besar. Sedangkan pengumumannya masih ditunda karena dewan juri harus bersidang secara cermat. Menurut informasi yang ia terima, yang berhasil meraih juara 1, 2 dan 3 akan ditampilkan di panggung utama Pertunjukan Rakyat di arena Pekan Kebudayaan Aceh

(PKA) V, Taman Ratu Syafiatuddin Banda Aceh, pada malam penutupan PKA-V. Kelompok Sanggar Sanggar Nol KM Sabang terdiri dari 7 penari srikandi (cewek) dan 2 penari cowok, sedangkan pemusik 7 orang dan penyanyi 1 orang Yani (siswi SMA Negeri 1 Sabang kelas III).(b29)

Pedagang MP Banjiri Kota Langsa LANGSA (Waspada): Memasuki Agustus 2009 dan menjelang peringatan HUT Kemerdekaan ke 64 pada 17 Agustus 2009, pedagang musiman bendera dan umbul-umbul merah putih (MP) mulai membanjiri beberapa titik keramaian Kota Langsa, Provinsi Aceh. Pengamatan Waspada, Minggu (2/8), pedagang menggantung bendera berbagai jenis dan ukuran sejak pagi hingga sore di jalan A. Yani, Sudirman, T. Umar dan jalan lainnya di pusat kota. Wahyu, 14, pedagang musiman yang menjajarkan benderanya di jalan Sudirman mengatakan, menjadi pedagang bendera musiman telah dilakoni ayahnya sejak dulu. “Saya bantu ayah jualan bendera, memang ayah selalu menjual bendera setiap menjelang HUT kemerdekaan di sini,” sebut Wahyu yang masih duduk di bangku SLTP. Ditambahkan, bendera dan umbulumbul merah putih yang dijualnya memiliki harga bervariasi dan tergantung ukuran. Untuk ukuran besar dengan diameter dua meter seharga Rp40.000 hingga Rp50.000 per lembar. “Untuk umbul-umbul kendaraan per lembar Rp3.000, ukuran sedang Rp8.000, ukuran satu meter Rp20.000-25.000 per embar. (cmad)

Beberapa saksi mata yang ditemui Waspada di tempat kejadian perkara mengatakan, sebelum api melalap rumah Umar Harahap alias Opung dan Hasan alias Mondok, terlihat kepulan asap hitam dari komplek perumahan Dinas Pengairan Pemkab Aceh Tenggara (Agara).

Melihat kepulan asap hitam semakin tebal, beberapa warga di tempat kejadian perkara dan desa Kampung Baru sekitarnya, bergegas mencari asal serta lokasi munculnya apas hitam tebal tersebut. Namun, saat warga tiba di rumah milik pegawai Dinas Pengairan Pemkab Agara itu, kepulan asap hitam telah berubah menjadi kobaran api yang telah membakar sebagian rumah Umar dan Hasan. Kendati warga di sekitar tempat kejadian perkara dan warga Kampung Baru telah mencoba memadamkan kobaran api, namun api baru bisa dipadamkan setelah empat unit mobil pemadam kebakaran dan aparat kepolisian tiba di lokasi. Karena itu, kebakaran yang hanya berlangsung lebih tiga puluh menit itu

mengakibatkan barang berharga milik korban gagal diselamatkan dan hanya sebagian kecil perabot rumah tangga yang berhasil diselamatkan dari amukan api. Hingga berita ini diturunkan, Waspada belum memperoleh data tentang penyebab kebakaran dan asal muasal api yang menyebabkan rumah dua Pegawai Dinas Pengairan musnah terbakar serta kerugian yang timbul akibat musbah di siang hari tersebut. Pantauan Waspada, meski api telah berhasil dipadamkan petugas Dinas Pemadam Kebakaran Pemkab Agara, namun keluarga korban kebakaran yang menetap sementara di rumah tetangga terdekat, terlihat masih histeris dan terpukul melihat kejadian yang diduga itu.(b27)

Korban Kabakaran Masih Mengungsi REDELONG, Bener Meriah (Waspada): Pasca terjadinya kebakaran di Simpang Utama, Kampung Pondok Baru, Kecamatan Bandar, Kabupaten Bener Meriah, menyebabkan sedikitnya 18 Kepala Keluarga (KK) mengungsi, Pemkab Bener Meriah telah menyediakan Posko penampungan. Walaupun telah disiapkan tempat penampungan sementara, korban memilih mengungsi di rumah sanak famili. Seperti dikatakan oleh Camat Bandar, Sadra BK SE, Senin (3/8). Menurut Sadra, meski Pemkab menyediakan Posko penampungan, tapi semua korban lebih memilih mengungsi di tempat saudaranya. Selain menyediakan Posko, Pemkab juga menerjunkan

tim dari kesehatan, melayani korban kebakaran hingga ke tempat saudaranya tinggal. Ditambahkan, kebakaran Simpang Utama, Kampung Pondok Baru Kecamatan Bandar yang terjadi Sabtu (1/8) sekitar pukul 03.00 menyebabkan sedikitnya 18 rumah toko (Ruko) musnah. Camat Bandar mengatakan, bantuan untuk korban terus mengalir dari berbagai kalangan seperti Pemkab Bener Meriah berupa uang Rp1 juta per KK diserahkan Sekda Drs. Ishak MS, MM. Bantuan Dinas Sosial berupa Jatah Hidup (Jadup) dan sembako dan bantuan yang diserahkan Kadis Sosial Kabupaten Bener Meriah Azzama, SE, MM dan bantuan dari Palang Merah Indonesia (PMI) Cabang Bener Meriah diserah-

kan Ketua PMI Abu Bakar serta bantuan Disdikpora diserahkan Sekretaris Disdikpora, Darwin, SE, MH. Sementara itu dari 18 korban kebakaran, tiga di antaranya tenaga pengajar yang rumahnya juga ikut hangus. Kepada tiga tenaga pengajar, pihak Dinas Pendidikan Pemuda dan Olah Raga memberi bantuan masa panik Rp1 juta per orang. Selanjutnya, dibuka posko bantuan di Sekolah Dasar Negeri (SDN) 2 Pondok Baru. Kapolres Bener Meriah AKBP Helmi Kwarta K Putra, S.Ik, MH, mengatakan, pihak kepolisian belum bisa menentukan penyebab kebakaran, menunggu tim laboratorium dan forensik dari Medan yang akan turun ke lokasi.(cb04)

