Issuu on Google+








Edisi 343 „ Tahun X

Pengungsi Saling Serang 8 Warga Myanmar Tewas MEDAN- Suasana hening di Rumah Detensi Imigrasi (Redenim) di Kelurahan Belawan, Kecamatan Medan Belawan, berubah dengan suara kegaduhan, Jumat (5/ 4) sekira pukul 01.30 WIB. Dini hari itu, terjadi pembantaian terhadap delapan warga Myanmar yang dilakukan puluhan warga etnis Rohingya.


Korban tewas warga Rohingya yang terlibat bentrok di Rudinem Mabar, saat berada di kamar mayat Pirngadi, Medan.

Kapolsek Tewas Diamuk Massa

TANGKAP BANDAR TOGEL! PARAPAT- Pasca pengerorokan yang tewasnya Kapolsek Dolok Pardamean AKP Andar Siahaan yang dilatarbelakangi masalah togel, sebanyak 19 warga ditetapkan tersangka. Sementara bandar togel masih berkeliaran. Masyarakat mendesak agar polisi menangkap bandar togel. Tokoh agama di Kota Wisata Parapat, Kecamatan Girsang Sipangan Bolon Pdt Abraham Josua

Kemenlu Pastikan Telah Beritahu Kedubes Myanmar JURU Bicara Kementerian Luar Negeri (Kemenlu) Michael Tene, mengaku masih menunggu hasil penyelidikan lebih lanjut dari kepolisian, atas peristiwa tewasnya 8 orang warga negara Myanmar saat berada

taan Besar Myanmar untuk Indonsia. "Sebelumnya kita telah mendapat informasi dari pihak Imigrasi, bahwa telah terjadi bentrok dua kelompok warga negara Myanmar yang sejak beberapa waktu lalu ditahan

Merambah ke Pelosok


KORBAN LAKALANTAS- Jasad Gito, korban kecelakaan lalulintas saat divisum di Ruang Jenazah, Jumat (5/4).

SIMALUNGUN- Kecelakaan hebat terjadi di Jalan Medan Km 8,5, Kelurahan Sinaksak, Kecamatan Tapian Dolok, Simalungun. Bus L-300 dengan Karya Agung laga kambing dan menewaskan dua orang penumpang, sementara delapan penumpang lainnya mengalami luka-luka. Informasi dihimpun METRO, tabrakan tersebut terjadi Jumat (5/4) pukul 03.45 WIB. Saat itu, bus L-300 BK 1523 GY yang dikemudikan Johan Hutapea (34), melaju dari arah Medan menuju Siantar, yang rencananya akan berhenti di Tarutung. Warga Laguboti, Kabupaten Toba Samosir itu, mengangkut surat kabar harian terbitan Medan. Selain mengangkut koran, dia juga membawa 4 penumpang, antara lain Adi Saputra Simatupang (49), warga Jalan Percut, Kota Medan, Tiurma br Siagian (46) warga Jalan TB Simatupang, Kota Medan, Karne br Nainggolan (77), warga Jalan Narumambing Siraituruk, Kecamatan Porsea, Toba Samosir dan supir batangan L-300 bernama Frans yang melarikan diri setelah kejadian. Sementara, dari arah berlawanan, melaju bus Karya Agung BK 7655 TL yang dikemudikan Saut Manurung (36). Warga Dolok Nauli, Kecamatan Porsea, Tobasa ini mengangkut enam penumpang, yaitu Gito Marpaung (77) warga „) Baca Dua Penumpang ....Hal 2

pihak imigrasi di penampungan di Belawan, Medan, Sumatera Utara," ujarnya kepada koran ini di Jakarta, Jumat (5/4).

Pemko Dinilai Ingkar Janji SIANTAR- Dana santunan yang dijanjikan Pemko Siantar kepada keluarga korban kecelakaan bus rombongan paskibra di Nagori Pondok Buluh, Kecamatan Dolok Panribuan, sampai saat ini belum disalurkan Pemko Siantar. Kepada METRO, B Simalango ayah Okfri Simalango salah seorang korban, , Jumat (5/4) mengatakan, sampai saat ini mereka belum menerima dana santunan yang sudah dijanjikan Pemko Siantar kepada keluarganya. Mereka sangat menyesalkan kinerja pemerintah yang tidak memiliki tanggung jawab atas kecelakaan „) Baca Pemko Dinilai ....Hal 2

Dahlan Iskan Pastikan Penuhi Undangan DPR


KORBAN LAKALANTAS- Jasad Sondang, saat divisum di Ruang Jenazah, Jumat (5/4).

JAKARTA- Setelah DPR melayangkan surat ke Presiden Susilo Bambang Yudhoyono (SBY), Menteri BUMN Dahlan Iskan memastikan akan menghadiri undangan Komisi VI DPR guna membahas outsourcing tenaga kerja BUMN. “Pak Dahlan Iskan sudah memastikan akan hadir pada hari Senin (8/4) jam 15.00 WIB di Komisi VI DPRRI,” kata Koordinator BUMN Care, Budi Purnomo Karjodihardjo, di Jakarta, Jumat (5/4). Budi Purnomo mengatakan, Menteri BUMN Dahlan Iskan selalu memenuhi undangan Komisi VI

Kisah Guru di Desa Terpencil

Jalan Kaki Melewati Hutan, Honor Rp150 Ribu Sebulan Tugasnya sungguh mulia untuk mencerdaskan anak bangsa. Namun perlakuan yang layak belum dirasakan pahlawan tanpa tanda jasa yang bertugas di wilayah terpencil di Tapsel ini. Apalagi imbalan yang diterimanya hanya Rp150 ribu per bulan. Padahal untuk menemui anak didiknya, ia harus berjalan kaki di tengah hutan lebat, mendaki dan menurun di jalan terjal. Sungguh penuh dengan resiko. Siapa dan bagaimana kisahnya? AMRAN POHAN-TAPSEL


LINTASI HUTAN- Siti Mariani sedang melintasi hutan menjumpai anak didiknya di SDN Turunan.