Kinerja PDAM Langsa Kembali Anjlok LANGSA (Waspada): Kendati sempat menunjukkan kinerja bagus awal tahun lalu dengan meningkatnya jumlah konsumen, namun kualitas pelayanan Perusahaan Daerah Air Minum (PDAM) Tirta Keumuning langsa kembali anjlok, Senin (3/9). Perusahaan yang seharusnya menyalurkan air bersih ke konsumen tapi kini malah sebaliknya, perusahaan ini menyalurkan air berwarna seperti lumpur ke sejumlah kon-

sumen. “Ini menandakan kinerja perusahaan itu sangat mengecewakan,” sebut, Syafrizal, 29, salah seorang warga Desa Pondok Keumuning Kecamatan Langsa Lama. Menurutnya, sejak seminggu belakangan air yang disalurkan perusahaan itu setiap hari berwarna kuning kehitam-hitaman seperti lumpur. Syafrizal mengaku ketika masalah ini disampaikan langsung kepada Direktur PDAM

Tirta Keumuningjawaban yang diperoleh memuaskan bahwa masalah tersebut segera diatasi. Namun kondisi itu sampai saat ini tak kunjung juga diperbaiki. “PDAM jangan mengambil keuntungan di atas penderitaan konsumen,” ujarnya karena jika konsumen telat membayar rekening air maka perusahaan itu langsung memberikan denda, tapi di sisi lain pelayanan yang diberikan tidak memuaskan.(b25

Pemenang Terbaik 1 MTQ Mahasiswa Nasional XI:

FAISAL Amsa, 32, Warga Desa Keude Simpang Jalan, Kecamatan Seunuddon, Kabupaten Aceh Utara, yang telah lama menetap di Desa Panggoi, Kecamatan Muara Satu, Pemko Lhokseumawe, merupakan salah seorang peserta Musabaqah Tilawatil Quran (MTQ) Mahasiswa Nasional XI, mewakili tuan rumah Universitas Malikussaleh (Unimal). Pada even nasional itu, dia ikut dalam cabang Qira’ah Saba’ah. Kata dia, tidak ada persiapan matang yang dilakukan, karena pihak Unimal memberitahu untuk mengikuti MTQ sekitar sepuluh hari sebelum hari-H. Parahnya lagi, Faisal diharuskan mengikuti cabang yang tidak biasa diikutinya yakni Qira’ah Saba’ah. Dengan kemampuan seadanya, dia menyanggupi permintaan tersebut. “Biasanya, setiap mengikuti MTQ baik untuk tingkat kabupaten/kota maupun tingkat provinsi, saya ikut cabang Tilawah. Tapi kali ini saya diminta ikut cabang Qira’ah Saba’ah. Begitu pun tidak ada perbedaan mencolok, maka saya sanggupi permintaan tersebut,” ucap Faisal Amsa. Mahasiswa tingkat akhir Fakultas Sosial dan Politik (Sospol) Unimal itu juga mengaku, saat diberitahu dia sedang melaksanakan kuliah pengabdian masyarakat sebagai salah satu syarat untuk menyelesaikan pendidikan S1. Hampir setiap MTQ di Provinsi Aceh dia tidak pernah absen. Namun selalu gagal dan tidak pernah menjadi yang terbaik. Paling juga membawa pulang juara harapan. Untuk mewujudkan keinginannya menjadi yang terbaik, anak ke lima dari lima bersaudara itu terus belatih dan mengulangngulang bacaan Al Quran setiap ada kesempatan. Atas ketekunan dan kesa-

barannya dalam mengasah kemampuan, akhirnya Faisal berhasil menjadi terbaik satu cabang Qira’ah Saba’ah di MTQ Mahasiswa Tingkat Nasional XI di Kampus Unimal, Reuleut, Aceh Utara, 31 Juli kemarin. “Ini anugerah yang diberikan Allah kepada saya. Dan kebahagiaan yang tidak bisa saya lukiskan dengan katakata. Menjadi yang terbaik di MTQ merupakan impian saya. Alhamdulillah, impian saya terwujud,” katanya. Sesuai firman Allah, SWT, “ Orang-orang yang bersung-

guh-sungguh di jalan Kami sungguh akan Kami beri petunjuk kepada jalan Kami. Rasulullah, SAW bersabda, “Barang siapa bersungguh-sungguh pasti berhasil. Kata Faisal, yang berhasil menjadi yang terbaik satu pada MTQ Mahasiswa Nasional XI akan diikutsertakan pada MTQ di Taheran, Iran ke depan. “Do’akan, semoga saya kembali menjadi yang terbaik dan mampu mengharumkan nama negara dan daerah,” pinta alumni Politeknik Lhokseumawe itu. Maimun Asnawi, S.Hi

Waspada /Mansurdin

TINJAU ANJUNGAN: Wagub Aceh Muhammad Nazar, S.Ag didampingi Wakil Walikota Banda Aceh Hj. Illiza berbincang dengan kontingen PKA Aceh Singkil saat meninjau anjungan tersebut, Sabtu (2/8).

Wagub Kunjungi Anjungan Aceh Singkil BANDA ACEH (Waspada): Wakil Gubernur Aceh, Muhammad Nazar, Sabtu (1/8) meninjau anjungan Kabupaten Aceh Singkil di Pekan Kebudayaan Aceh (PKA) V, didampingi Wakil Walikota Banda Aceh Hj. Illiza Sa’aduddin beserta rombongan. Wagub Aceh mengharapkan anjungan Kabupaten Aceh Singkil yang menampilkan adat istiadat tersebut dapat memberi nilai budaya masyarakat di daerah itu. Kehadiran Wakil Gubernur sekaligus melihat kesiapan PKA. Selain itu Wagub juga berharap kepada panitia untuk tetap menjaga kebersihan di lokasi anjungan. Selain Wakil Gubernur Aceh Muhammad Nazar, Wakil Bupati Aceh Singkil H. Khazali juga hadir di anjungan tersebut, Wakil Bupati berharap, anjungan Kabupaten Aceh Singkil dapat menampilkan seni budaya dan adat yang ada di kabupaten itu. Sementara Ketua Panitia PKA V Kabupaten Aceh Singkil Aidil Zulfadla, S.Pd dalam laporannya pada pelepasan rombongan oleh Bupati H. Makmursyah Putra dan Unsur Muspida Aceh Singkil, Kamis (30/7), mengatakan, kegiatan yang akan ditampilkan meliputi Tarian Kreasi Baru, Seni Lukis, Zikir Maulid, Qasidah, Marhaban, juga Tarian Tradisional, Peugot Kuweh Aceh serta olahraga tradisional.(cb02)

261 CPNS Di Agara Terima SK KUTACANE (Waspada): Setelah menunggu beberapa bulan, 261 CPNS dari jalur umum di Aceh Tenggara akhirnya bernafas lega setelah pihak Badan Kepegawaian Pendidikan dan Pelatihan membagikan SK pengangkatan. Kepala BKPP melalui Kabid Pembinaan dan Pengembangan, M. Irfa Sebayang. SE, M.AP di ruang kerjanya, Senin (3/8) mengatakan, SK CPNS yang dibagikan ikhusus kepada CPNS jalur umum. Untuk tahap awal, CPNS yang menerima SK 230 orang, sisanya 31 lagi akan dibagi beberapa minggu kemudian, karena masih tahap pembuatan di kantor BAKN Regional VI Medan Sumatera Utara. SK yang diterima merupakan tahun pengangkatan atau TMT tahun 2008, sedangkan CPNS yang menerima SK itu 58 orang berasal dari Golongan II, dan 172 lagi Golongan III. Diterangkan Irfan, ke semua CPNS yang menerima SK berasal dari tenaga administrasi, tenaga penyuluh, tenaga kedehatan dan tenaga guru edukatif yang ditempatkan di berbagai dinas, badan, kantor serta instansi di lingkungan Pemkab Agara.(b27)

Isu Mutasi Merebak Di Aceh Tamiang KUALASIMPANG (Waspada): Isu mutasi dan promosi pejabat penting di lingkungan Pemkab Aceh Tamiang mulai merebak di kabupaten yang dijuluki sebagai Bumi Muda Sedia itu. Informasi yang diperoleh, Minggu (2/8), disebut-sebut sejumlah pejabat eselon II dan III akan dimutasi dan dipromosikan oleh Bupati Drs. H. Abdul Latief. Juga disebutkan, dua Camat yaitu Camat Bendahara dan Pj. Camat Banda Mulia serta sejumlah pejabat lainnya akan diganti, bahkan untuk posisi Camat akan ditempatkan alumni APDN. “Untuk penggantian Camat Bendahara dan Banda Mulia sudah dibahas di Kantor Bupati, karena sudah ada tim Baperjakat yang melakukan evaluasi untuk mutasi dan promosi,” sebut sumber. Bukan itu saja, lanjutnya, tokoh masyarakat dan tokoh pemuda Kecamatan Bendahara dan Banda Mulia, baru-baru ini mendatangi pendopo bupati mohon agar Camat Bendahara dan Banda Mulia jangan diganti. Bupati H. Abdul Latief belum berhasil dikonfirmasi, karena sedang berada di Banda Aceh. Tapi Ka. BKPP Kabupaten Aceh Tamiang, Basyaruddin, SH ketika ditanya melalui telepon selularnya, Minggu, membenarkan bakal ada mutasi dan promosi jabatan namun belum tahu tanggal pelaksanaannya, begitu juga nama-nama pejabat yang akan dimuatasi. “Kalau soal Camat Bendahara dan Banda Mulia itu tanya saja ke Bagian Pemerintahan,” saran Basyaruddin.(b24)

Tewas Ditabrak Mopen KOTA LANGSA (Waspada): Abdul Qadir, 57, warga Tanah Terban Kecamatan Karang Baru, Aceh Tamiang tewas saat sepedamotornya ditabrak mobil penumpang ketika hendak mengantarkan bubur untuk anaknya di Madrasah Ulumul Qur’an (MUQ) Langsa, Senin (3/8). Dalam musibah maut itu kedua putrinya, Siti Asiah, 16, dan Suratul Haina, 11, selamat dengan luka kritis. Saat ini keduanya berada di RSUD Langsa. Kepada wartawan Siti Asiah menceritakan, musibah yang dialami bersama adik dan orangtuanya itu terjadi sekira pukul 18.30, saat mengendarai sepeda motor Kharisma dari rumah di Tanah Terban hendak ke pesantren MUQ Langsa untuk menjenguk kakaknya sekaligus membawa bubur buatan ibunya. Tiba-tiba dari arah berlawanan (Langsa – Medan ) muncul mopen jenis mini bus atau ADT dan terjadi tabrakan. Warga mengungkapkan, saat kejadian kondisi jalan sedang sepi karena menjelang shalat magrib.(b25)

PNS Bukan Raja

Maimun Asnawi, S.Hi

6 JUTA RUPIAH: Faisal Amsa menunjukkan hadiah uang tunai Rp6 juta sebagai uang pembinaan yang berhasil diraihnya pada MTQ MN XI. Dalam even tersebut Faisal berhasil menjadi terbaik I cabang Qira’ah Saba’ah.

IDI, Aceh Timur (Waspada): Pegawai Negeri sipil (PNS) bukan raja, tapi pesuruh atau pelayan masyarakat. Karena itu layani masyarakat dengan baik dan jangan berharap dilayani. Demikian amanat Bupati Aceh Timur Muslim Hasballah diwakili Kepala Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Aceh Timur, Muhammad, SH, MH pada penyerahan SK kepada 309 Calon Pegawai Negeri Sipil (CPNS) formasi umum 2008, di halaman Setdakab di Idi Rayeuk, baru-baru ini. Bupati menegaskan, seseorang yang telah diangkat menjadi PNS harus siap berbakti serta bekerja semaksimal mungkin demi memajukan daerah. Apalagi status PNS merupakan kepercayaan pemerintah yang notabene merupakan jelmaan kepercayaan dari publik. “Jangan sesekali mengkhianati kepercayaan dan amanah masyarakat. Sebab selain beresiko berurusan di meja hijau, segala tindak tanduk yang merugikan orang lain juga wajib dipertanggungjawabkan di mahkamah Tuhan di akhirat kelak,” seru Bupati Muslim Hasballah. Sementara Kasubbag Humas Aceh Timur, Sayyid Syamsul Qamal, yang ditemui terpisah menjelaskan, penyerahan SK pengangkatan CPNS dilakukan secara simbolik oleh Kepala Badan Kepegawaian, Pendidikan dan Pelatihan Aceh Timur, Muhammad, SH, MH kepada tiga peserta yang masing-masing diwakili dr. Zainuddin dari Tenaga Kesehatan, Onza Nastikalia, A.Ma.Pd Tenaga Guru dan Sayed Murtadha, S.PT mewakili Tenaga Adm.(cmus)