„) Baca Kemenlu ....Hal 2

Santunan Belum Disalurkan

Dua Penumpang Tewas

„) Baca

„) Baca Merambah ....Hal 7

di penampungan Imigrasi Indonesia di Belawan. Meski begitu, Michael memastikan Kemenlu secara resmi telah menginformasikan secara resmi peristiwa dimaksud ke Kedu-


Tangkap ....Hal 7

“Masyarakat sudah mulai resah dengan aksi perjudian jenis togel, karena telah berkembang hingga ke pelosok perkampungan atau desa, juga di wilayah Siantar.” Demikian dikemukakan Ustad Indra (40), pemuka agama di Jalan Meranti, Kelurahan Kahean, Kecamatan Siantar Utara, Jumat (5/4). Dia mengharapkan, jajaran kepolisian Polres Siantar dapat menangkap para bandar judi togel yang sudah mulai meresahkan di Siantar.

n yang merupakan KORBAN- Para korban pembantaia warga Myanmar.

„) Baca Pengungsi ....Hal 2

Ia adalah Siti Mariani Pasaribu (27), guru honor komite di SDN Turunan, Desa Sunge Sigiringgiring, Kecamatan Saipar Dolok Hole (SDH), Kabupaten Tapanuli Selatan. Pada awak koran ini, ia

menceritakan telah menjadi guru honor komite di SDN Turunan sejak 2007 lalu. Ketika itu dirinya masih gadis dan tercatat sebagai warga Kampung „) Baca Jalan Kaki ..Hal 7

„) Baca Dahlan Iskan ....Hal 7


6 April 2013

Kapolda DIY Dicopot

Pengungsi Saling Serang 8 Warga Myanmar Tewas

Kadivhumas Bantah Terkait Kasus Cebongan JAKARTA “ Mabes Polri melakukan mutasi mendadak di jajarannya. Nama Kapolda Daerah Istimewa Yogyakarta Brigjen Sabar Rahardjo masuk dalam gerbong mutasi tersebut. Namun, pihakMabesPolrimembantahjikamutasitersebut terkait dengan penyerangan ke Lapas kelas IIB Cebongan, Sleman. Sabar dimutasi tidak melalui surat telegram rahasia STR sebagaimana umumnya mutasi. Melainkan, lewat surat keputusan bernomor KEP: 234/IV/2013 tertanggal 5 April atau kemarin. “Memang benar yang bersangkutan dimutasi,” terangKadivhumasMabesPolriIrjenSuhardiAlius kemarin. Namun, mutasi yang dilakukan lewat surat keputusan menimbulkan tanda tanya. Sebab, lazimnya mutasi dilakukan lewat surat telegram rahasia. Sempat muncul dugaan jika Sabar dimutasi terkait dengan penyerangan ke Lapas Cebongan, Sleman. Sabar dianggap gagal melindungi para tahanan di lapas tersebut hingga dibunuh oleh anggota Kopassus KArtasura. Padahal, keempat tahanan tersebut dipindah bersama tahanan lain dari Mapolda dengan alasan sel tahanan Mapolda DIY sedang direnovasi. Namun, saat dikonfirmasi, Suhardi membantahnya. Menurut dia, mutasi merupakan hal biasadilingkunganMabesPolriuntukpenyegaran. Sabar bakal digantikan oleh Kabiro Kajian dan Strategi SSDM Mabes Polri Brigjen Haka Astana. Rencananya,Senin(8/4)mendatangHakadilantik menjadi Kapolda DIY. Komnas HAM Tetap Selidiki Cebongan Pengakuan para enggota Kopassus Kartasura sebagai pelaku penyerangan Lapas Cebongan, Sleman, belum membuat Komnas HAM Lega. Komnas HAM tetap akan menelusuri kasus tersebut. Sebab, penyidikan akan kurang kuat jika hanya didasari pengakuan semata.Ketua Komnas HAM Siti Nur Laila menyatakan, pihaknya akan tetap menyelidiki kasus tersbeut meski telah ada pengakuan dari sebelas anggota Kopassus Kartasura. Menurut dia, apa yang disampaikan Wadanpuspom TNI AD kemarin baru sebatas pengakuan belaka. Masih harus didukung dengan bukti-bukti yang kuat. Siti mengapresiasi langkah TNI AD yang mengumumkan pengakuan sebelas anggota Kopassus dalam penyerangan tersebut. “Buktibukti penyerangan saat ini masih dianalisis oleh Mabes Polri. Begitu pula dengan sketsa wajah pelaku. Kita tunggu saja hasilnya,” ujarnya saat dikonfirmasi kemarin. Hukum tidak afkan bisa berjalan jika hanya didasaripengakuanbelakan.MenurutSiti,bisasaja orang yang mengaku itu memiliki maksud lain. Misalnya melindungi pelaku sebenarnya. “MakanyatadikanpihakTNImengatakaninibaru awal,” lanjut ibu tiga anak itu. Apakah sebelumnya Komnas HAM juga memiliki dugaan jika pelakunya anggota Kopassus, Siti enggan mengakuinya secara eksplisit. Namun, dia tidak menampik jika memang ada indikasi ke arah militer. “Itu kenapa kami minta untuk koordinasi dengan kopassus secara langsung, tapi ternyata harus lewat Mabes TNI,” tuturnya. Sejumlahindikasiyangdimilikipihaknyasaatitu masihmemerlukankonfirmasi.Sehingga,diatidak bisa memberikan kesimpulan apapun pada penyelidikan yang sedang dilakukan. Siti menegaskan, pihaknya masih akan menyelidiki kasus tersebut sampai tuntas. Terutama, untuk menyimpulkan apakah yang dilakukan para penyerang itu tergolong pelanggaran HAM biasa atau pelanggaran HAM berat. Kalau pelanggaran HAM biasa, bisa ke pengadilan militer. “Namun, kalau tergolong pelanggaran HAM berat, kami rekomendasikan untuk menggunakan UU nomor 26 tahun 2000 tentang Pengadilan HAM. Mereka sebaiknya diadili di sana,” tutupnya. (byu/jpnn)