WASPADA Selasa 4 Agustus 2009

23 Kizashi Meluncur

Transaksi IIMS Rp 1,7 T Transaksi di ajang Indonesia International Motor Show (IIMS) 2009 yang berlangsung di Jakarta International Expo (JIExpo), Kemayoran, Jakarta 27 Juli sampai 2 Agustus, mencapai target yang ditetapkan, dengan nilai Rp 1,7 triliun. “Dalam hal transaksi, IIMS kali ini mencatatkan total angka mencapai Rp 1,731 triliun,” ungkap ketua pelaksana IIMS 2009 Johnny Darmawan, Minggu (2/8), yang merupakan hari terakhir gelaran. Dengan hasil tersebut, pameran IIMS 2009 kali ini memang agak turun dibanding tahun lalu, tahun 2008 lalu, IIMS mencatat transaksi sekitar Rp 1,8 triliun. Namun hal ini terbilang menggembirakan mengingat ekonomi RI masih terkena dampak krisis global. “Dan dapat dipandang sebagai catatan dan prestasi tersendiri di tengah krisis ini,” ungkap Johny tentang pameran yang diikuti oleh 21 merek mobil, 7 merek motor serta 120 aksesoris kendaraan. 237 Ribu Pengunjung Sementara, meski melebihi jumlah tahun lalu, pengunjung IIMS 2009 belum melewati target yang ditetapkan panitia. Hingga pukul 18.00 WIB, hari terakhir IIMS pada 2 Agustus 2009, jumlah pengunjung yang datang ke ajang otomotif terbesar di Indonesia ini telah mencapai 237.687 orang, masih kecil dibanding target panitia sebanyak 250.000 orang. “Angka pengunjung ini lebih besar dari tahun lalu, tapi memang lebih kecil dari target yang kita tetapkan di 250.000,” ujar Johnny. Namun meski tidak mencapai target, Johnny menilai IIMS sudah cukup sukses. Apalagi melihat angka pengujung ini jauh lebih tinggi dari tahun lalu, padahal ketika akan dilaksanakan, tempat kegiatan di Kemayoran yang jauh dari pusat kota serta situasi ekonomi yang sedang anjlok menimbulkan banyak keraguan. Padahal baru kali ini sejak pertama kali dilaksanakan, IIMS menampilkan industri roda dua dan beragam aksesoris pendukung otomotif serta konser musik di acara ini. Terlebih bila kita bandingkan angka pengunjung harian IMS tahun ini dan tahun lalu. “Bila dulu di JCC pengunjung harian hanya bisa 24.000, di IIMS kali ini bisa menembus angka 35.000. Ini merupakan sebuah prestasi,” tandasnya. (h09)

Honda Manjakan Komunitas Matik Dunia Matik Honda

Honda, pemimpin pasar sepeda motor di tanah air, kembali menggelar acara sebagai ungkapan terima kasih kepada konsumen yang telah mempercayai pilihan terhadap pabrikan berlogo sayap berkepak ini. Para komunitas pemakai sepeda motor skutik (Skuter Otomatik) diundang pihak Astra Honda Motor bersama main dealer di seluruh tanah air, ke Jakarta menyaksikan sederetan artis top dalam rangkaian peluncuran skutik Vario Techno CBS akhir pekan lalu. Para wakil klub yang berangkat tak ayal, pasti merasa beruntung

menyaksikan aksi panggung Agnes Monica, Duo Maia, D’Massive, The Titans serta Afgan dan Cinta Laura di acara yang mereka hadiri ‘Dunia Matik Honda’. Sekitar 63 klub motor matik Honda dari seluruh Indonesia, mulai dari Banda Aceh hingga Jayapura tampak begitu bersemangat menyaksikan peluncuran motor varian teratas skutik Honda ini di Integrity Convention Center Mall Mega Kemayoran, Jakarta Minggu (2/ 8). Acara peluncuran Honda Vario CBS Techno ini sendiri juga dibarengi dengan peluncuran wajah baru dari skutik Honda

yang telah ada yakni New Beat dan New Vario. Para komunitas klub motor matik ini, semuanya diterbangkan dari kota asal, dan setibanya di Jakarta diinapkan satu malam di salah satu Hotel berkelas di Jakarta, semuanya dengan gratis tentunya. Peluncuran motor yang bulan lalu telah diperkenalkan ke media ini, tampak meriah. Apalagi ke-63 klub yang sengaja diundang ini hadir dengan sekitar 228 anggota mereka. Mereka adalah wakilwakil dari komunitas pengguna motor Honda Beat dan Vario. Dari Medan, tampak hadir wakilwakil dari klub HVC (Honda Vario Club), Vanatik, serta De’Beatless.

“Acaranya luar biasa. Kapan lagi bisa jumpa langsung artisartis papan atas beraksi di atas panggung. Apalagi, yang tampil semuanya punya hits, enggak heran kalau kami-kami tadinya histeris,” ungkap seorang pengunjung. Anak-anak klub, yang berbaur dengan ratusan siswa SMU yang juga ikut diundang, terlihat larut setiap kali artis mereka melantunkan lagu. Apalagi para vokalis tersebut tak segan menyambangi mereka berjabat tangan dari panggung. Acara berdurasi 60 menit yang juga disiarkan live RCTI ini seperti berlangsung begitu singkat. Namun, hampir semua yang hadir tampak puas dengan

aksi-aksi yang telah mereka nikmati. “Ini pengalaman yang tak terlupakan. Terima kasih untuk Honda, timpal M. Afandi dari De’Beatless dan Jaka (Vanatik). Semua anggota klub yang hadir di tempat berlangsungnya acara tampak begitu antusias menyaksikan prosesi peluncuran motor matik terbaru Honda itu. “Hadirnya komunitas ini merupakan bentuk apresiasi kami terhadap mereka, karena Honda sangat peduli dengan komunitas-komunitas pengguna motor Honda yang ada,” ucap Marketing Manager CV Indako Trading Co Leo Wijaya SE, MBA didampingi Gunarko Hartoyo. # Armansyah Th

Acura ZDX:

Kombinasi Style, Peforma Dan Teknologi

Waspada/Armansyah Th

Aksi menawan grup band d’massive yang mengisi acara Dunia Matik Honda di ICC, Kemayoran, Jakarta Sabtu (1/8) malam mendapat sambutan meriah dari komunitas Klub Matik Honda.

Acura ZDX hadir dengan tiga tipe yaitu ZDX, ZDX Technology dan ZDX Advance yang paling mewah. Untuk pasar Amerika Serikat, ZDX mengkombinasikansistempenggerak roda canggih Super Handling All WheelDrive(SH-AWD)denganmesin 3.7 literV6 yang memproduksi 300hp dan torsi 366Nm. Bersama Honda’s excellent SHAWD atau Super Handling All-Wheel Drive, Acura ZDX di AS akan ditenagai dengan mesin V6 3,7 liter berdaya 300PS yang mampu menghasilakan torsi 366Nm. ZDXmengkombinasikansisistyle, peforma dan kecanggihan teknologi sports coupe empat pintu dengan fleksibilitas dan commanding pressence SUV. Prototipenya hadir di ajang pameran New York International Auto Show 2009. Versi produksinya mempertahanakan fitur-fitur utama prototipe seperti panoramic glass roof, handle pintu

belakang yang tersembunyi dan fender besar. Bukan hanya tampilannya saja yang dipoles, tapi juga peformanya. Mesin aluminium yang ringan mampu memproduksi daya akselerasi menggetarkan dengan torsi besar di putaran rendah dan menengah. Daya produksi mesin dikelola gearbox 6-speed matik –dikendalikan lewat paddle shifter di kolom kemudimenghasilkan harmoni antara efisiensi dan peforma. SH-AWD mengkombinasikan peforma handling terbaik dengan kemampuan beroperasi disemua musim. Alloy wheel standar berdiameter 19 inch dengan 7 palang. Inilah diameter wheel paling besar di keluarga Acura. Interiornya –seperti layaknya mobil mewah- ZDX menampilkan kesempurnaan tertinggi. Semua bagianinteriordibalutkulityangdijahit tangan seperti kemudi, dashboard,

Honda Vario CBS Techno

Skutik Yang Paling Aman Dan Nyaman Tabir Honda Vario baru yang selama ini menjadi tanda-tanya akhirnya terjawab, karena PT Astra Honda Motor (AHM) telah meluncurkan skuter otomatik (skutik) premium mereka itu, Vario CBS Techno.


Sekali lagi, Honda kembali membuktikan, kalau pabrikan ini selalu terdepan dalam penerapan fitur dan teknologi. Skutik teranyar mereka ini memang sudah dilengkapi fituryang tidak dimiliki para kompetitor, utama-

Kenali Busi Palsu

Maraknya peredaran busi palsu di pasaran kini membuat konsumen harus semakinwaspada. Karena membeli busi palsu itu sesungguhnya merugikan, terutama bila dilihat secara kualitas. Berikut beberapa tips agar konsumen mampu mengenali busi palsu. Sangat sulit untuk mengenali asli tidaknya sebuah busi dari kemasan luarnya saja, jadi konsumen pun harus jeli melihat dan membedakan dari fisik busi itu sendiri. Bagian pertama yang harus diperhatikan, adalah ring busi, dimana ring busi palsu itu mudah dan dapat terlepas. Padahal kalau busi asli bagian ring itu tidak dapat lepas. Bagian kedua yang paling mudah dilihat adalah warna keramik busi. Bila busi asli memiliki warna gading pada keramiknya, tidak begitu pada busi palsu. Sebab biasanya busi palsu memiliki warna keramik yang lebih muda, bahkan cenderung memutih. Yang palsu warnanya lebih muda dan bahkan ada yang putih. Bagian lain yang mampu menjelaskan bahwa busi asli adalah kode produksi busi yang ada di tubuh busi itu. Karena bila busi asli harus ada kode produksinya, yang palsu biasanya tidak ada. Lebihlanjut,bagianlainyangdapat menjadi patokan yakni ada di cetakan yang ada di keramik. Bila busi itu palsu biasanya tulisan di keramik lebih tebal dan kadang tidak simetris. Sementara pada busi asli itu tidak terjadi. Dan yang terakhir, disarankan membeli busi pada distributor besar dan resmi. (h09/bg sumber)

nya Combi Brake System (CBS). Combi brake system adalah cara pengereman yang memudahkan pengendara mengantisipasi segala situasi jalan dengan nyaman. Fitur ini berada di roda belakang yang bila tuas rem belakang ditarik, maka daya pengereman tidak hanya didistribusikan ke roda belakang, namun juga sebagian akan disalurkan ke roda bagian depan. “Dengan mengaplikasi teknologi CBS membuat membuat varianVario Techno menjadi paling aman dari semua skutik yang ada saat ini,” sebut Gunarko Hartoyo dari CV Indako Trading Co (main dealer Honda), yang menemani media Sumut selama peluncuran di Integrity Contenvion Center, Mall Mega Kemayoran, Jakarta Sabtu (1/8) malam. Dengan adanya fitur CBS, maka sistem pengereman pada Vario Techno kini lebih praktis dan nyaman, karena tangan kanan pengendara bisa bebas dan leluasa memainkan selongsonggas,tanpaperlumemikirkan tugas pengereman pada roda depan. Varian baru ini, menurutnya, adalah varian ‘pelengkap’ Honda dimana di pasaran sebelumnya Honda sudah memiliki Vario dan Beat, yang pada hari bersamaan juga tampil dengan wajah baru. Menurut Leo Wijaya SE, MBA, kasta tertinggi dariVario ditawarkan dengan harga menarik, karena tidak berbeda terlalu jauh dengan bandrol Vario CW.“Untuk informasi lebih jelas

anda bisa menyambangi dealerdealer dan show-room Honda terdekat,” sebut Marketing Manager CV Indako Trading Co, ini. Soal spesifikasi, selain penerapan fitur Combi Brake System padaVario CBS Techno, motor ini juga mengusung konsep lain yang terbilang cerdik yakni Hi Tech & Hi Grade Sporty. Vario juga dianggap juga memiliki tingkat kenyamanan dan keamanan yang tinggi dengan fitur yang berkelas, karena telah dilengkapi dengan sistem pengereman yang merupakan pertamaditerapkandiIndonesiayakni parking brake lock, slide stand. Selain itu, secara desain, motor yang dilepas dengan harga 15 jutaan ini terlihat sangat sporty dengan desain lampu depan ganda yang berkarakter tegas dan agresif. Begitu pula dengan garis tegas di bodi yang pada akhirnya bermuara ke lampu belakang alias tail lamp yang dibuatdengandesaintajamyangtidak kalah agresif dan futuristik. Panel indikator yang diaplikasi di motorinipunbakalmembantumemperkuat imageVario CBSTechno sebagai motor eksklusif. Terlebih panel indikator tersebut juga memiliki disain yang modern namun tanpa mengurangi sisi ergonominya. Vario CBS Techno tersedia dalam lima pilihan warna yakni element black, integra white, acura silver, odyssey violet, dan clarity red. Berbekal Vario CBS Techno, dan juga dibarengi refreshing pada Vario

Waspada/Armansyah TH

SUPER CAR: Para pengunjung antusias menyaksikan jejeran super car Ferrari pada hari terakhir IIMS di (JIExpo), Kemayoran, Jakarta, Minggu (2/8).