Sambungan Halaman 1 Data dihimpun POSMETRO MEDAN (grup METRO), peristiwa berdarah itu terjadi dipicu dendam lama. Di mana sejak dua bulan terakhir pengungsi etnis Rohingya tidak terima dengan perilaku delapan orang warga Myanmar yang kerap mengganggu, bahkan melakukan pelecehan seksual terhadap keluarga mereka. Persoalan yang sudah berulang kali dilakukan warga Myanmar yang sama-sama ditahan di Rudemin. Dalam beberapa hari, warga etnis Rohingya telah menyimpan rasa dendam dan saling memengaruhi satu sama lain dengan menunjukkan tragedi pembantaian keluarga mereka yang tewas mengenaskan di Myanmar. Dari itu, mereka menyusun rencana untuk melakukan pembantaian secara massal. Tengah malam itu, para pengungsi Rohingya yang umumnya berada di lantai satu, menuju lantai dua membantai delapan warga Myanmar. Dengan luapan dendam dicampur emosi, puluhan etnis Rohingya membawa kursi terbuat dari kayu menuju ke lantai dua, membuat sejumlah penghuni Rudenim lainnya terkejut. Etnis Rohingya langsung mematikan lampu dan memukuli dengan kursi kayu para korban yang saat itu sedang tidur di lantai.

Suara keributan pembantaian, dengan jeritan histeris yang dihajar dengan benda tumpul yang ada di lantai dua. Pembantaian sadis ini juga menjadi tontonan para penghuni asing dari negara lain yang hanya mampu diam menyaksikan kejadian itu. Pegawai Redenim yang mendengar suara keributan, langsung menuju kamar tersebut dan mencoba masuk untuk melakukan pengamanan. Namun karena pintu kamar dikunci dari dalam, para petugas kesulitan masuk. “Waktu kejadian itu saya mendengar suara ribut, suara teriakan, tapi tak ada minta tolong. Saya menduga ada yang mau kabur. Tapi pintu dikunci dari dalam dan saya diancam jangan masuk karena ada yang mau kabur. Kalau saya masuk nanti dibunuh mereka. Ternyata tak lama berselang, saya dengar ada keributan, ada yang mati. Saya langsung melapor ke Polres Pelabuhan Belawan,” kata pegawai Rudenim Riko Thomas. Setelah pembantai berlangsung, suasana mencekam menyelimuti lokasi Rudenim. Para penghuni lainnya berdiam diri di kamar pasca tragedi berdarah itu. Petugas Polres Pelabuhan Belawan yang menerima informasi, langsung turun ke lokasi kejadian dan melakukan evakuasi terhadap jenazah para korban ke RS Pirngadi Medan.

Para korban WNA Myanmar, yakni Aye Min (23), Myo Co (20), Aung Thu Win (24), Aung Than (44), Min-Min (24), Win Tun (32), Nawe (23) dan Sam Lwin (45). Kabid Humas Poldasu Kombes Pol R Heru Prakoso didampingi Kepala Imigrasi Belawan Sunardi dan Kapolres Pelabuhan Belawan AKBP Endro Kiswanto, saat pemaparan di Aula Mako Polres Pelabuhan Belawan, menerangkan motif sementara kejadian berdarah itu, berawal dari pelecehan seksual yang dilakukan warga Myanmar terhadap pengungsi Rohingya. Lokasi itu berada di lantai dua, dan ada sekitar 90 pengungsi Rohingnya yang menempati di bilik itu. “Tak benar motif bentrok karena SARA atau agama, melainkan motifnya karena pelecehan yang sebelumnya telah dicoba diselesaikan pihak Imigrasi namun kemungkinan belum tuntas menyebabkan persoalan berlanjut,” tegasnya. Heru menyebutkan, pada Kamis (4/4) sekira pukul 10.00 WIB, tiga perempuan dari etnis Rohingya yang ada di Rudenim melapor kepada Ali. Ali merupakan sosok yang dituakan oleh 153 pengungsi etnis Rohingya yang ada di Rudenim. Ketiga wanita itu mengaku mengalami pelecehan seksual secara fisik dari kelompok Myanmar lainnya, kelompok anak buah kapal (ABK) Myanmar yang tertangkap karena melakukan