Suzuki akhirnya meluncurkan sedan mid-sized terbarunya Kizashi yang dipastikan menjadi rival berat Toyota Camry. “Dalam mengembangkan dan memberikan nama pada model terbaru kami, kata Kizashi memiIiki makna sesuatu yang hebat telah datang. Saat ini Kizashi telah hadir dan kami berharap nama serta produknya akan semakin menguatkan image Suzuki untuk memberikan produk terbaik di masa depan,” ujar Preiden American Suzuki Kevin Saito, pekan ini. Sedan sport ini menggunakan platform dari mobil konsep Suzuki Kaizashi yang pertama kali diperkenalkan ke publik dunia dua tahun lalu. Mobil yang diproduksi di pabrik Suzuki terbaru di kota Sagara, Jepang, ini mengusung mesin 2.4-liter DOHC inline empat silinder. Sedan berdimensi 4.650 mm x 1.820 mm x 1.480 mm ini memiliki fitur-fitur keamanan seperti delapan standar airbag, ESP, anti-lock brakes, projector beam headlamp, dan tyre pressure monitoring system. Kizashi juga dipastikan akan diproduksi untuk versi hybrid dalam waktu dekat. (h09/inc)

dan Beat, Honda sepertinya kini lebih siap bersaing di pasar skutik, satusatunya segmen yang hingga kini belum mereka kuasai. (h09)

Acura ZDX mempertahanakan fitur-fitur utama prototipe seperti panoramic glass roof, handle pintu belakang yang tersembunyi dan fender besar. Bawah, untuk versi yang lebih mahal, sudah ditambahi sisten navigasi yang dikendalikan suara.

panel-panel dan center console. Interior yang kaya sentuhan kulit berkualitas tinggi ini melahirkan kesan hangat dan mengundang, menciptakan ruang kokpit yang intim untuk pengemudi dan penumpangnya. Fleksibilitas dan serbaguna membuat ZDX memudahkan pemiliknya. Kursi-kursinya bisa mengakomodasi lima penumpang dewasa sekaligus mempertahankan ruang space lapang dibelakang kursi kedua. Ruang kargo bisa diperluas untuk memuat barang-barang berukuran panjang, seperti tas golf dengan cara melepas panel samping di dinding ruang kargo. Tambahan lagi, ruang penyimpanan dibawah lantai. Fitur-fituryangditanamtermasuk koneksi Bluetooth, power tailgate dan

sistem audio berkekuatan tinggi. Sistem audio-nya bisa memutar CD, radio AM/FM dan radio satelit XM serta dilengkapi USB Interface untuk iPod. Pada versi yang lebih mahal, ditambahi sisten navigasi yang dikendalikan suara, Acura surround premium audio system, multi-view rear camera. Untuk versi teratas, masih ditambah dengan teknologi blid-spot information yang menggunakan sistem radar untuk mendeteksi objeklainyangtidakterlihatdarispion, juga Collision Mitigating Braking System dan Adaptive Cruise Control (ACC). Acura belum mengumumkan harganya, cuma memberi indikasi antara SUV Acura MDX dan sedan mewah Acura RL. (h09/mkc)

Waspada/Armansyah TH

HondaVario CBS Techno, sudah dipajang di arena IIMS 2009 Jakarta, dan selalu menarik perhatian pengunjung.



WASPADA Selasa 4 Agustus 2009

Michael Jackson Tidur 3 Jam Setiap Malamnya Ketergantungan Michael Jackson terhadap obat penenang ternyata ada sebabnya. MJ selama ini dikenal sulit tidur. Ia diketahui hanya tidur 3 jam setiap malam.

Michael Jackson/ist/dth

Tak heran obat tidur dengan resep dokter apalagi yang dijual bebas di apotek tidak mempan. Pelantun ‘Billy Jean’ itu hanya bisa terlelap jika disuntik obat anestesi dosis tinggi. “Dia selalu terlihat kelelahan. Dia selalu minta disuntikkan Diprivan, obat bius dosis

tinggi yang biasa digunakan di meja operasi. Tapi tentu saya menolaknya karena obat itu berbahaya,” jelas Sherilyn Lee, mantan perawat dan konsultan gizi MJ seperti dikutip dari Contact Music, Senin (3/8). Lee juga pernah mengatakan hal yang sama soal ketergantungan MJ terhadap Propofol atau Diprivan. Lee tak mengetahui mengapa MJ sering sulit tidur. Selain sering minta disuntikkan obat penenang jelang tidurnya, MJ juga punya kebiasaan aneh. “Dia selalu minta lampu kamarnya dimatikan dan diputarkan musik,” imbuhnya.(dth)

Ibunda Manohara Dicekal Di Banyak Negara Ibu Manohara Odelia Pinot, Deasy Fajarina, ternyata punya banyak masalah. Selain menjadi buronan Interpol Perancis, Deasy juga sudah dicekal di banyak negara. “Deasy bukan hanya dicaricari di Perancis tapi sudah dicekal di banyak negara,” jelas aktivis Ratna Sarumpaet saat ditemui bersama mantan pembantu Deasy, Saliha, seusai melakukan kunjungan ke Kedubes Perancis di Jl MH Thamrin, Ja-

karta Pusat, Senin (3/8). Ratna tidak mengumbar omong kosong tapi didasari sejumlah bukti, termasuk yang diberikan Kedubes Perancis. Ratna tak habis pikir mengapa Deasy yang sudah dinyatakan buron Interpol Perancis tapi masih bisa berkeliaran di Indonesia. “Pemerintah Indonesia memang boleh hati-hati, tapi kan suratnya sudah dikirim Interpol Perancis dari satu tahun

Funny People/aces/dth

lalu, masa dicuekin sih surat orang,” imbuhnya. Keseriusan Ratna membongkar aib Deasy bukan karena dirinya mendapat bayaran dari Istana Kelantan, tapi agar masyarakat mengetahui siapa sosok Deasy Fajarina sesungguhnya. Deasy mendapat em-pat tuntutan di Perancis, diantaranya pemalsuan identitas Saliha, penganiyaan dan penggelapan masalah bisnis,” pungkasnya.(dth)