Kemenlu Pastikan Telah Beritahu Kedubes Myanmar Sambungan Halaman 1 Kedua kelompok tersebut menurut Michael, masing-masing pengungsi warga Rohingya di satu sisi dan sekelompok nelayan asal Myanmar di sisi lain. Pengungsi Rohingya sebelumnya diamankan saat hendak mencari suaka ke negara ke tiga. Sementara para nelayan, ditangkap karena melakukan pencurian ikan di wilayah Indonesia. "Jadi atas informasi tersebut, kita sampaikan ke Kedubes Myanmar. Secara lengkap kita jelaskan, karena kewajiban kita (Kemenlu,red) memang seperti itu," ujarnya.

Sayangnya saat ditanya penyebab dari peristiwa tersebut, Michael mengaku belum mengetahui secara persis, karena kasusnya hingga saat ini masih ditangani pihak kepolisian. "Mungkin sebaiknya menghubungi pihak imigrasi yang ada di Belawan atau kepolisian yang bertugas menangani masalah ini. Karena kejadiannya kan di tempat penampungan imigrasi," katanya. Michael mengungkapkan demikian, karena Kemenlu sampai saat ini juga masih terus menunggu perkembangan hasil penyelidikan. Informasi yang diperoleh tersebut menurutnya, secara berkala tetap

akan diteruskan ke pihak Kedubes Myanmar. "Ini yang yang menjadi kewajiban kita (Kemenlu,red). Jadi penugasannya sangat jelas. Penyelidikan tentu menjadi tanggung jawab kepolisian," katannya.m Sebagaimana diketahui, bentrokan antar pengungsi asal Myanmar terjadi di Rumah Detensi Imigrasi (Rudenim) Medan, di Belawan, Sumatera Utara, Jumat (5/4) dini hari. Dilaporkan 8 orang tewas sementara dan 15 lainnya luka-luka. Menurut Pelaksana Harian (Plh) Kepala Rudenim Yusup Umardani, sejak berada di Rudenim, para pengungsi kerap terlibat adu

mulut. Sehingga diduga bentrok terjadi karena perselisihan yang terjadi sejak mereka masih sama-sama berada di negaranya. Namun inforrmasi yang berkembang menyebut, bentrok diduga masalah kebutuhan biologis. Dimana pada satu dari dua kelompok yang ditahan di tempat tersebut, tidak terdapat wanita. Sementara di kelompok lain banyak yang disertai sang istri. Beberapa anggota kelompok tertentu, disebut berusaha mengganggu istri dari kelompok lain. Karena tidak terima bentrokan pun tak terhindarkan. Namun belum diperoleh kepastian apakah informasi ini benar adanya. (gir)

Pemko Dinilai Ingkar Janji Sambungan Halaman 1 yang menewaskan putrinya di Balai Latihan Kehutanan beberapa waktu lalu. “Kami hanya masyarakat kecil yang tidak sanggup berbuat apa-apa. Kami selalu termakan janji palsu yang diucapkan para pejabat,” katanya kesal. Masih kata B Simalango, mereka semua sudah menerima dengan ikhlas akan kepergian putri sulungnya dalam kecelakaan tersebut. Mereka hanya bisa berbuat seadanya, meskipun mereka sudah mendatangi kantor walikota Maret lalu. Tetapi mereka tidak mendapatkan respon. “Minta tanggung jawaban saja kami ke sana, bukannya bisa dikembalikan nyawa putri kami. Saya berharap untuk ke depannya Pemko Siantar untuk bisa lebih tanggung jawab dengan tindakan yang dilakukan mereka,” katanya. Sementara itu Wakil Kepala SMAN 1 Siantar

Mula Simanjuntak mengatakan, mereka belum mendapatkan kabar lebih lanjut mengenai dana santunan yang akan dikirimkan melalui rekening sekolah. Hanya dana santunan dari Jasa Raharja yang sudah sampai kepada pihak keluarga. “Sudah saya cek rekening sekolah, tetapi jumlah uang sekolah tidak ada bertambah. Kalau sudah dikirimkan, pasti sudah saya sampaikan kepada pihak keluarga yang bersangkutan,” katanya Sementara itu, Kabag Humas Pemko Siantar Daniel Siregar mengatakan, dana

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Anggota SPS No: 438/2003/02/A/2012 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

bantuan yang sudah dijanjikan akan disampaikan kepada pihak keluarga korban. “Kalau mau tahu lebih lanjut, langsung saja tanyakan kepada Pak Walikota. Karena saya tidak bisa mengambil keputusan sendiri,” katanya. Sementara, Wakil Ketua DPRD Timbul Lingga mengatakan, pihaknya sudah mendesak pemko memberikan santunan kepada keluarga korban kecelakaan paskibra. Dana santunan korban kecelakaan akan dapat membantu meringankan beban keluarga. Dananya akan ditam-

pung di APBD tahun 2013 pada pos belanja sosial. Menurut dia, sikap pemko memperlama memberikan santunan, membuktikan betapa pemko hanya menebar janji yang tidak pernah ditepati kepada masyarakat kecil. “Aneh rasanya sampai sekarang masalah tersebut tidak selesai juga,” katanya. Keluarga korban lainnya juga sampai sekarang tidak mendapatkan dana santunan yang dijanjikan pemko. Mereka berharap pemko dapat menepati janjinya kepada seluruh keluarga korban. (mag-06)

Dua Penumpang Tewas Sambungan Halaman 1 Jalan Sitorang Jahe, Toba Samosir, Sondang Marpaung (65), warga Lumban Lintong Porsea, Toba Samosir, Jinggar Marpaung (39), warga Toba Samosir, Mangiran Marpaung (45), Mitton Marpaung (45), warga Toba Samosir dan Nursalam Napitupulu (58), warga Toba Samosir. Menurut penuturan warga sekitar, saat itu kedua bus melaju dengan kecepatan tinggi. Diduga supir L-300 mengantuk saat mengemudikan mobil dan mengambil jalur terlalu ke tengah. Karena melaju kencang, bus Karya Agung tak sempat mengelakkan bus yang ada di depannya, hingga tabrakan dengan posisi laga kambing tak terhindarkan. Selanjutnya, kedua mobil bergeser melintang di jalan. Warga sekitar lokasi kejadian selanjutnya berhamburan dan membantu menggeser posisi mobil dari tengah jalan, sementara sebagian warga menghubungi polisi dan sebagian lagi memberikan pertolongan kepada penumpang. Saat dievakuasi, salah seorang penumpang bernama Gito Marpaung dinyatakan tewas di lokasi kejadian, sementara seluruh korban lain dilarikan ke Rumah Sakit Mina Padi, Sinaksak.

Chairman: Rida K Liamsi Komisaris Utama: Makmur Kasim Komisaris: Khadafi Direktur Utama: Marganas Nainggolan Direktur: Maranatha Tobing PENGASUH Pemimpin Umum/Penjab/GM: Marganas Nainggolan Wakil PU/Pimpinan Perusahaan: Maranatha Tobing Pimred Metro Siantar: Pandapotan MT Siallagan Pimred Metro Tapanuli: Pandapotan MT Siallagan Pimred Metro Tabagsel: Muhiddin Hasibuan Pimred Metro Asahan: Eva Wahyuni Wapimred Metro Tapanuli: Daniel Simanjuntak Wakil Pimpinan Perusahaan Asahan: Darwin Purba Tim Ombudsman: Vincent Wijaya

penangkapan ikan ilegal di Indonesia. Mereka sama-sama ditempatkan di Rudenim. Atas laporan ini, Ali kemudian menyampaikan persoalan kepada pihak petugas imigrasi yang ada di Rudenim. Pertemuan pun digagas pada Kamis malam sekira pukul 22.00 WIB. Saat itu kedua belah pihak sepakat damai. “Pada saat itu clear, selesai,” tukas Heru. Usai pertemuan itu, kelompok Rohingya melakukan diskusi. Mereka terkesan tidak puas dengan kesepakatan yang diambil dalam pertemuan yang difasilitasi Rudenim. Ketika sedang berdiskusi itu, ada kelompok ABK yang menyeletuk, memancing suasana. Tak lama kemudian, si ABK yang nyeletuk tadi masuk ke dalam dan kemudian keluar lagi membawa senjata tajam. Dia lalu menusuk Ali. Pergumulan terjadi, senjata itu dapat direbut Ali dan tindakan tersebut dibalas. “Di situlah spontan pengungsi Rohingya yang berada di lantai dua melakukan pengeroyokan terhadap delapan ABK WNA Myanmar. Sehingga seluruhnya meninggal di tempat kejadian perkara,” kata Heru. Para korban menderita luka memar dan luka akibat tusukan benda tajam, yang diduga berasal dari pecahan meubeler berupa meja dan kursi yang ada di barak. (ril/pmg/int)

Departemen Redaksi METRO SIANTAR Dewan Redaksi Group: Marganas Nainggolan (Ketua), Maranatha Tobing, Pandapotan MT Siallagan, Muhiddin Hasibuan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Nasa Putramaylanda, Hermanto Sipayung, Nurjannah. Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Hezbi Rangkuty, Edi Saragih. Reporter: Tonggo Sibarani, Imelda Purba, Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Raymound Sitanggang, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat). Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi: Ita Butar-butar METRO TAPANULI Pjs Redaktur Pelaksana: Nasa Putra Maylanda, Kordinator Liputan: -, Ass.Korlip (Taput): Horden Silalahi, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Hermanto Turnip (Tobasa). METRO TABAGSEL Redaktur Pelaksana: Nurjannah, Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Parningotan Aritonang.

Namun setelah sampai di IGD RS Mina Padi, seorang penumpang lagi, Sondang Marpaung, yang mengalami luka serius di seluruh tubuh dan kepalanya tidak dapat terselamatkan. Dia menghembuskan nafas terkahir di ruang IGD RS Mina Padi. Sementara, seluruh penumpang di dua bus tersebut tampak mengalami luka dan menjalani perawatan di rumah sakit tersebut. Johan Hutapea, pengemudi bus L-300 ketika ditemui METRO mengatakan, bus tersebut sebelumnya dikemudikan Frans. Karena lelah, Frans memintanya untuk mengemudikan mobil. Tepat di Timbangan Dolok Melangir, Johan yang sebelumnya tidur langsung mengambil alih kemudi. “Sebelumnya aku sudah nolak karena capek dan ngantuk Bang. Tapi kawan itu tetap saja ngotot minta gantian nyetir. Waktu tabrakan, aku tidak sadar karena masih mengantuk dan tiba-tiba mobil sudah ringsek akibat tabrakan. Selain itu laju mobil juga tidak ingat kencang atau pelan. Setelah kejadian aku keluar dari dalam mobil dan tergeletak di pinggir jalan. Begitu sadar, polisi sudah datang,” kata supir di RS Mina Padi. Masih kata Johan, dia kenal dengan Frans saat di Medan. Tetapi keduanya tidak terlalu akrab karena Frans sering keluar

METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Jekson Siahaan (Batubara), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke). Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Mounting: Samuel Sihotang (Koord.), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi, Maintenance & IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan: Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Annisa (Medan), Staf Desaign:Reliston Purba, Togap Sinaga. Perwakilan Metro Tapanuli

kota. Selama ini dia jarang ikut dengan Frans untuk mengantar koran, tetapi karena ingin pulang kampung ke Laguboti, dia berniat menumpang. “Aku sama dia belum terlalu dekat Bang. Karena dia terus sibuk bekerja, aku ikut sama dia karena aku ada janji sama lae (saudara ipar, red) ku Bang. Kami rencananya mau jumpa karena ada urusan keluarga, tapi belum juga sampai aku sudah kaya gini,” tambah pria kurus yang mengaku sudah duda tersebut. Sementara, saudara korban tewas yang mendapat kabar duka tersebut langsung datang ke rumah sakit, kemudian membawa jenazah ke rumah duka di Toba Samosir untuk disemayamkan. Korban lainnya terus mendapatkan perawatan intensif. Ada juga beberapa korban yang sudah pulang dan meminta pindah ke rumah sakit lain. Kapos Lantas Dolok Melangir Aiptu E Simanjorang, ketika dikonfirmasi mengatakan, kecelakaan bus L-300 kontrak bus Karya Agung sudah mereka tangani. Begitu juga dengan para korban sudah dievakuasi ke rumah sakit terdekat. Untuk pemeriksaan selanjutnya, pihaknya akan memeriksa Johan Hutapea selaku pengemudi L-300. (mag-10/eko)

Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koord. Pengembangan: Zulfiandi, Staf Pengembangan: Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH Tarif Iklan: Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 April 2013


Jembatan Salahi AAturan turan CAMAT Siantar yang terhormat, tolong ditindak tegas warga yang membangun jembatan di Jalan Haji Ulakma Sinaga Rambung Merah. Karena telah menyalahi aturan tata ruang pemukiman. Terimakasih 08789222xxxx

Ganti Kadishub

Walikota Pematangsiantar yang terhormat, tolong diganti saja Kadis Perhubungan. Sebab tidak memperbaiki traffic light yang sudah lama tidak berfungsi. Akibatnya pengendara menjadi terganggu. 08139741xxxx

Tarif KA TTidak idak Stabil

KEPADA Bapak Kepala Dinas Perhubungan, tolong segera buat penjelasan atau pengumuman informasi harga tiket kereta api. Penumpang sering bingung karena tarif yang tidak stabil, terutama saat tanggal muda, harga tiket mencapai Rp30 ribu. 081264317XXX

Bersihkan TTogel ogel di Hutabayu

PAK Kapolres Simalungun yang terhormat, judi togel masih marak di Kecamatan Hutabayu. Apakah polisi belum mau memerangi judi togel, dengan kejadian yang menimpa Kapolsek Dolok Pardamean? Atau Bapak Kapolres segan memerintahkan Kapolsek Tanah Jawa untuk memberantas togel di wilayah hukum Polsek Tanah Jawa? 087749061XXX

Jembatan Pinang Ratus Putus Dihantam Banjir Besar SIMALUNGUN-Hingga saat ini Pemkab Simalungun belum memperbaiki jembatan yang putus dihantam banjir besar bulan lalu di Nagori Pinang Ratus, Kecamatan Jorlang Hataran, Simalungun. Akibatnya, masyarakat terganggu beraktivitas. Kondisi Jembatan ini disebabkan curah hujan yang tinggi di Simalungun. Sehingga air sungai meluap hebat dan kemudian menghantam jembatan tersebut. Walaupun tidak menimbulkan banjir untuk daerah disekitar sungai, namun jembatan yang rusak cukup membuat aktivitas warga menjadi terganggu. kondisi jembatan tersebut menjadikan aktivitias warga menjadi terganggu sebab jembatan ini merupakan jalan utama ke Nagori Pidang Ratus. Akibat dari situas ini masyarakat Nagori Pinang Ratus khususnya yang menggunakan mobil terpaksa memutar dari Tiga Balata melalui jalanjalan tikus di tengah perkebunan. Sementara untuk sepeda motor terpaksa melalui jembatan alternatif. Para warga pun mengeluhakan ini, sebab untuk membawa hasil pertanianpun menjadi terganggu. Sehingga biaya transportasi pun semakin bertambah yang menjadi kerugian bagi masyarakat. Menurut pemerintah setempat, Camat Jorlang Hataran Williamer Saragih menjelaskan , bahwa jalan tersebut adalah lintasan menuju Kebun Bah Birong Ulu. Sehingga Pemkab Simalungun melakukan bekerjasama dengan PTPN IV untuk mengupayakan sesegera mungkin melakukan perbaikan. (eko)