Funny People Tempati Posisi Teratas Deasy Fajarina/dth

Gebrakan Indie Rock TYKW Band band tersebut, melansir album bermutu dan memiliki keunikan seperti TYKW yang menyuguhkan Indie Rock dengan sentuhan nada-nada

Wave dari Synthesizer, saya optimis industri musik Indonesia bakal segera bergairah kembali,” prediksi Juan. * (AgusT)

Film karya studio Universal Funny People menjadi pelopor box office pekan lalu, dengan mengantungi sebanyak 23,4 juta dolar AS selama tiga hari masa tayang, demikian jumlah awal yang disiarkan Ahad. Namun film komedi disutradari Judd Apatow tersebut menandai pembukaan paling rendah untuk film Nomor 1 tahun ini, serta pembukaan terburuk dalam lebih empat tahun buat Adam Sandler, berperan sebagai tokoh didiagnosis terserang penyakit yang mematikan. Film paling akhir Harry Potter naik lagi melalui peluncurannya di teater Imax akhir pekan lalu, saat Harry Potter and The Half-Blood Prince mempertahankan posisi Nomor 2 dengan perolehan 17,7 juta dolar AS, dan secara keseluruhan

255,5 juta dolar AS di benua tersebut sejak peluncuran perdananya tiga pekan sebelumnya. Pemimpin box office pekan sebelumnya, komedi animasi Disney G-Force, merosot ke posisi ketiga dengan pengumpulan 17,1 juta dolar AS pada akhir pekan lalu. Film itu secara keseluruhan mengantungi 66,5 juta dolar AS di Amerika Utara sejak peluncuran perdananya pekan sebelumnya. Film lain menempati posisi lima besar pada akhir pekan lalu adalah komedi romantis karya Sony, The Ugly Truth, dengan meraih 13 juta dolar AS, dan film aksi karya 20th Century Fox Aliens in the Attic, mengumpulkan 7,8 juta dolar AS.(ant)

Russell Crowe Dilarang Masuk Klub Malam TYKW Band

KENDATI industri musik nasional terus dijejali band pendatang baru, kehadiran The You Know Who (TYKW), lewat mini album bermaterikan lima lagu mengandalkan tembang “Lullaby” cukup mampu menarik perhatian penikmat musik Rock. Pasalnya, band dipunggawai Okto (vokal), Angga (bas), Putri (drum), Stella (keyboard & Synthesizer) dan Jaka (gitar), menawarkan komposisi musik unik Indie Rock. Lengkap dengan sentuhan nada-nada Wave dari Synthesizer berbumbu dentuman suara bas pada bagian tertentu. “Lewat keunikan musik bernuansa Indie Rock yang masih sangat jarang disuguhkan band-band di Indonesia, kami mencoba menggebrak blantika musik cadas nasional. Apalagi, sebelumnya lewat dua single bertajuk Little Sister dan Lies yang masuk dalam kompilasi Rock – TYKW band cukup terkenal di komunitas band indie,” papar Okto, sang vokalis kepada Waspada di Jakarta baru-baru ini. Menurutnya, berbekal dua

07.30 Siapa Lebih Berani 09.00 Musik Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Musik Hits 15.00 Cek & Ricek 15.30 OB Shift 2 16.00 Mata Mata 16.30 Minta Tolong 17.00 Seputar Indonesia 17.30 Tarzan Cilik 18.00 Manohara 19.00 Cinta Dan Anugerah 21.00 Dewi 22.00 Deddy Corbuzier 23.00 Box Office Movie 01.00 Seputar Indonesia Malam

tahun magang di industri musik nasional lewat dua single tersebut cukup menambah rasa optimis bandnya yang dibentuk pada 22 Juli 2005 silam untuk berkutat di jalur alternatif atau indie label. “Di jalur indie kami merasa lebih puas lantaran bisa menyalurkan bermusik secara leluasa. Termasuk mengusung genre musik Indie Rock yang tergolong masih langka di tanah air,” tandas frontman berambut pendek dan bertubuh atletis yang begitu piawai dan fasih mengusung tembang “Just Kill Me” dan “Candle of Life” itu. Tentang lagu-lagu usungan mereka semuanya berlirik Inggris, Angga sang pembetot bas berkilah hal tersebut bagian dari kekuatan TYKW band. “Bukan mau sok-sok-an. Mengusung lagu berlirik Inggris merupakan bagian dari tatakrama atau keharusan bagi pengusung Indie Rock. Semoga dengan bahasa internasional kami pun bisa lebih terkenal di kancah musik dunia,” harap Angga yang diamini dua personel wanita – Stella dan Putri. Sementara itu, Juan MM

07.30 Musik Inbox-live 09.30 Halo Selebriti 10.00 Sinema Pagi 12.00 Liputan 6 Siang 12.30 Kasak Kusuk 13.30 Back Street 14.00 Play List 16.00 Kepompong 17.00 Liputan 6 Petang 17.30 Lemon Tea 19.00 Melati Untuk Marvel 20.30 Cinta Fitri 21.30 Terlanjur Cinta 00.00 Liputan 6 Malam 00.30 Buser 01.00 Musik : Playlist

manajer TYKW band menambahkan, kehadiran Okto – Stella dkk. lewat mini album momentumnya sangat lah tepat. Apalagi, jalur alternatif Indie Label berpotensi turut menggairahkan musik industri nasional yang beberapa tahun terakhir terkena dampak krisis moneter dunia. “Momentumnya tepat lantaran saat ini di industri musik nasional terjadi pergeseran cara penjualan album rekaman dari sistim konvensional menjadi virtual. Yakni secara mengunduh atau Downloud dari internet dan RBT. Sehingga para penyanyi atau grup band, tak lagi dituntut melansir album penuh. Melainkan cukup dengan single atau mini album,” terang Juan yang cukup optimis kehadiran band indie seperti TYKW band mampu menggairahkan kembali industri musik nasional. “Berdasarkan survey terakhir, sejak bermunculan pada dekade 1990-an saat ini lebih dari 20 ribu band indie di Indonesia. Nah, kalau sepersekian persen saja dari band-

07.00 de Klip 07.30 Ngerjain Pol 08.00 Peque Prix 10.00 Grand Prix del Verano 11.00 Yukita Tawa 11.30 Sidik 12.30 Go Show 13.00 Layar Kemilau 15.00 1001 Cerita 16.00 Casper 17.00 Ninja Warrior 18.00 Ben 7 19.00 Mujizat Cinta 20.00 Kumpulan Kisah 22.00 Curhat Bareng Anjas 23.00 Republik Cinta Midnite 00.00 Yukita Tawa 01.00 Galaxy