Boa Boa

Panitia pesta Punguan Toga Samosir Boru Bere (PTSB) Siantar Simalungun

Drs E Samosir (Amani Gomgom) Ketua Diketahui Ketua Umum PTSB Siantar-Simalungun St Drs A Samosir MM (op. Lamtama) Pengumuman ini sekaligus sebagai undangan kepada seluruh anggota Punguan Toga Samosir Boru Bere

KADAR GULA DARAH TURUN, BADAN TERASA LEBIH SEGAR Indonesia kaya akan sumber daya hayati dan merupakan salah satu n e g a r a megabiodiversity terbesar di dunia. Selain itu, Indonesia juga dikenal sebagai gudangnya tumbuhan obat (herbal) sehingga mendapat julukan live laboratory. Salah salah hasil alam Indonesia yang terbukti bermanfaat bagi kesehatan adalah Gula Aren. Kini, hadir Gentong Mas yang salah satu bahan dasarnya adalah Gula Aren. Saat ini, telah banyak orang yang telah membuktikan manfaatnya, salah satunya adalah Suwarno (60 thn), "Mungkin karena pola makan dan faktor usia, sudah 6 bulan saya menderita penyakit berbahaya ini. Kadar gula darah saya mencapai 600 mg/ dL." Ujar pria yang berprofesi sebagai Wiraswasta tersebut. Ia menambahkan, ketika kadar gula darahnya tinggi, badannya sering terasa lemas, dan kepalanya sering pusing. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat

kaitannya dengan mekanisme pengaturan gula normal. Tapi sekarang, kakek 5 orang cucu dapat bernafas dengan lega karena telah menemukan solusi yang tepat untuk mengatasi keluhannya, "Setelah minum Gentong Mas secara teratur selama 2 bulan, kadar gula darah saya sekarang sudah turun, badan pun terasa lebih segar." Ungkap ayah 4 orang anak itu. Setelah merasakan manfaat mengkonsumsi Gentong Mas, ia pun merasa terpanggil untuk membagi pengalamannya itu dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain." Harap warga Bandar Klippa, Kec. Percut Sei Tuan, Deli Serdang, Medan tersebut. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula

darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas. Selain itu, indeks glisemik dalam Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787 Dolok Sanggul : 082129284752 T. Tinggi/Siantar : 081322099495 Binjai/pakam : 081398666166 Langkat/karo : 082167538828 Kisaran : 06237014362 Tanjung Balai : 081263495563 Labura : 081370590972 Labuhan batu : 082365222011 Sibolga :081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114


„ Jalur menuju Pinang Ratus putus total. Hingga saat ini belum ada perbaikan, sementara aktifitas warga terganggu akibat kerusakan ini.

Tangani Dengan Cepat BICARA jembatan yang rusak, penanganannya tidak boleh diundur-undur atau ditunda. Sebab itu merupakan kebutuhan yang vital bagi masyarakat. Terkecuali jalan rusak. Namun bila jembatan rusak, ini yang harus ditangani secepatnya. (pra) Bernhard Damanik Anggota DPRD Kabupaten Simalungun

Salurkan CSR PIHAK kebun setidaknya perduli terhadap kondisi disekitarnya. Kan ada dana CSR, kenapa tidak disalurkan saja untuk perbaikan jembatan. Sehingga masyarakat dapat merasakan manfaat kehadiran kebun. (pra) Herbert Hutagaol Wiraswasta


6 April 2013

Apa Kata Mereka

Sikap Kami Wakil Ketua DPR RI Priyo Budi Santoso Panja akan melaporkan RUU Ormas untuk disahkan pada paripurna. Tapi kalau masih ada yang krusial yang menjadi perdebatan, saya kira Panja harus lapang dada untuk mendengarkan dari semua elemen. Kalau itu tidak dimungkinkan, saya anjurkan kita tunda sampai persidangan berikut,”

Kasus Cebongan, Pintu Masuk Revisi Peradilan Militer

Mendengar Koreksi RUU Ormas Anggota Komisi I DPR Tjahjo Kumolo “Pada awalnya pendapat saya membela korps elite Kopassus, sangat tidaklah mungkin, sebagai pasukan elite TNI yang tugas utamanya membela bangsa negara. Ternyata, ada oknum Kopassus yang belum mampu menahan emosi,”

Ketua Badan Standar Nasional Pendidikan (BSNP) Muhammad Aman Wirakartakusumah “Sekarang setiap kursi akan mendapat setting soal berbeda, sehingga di satu ruang ada 20 setting (soal),”

Ketua Pansus Revisi UU Ormas Abdul Malik Haramain “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985 tentang Ormas memang asas yang sama dengan UU Parpol,”