RUSSELL Crowe terlibat pertengkaran berakhir dengan dilarangnya sang aktor masuk ke klub malam The Brickmakers di Windlesham, Surrey, Inggeris, terletak dekat tempat syuting film terbarunya Robin Hood. Suratkabar Sunday Express melaporkan pertengkaran terkait surat ijin menyebabkan aktor Australia kelahiran Selandia Baru yang meraih Oscar lewat film Gladiator tersebut dilarang masuk klub malam itu. Seorang manajer klub malam mengatakan kepada Sunday Express. “Saya tidak tahu pasti apa yang telah dilakukannya, tapi sepertinya terjadi keributan dan dia diberitahu tidak boleh datang ke sana lagi.” “Bukan hanya di tempat itu saja dia dilarang masuk. Setahu saya, sedikitnya ada dua tempat lain di sekitar situ yang tidak boleh didatanginya,” tambah manajer itu. Seorang penduduk setempat mengatakan kepada suratkabar itu bahwa Russell menawarkan uang agar diijinkan tetap minum di The Brickmakers padahal sudah waktunya tutup. “Dia akhirnya memang keluar, tapi setelah memecahkan piring,” kata penduduk tersebut. Namun, Manager Russell, Grant Vandenberg dengan segera membantah dan mengatakan cerita suratkabar itu tidak benar. “Cerita sebenarnya, dia sudah sering ke pub itu,” kata Grant kepada televisi Nine Network di Australia. “Ada empat atau lima kali dia datang bersama anak-anaknya ke sana, soalnya di bagian belakang ada taman bermain untuk anak-anak,” jelas Grant. Tidak heran, kalau ayah dua putra ini sering terlibat masalah, karena dia termasuk pria pemarah. Di tahun 2005, Russel pernah ditangkap polisi setelah melempar seorang pekerja hotel dengan telepon. Setelah itu Russel berujar “Itu adalah perbuatan memalukan seharusnya bisa saya kendalikan.”Syafri/ap

07.00 Peroro The Little Penguin 08.00 Star Kids 09.00 Espresso 10.00 Cagur Naik Bajaj 11.00 Fakta 11.30 Topik Siang 12.00 Klik! 13.30 Transformer Galaxy 15.30 Panji Sang Penakluk 2 16.00 Buka Kartu 17.00 Mati Gaya 18.30 Kena Deh 19.00 Segeeerr 21.30 Tawa Sutra Bisaa Ajaa 22.30 4 Lawan 1 23.00 Kena Deh 23.30 Mata Rantai 00.00 Topik Malam 00.30 Lensa Olahraga Malam

Russel Crowe

Eko ‘Patrio’ Tetap Melenggang Ke DPR

Eko Patrio/dth

07.00 KISS Vaganza 08.30 Impian Sang Putri 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS Sore 15.30 FS BBF 17.00 Kasih Dan Amara 18.00 Tangisan Isabella 19.00 Muallaf 20.00 Inayah 21.30 FS. Boys Before Flowers 23.00 Coffe Prince 01.00 Fokus Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Presenter Eko‘Patrio’ sem-pat terancam batal menjadi anggota DPR RI karena kepu-tusan Mahkamah Agung (MA) yang menganulir penetapan Pemilu Legislatif 2009 dibuat KPU. Namun ternyata putusan MA itu

07.05 Indonesia This Morning 07.30 Metro Xin Wen 08.05 Healthy Life 09.30 Market Review 10.05 Kreasi 11.05 Expedition 11.30 Megapolitan 12.05 Metro Siang 13.30 Economic Challenge 14.30 Election Update 17.05 Discover Indonesia 19.05 Suara Anda 20.30 Berbagi Cahaya 21.05 Top Nine News 21.30 Auto Zone 22.05 Todays Dialogs 23.05 Secret Operations 00.05 Metro Malam

baru bisa diberlakukan di masa mendatang dan itu artinya Eko tetap melenggang ke DPR. “Alhamdulillah keputusan KPU membawa rasa keadilan. KPU tetap menerima putusan MA namun akan diberlakukan

07.30 Dering 09.00 Musik Derings 10.30 Jelang Siang 11.00 Insert 12.00 Reportase 12.30 Missing Lyrics 14.00 Bioskop Indonesia 16.00 Insert Sore 16.30 Orang Ketiga 17.00 Reportase Sore 17.30 Tangan Di Atas 18.00 Suami Suami Takut Istri 19.00 HUT Insert 21.00 Bioskop Trans TV 23.00 Bioskop Trans TV 01.00 Reportase Malam

untuk masa akan datang,” demikian pesan singkat Eko Patrio, Sabtu (1/8) malam. Artinya keputusan MA tidak dapat diberlakukan untuk menganulir penetapan KPU yang sudah lebih dulu dikeluar-

09.00 Kabar 9 09.30 Kabar Pasar 10.00 Pariwara : DEPDIKNAS 11.00 Opini 12.00 Kabar Siang 13.30 Expose 14.00 Documentary One 14.30 Kabar Pasar 15.00 Kabar 15 16.00 Kerah Putih 16.30 Aku Pernah 17.00 Kabar Pemilu 17.30 Kabar Petang 19.00 Bang One Show 19.30 Janji Wakil Rakyat 21.00 Apa Kabar Indonesia Malam 22.00 Jakarta Lawyer’s Club 23.00 Nama Dan Peristiwa

07.00 Avatar 08.00 Dora Eksplorer 09.00 Obsesi Pagi 10.00 MTV Gaya Bebas 11.00 MTV Ampuh 12.00 Abdel & Temon 13.00 Global Siang 14.00 Transformers Animated 15.30 Mata Angin 16.00 Impianku 16.30 Berita Global 17.00 Spongebob 19.00 Big Movies 21.00 Big Movies 23.00 Reaper 00.00 F1 Sensation 00.30 Global Malam

kan. Penetapan Pemilu Legislatif yang ditetapkan KPU tetap sah. Namun KPU akan merubah peraturan pemungutan dan penghitungan suara untuk Pemilu yang akan datang sesuai dengan putusan MA.(dth)

07.30 I Gosip Pagi 08.00 Selamat Pagi 09.00 Dorce 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.30 Jalan Sesama 14.00 Cita-Cita 14.30 Tom & Jerry 15.00 Scooby Doo 15.30 Asal Usul 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 I Gosip News 17.30 Party 18.30 On The Spot 20.00 Opera Van Java 21.00 OKB 22.00 Bukan Empat Mata 23.00 Begadang 01.00 Redaksi Malam


waspada 4 agustus 2009