POLEMIK mengenai rancangan undang-undang organisasi kemasyarakatan (RUU ormas) terus menggelinding. Hal itu tampak dari pernyataan sikap sejumlah ormas dalam keputusan resmi organisasi, diskusi publik, dan demonstrasi. Desakan agar pasalpasal kontroversial segera direvisi begitu kuat. Bila tidak, begitu disahkan jadi UU ormas, ormas-ormas itu telah berancang- ancang mengajukan judicial review ke Mahkamah Konstitusi (MK). Pemerintah dan legislatif selayaknya mendengar suara kritis in Oleh : Biyanto


uhammadiyah ter masuk yang telah bersikap tegas me nolak RUU ormas. Sikap itu diambil karena menurut hasil telaah Muhammadiyah, RUU ormas yang dibahas di DPR dapat membatasi kebebasan berserikat dan berkumpul serta berpotensi menimbulkan kegaduhan dan instabilitas politik (Jawa Pos, 29 Maret). Dalam pertemuan di Kantor Pimpinan Pusat Muhammadiyah, setidaknya ada 96 ormas lain yang juga menolak. Sementara, PB NU mengusulkan pembahasan RUU ditunda terlebih dulu hingga ada titik temu, terutama terkait pasal-pasal yang masih diperdebatkan. Sikap beberapa ormas tersebut dapat dipahami karena mereka ingin memastikan bahwa RUU ormas tidak menjadi pemasung. Apalagi, ormas sekelas Muhammadiyah dan NU yang telah banyak berkiprah dan, berusia jauh lebih tua dari negeri ini. Ormas ingin RUU itu menjamin kebebasan berserikat, sementara pemerintah berkepentingan mengendalikan ormas. Dalam perspektif pemerintah, UU No 8/1985 tentang Ormas dianggap tidak lagi mampu mengikuti perkembangan. Itu karena perkembangan ormas, terutama pada masa reformasi, terasa sangat dinamis dan meriah. Alasan lain yang dimajukan pemerintah adalah keberadaan ormas anarkistis yang sering mengganggu masyarakat dan merongrong kewibawaan pemerintah. Dalam aksinya ormas anarkistis telah memanfaatkan simbol-sim-

bol agama atau simbol negara. Padahal, Jalaluddin al-Suyuthi, ulama besar dan mujadid Islam, menyatakan bahwa tidak semua orang dapat melaksanakan tugas tersebut. Menurut al-Suyuthi, hanya ulama dan penguasa yang dapat bertugas amar ma’ruf nahi munkar. Ulama mengembang tugas itu karena memiliki ilmu, sedangkan penguasa memiliki kekuasaan. RUU ormas juga dirancang untuk mengatur keberadaan lembaga swadaya masyarakat (LSM), baik yang didirikan WNI maupun warga asing. Dalam penilaian pemerintah, keberadaan LSM harus diatur agar kiprahnya dapat diselaraskan dengan tujuan pembangunan nasional. LSM yang dikelola orang asing pun harus menunjukkan komitmen untuk kepentingan nasional dan turut menjaga keutuhan NKRI. Regulasi ini dinilai penting, karena diduga kuat banyak LSM yang bekerja tidak untuk kepentingan nasional, melainkan untuk funding agency asing. Jika dicermati secara mendalam dari RUU ormas, paling tidak ada tiga poin yang penting diperhatikan. Pertama, RUU ormas berpotensi menggeneralisasi semua lembaga sosial kemasyarakatan. Itu berarti posisi ormas yang telah berkontribusi luar biasa bagi perjuangan kemerdekaan dan berpartisipasi dalam pembangunan nasional, seperti Muhammadiyah dan NU, tak berbeda dengan LSM baru. Berkaitan dengan persoalan ini, RUU ormas harus membedakan secara tegas peraturan untuk ormas dan LSM, apalagi ormas asing.

Poin ini penting diperhatikan karena Muhammadiyah dan NU dengan ribuan amal usaha di bidang pendidikan, kesehatan, ekonomi, dan pelayanan sosial lainnya memiliki jaringan yang luas mulai pusat, provinsi, kabupaten/ kota, kecamatan, dan kelurahan/ desa. Itu berbeda dengan LSM yang hanya menekankan pekerjaan di satu bidang dan bersifat elitis. Karena itu, penyamaan ormas dan LSM jelas sebuah kesalahan yang mendasar. Kedua, RUU ormas membuka peluang munculnya otoritarianisme baru. Apalagi, dalam RUU itu ada ketentuan bahwa Direktorat Jenderal Kesatuan Bangsa dan Politik (Ditjen Kesbangpol) dapat mencabut izin ormas. Jika itu yang terjadi, akan muncul budaya represif atas nama undangundang. Padahal, kebebasan berserikat dan berkumpul jelas diatur dalam konstitusi. Apalagi, konteks pembuatan UU No 8/1985 dan RUU Ormas jauh berbeda. UUNo8/1985dibuat suasana rezim otoritarian Orde Baru. Sementara RUU ormas kini disusun dalam suasana demokratis. Karena itu, RUU ormas seharusnya menjamin ormas untuk menampilkan kekhasan asal tidak bertabrakan dengan nilainilai Pancasila dan kepentingan nasional NKRI. Ketiga,RUUormas mewajiban pencantuman Pancasila sebagai asas bagi setiap ormas.Eloknya,RUU ormas memberikan kelonggaran bagi ormas yang ingin menggunakan asas lain, dengan syarat tidak bertentangan dengan

Pancasila.Jikaituyangdilakukan, ormas berbasis agama tidak harus menggantiasasnyadenganPancasila.Jangankoreklagitraumasosialdan politikasastunggaleraOrdebaruyang justru menyempitkan keterbukaan ideologiPancasila.Takperluadatafsir tunggal atas Pancasila dengan mena-fikanindahnyapelangikeragamanyangmembentukIndonesiatercinta. Jika beberapa hal yang berpotensi memicu pertentangan itu kembali didialogkan, rasanya masing pihak, yakni pemerintah, legislatif, dan ormas yang menjadi sasaran RUU, pasti menemukan jalan keluar. Aamin. (*) Penulis adalah Dosen IAIN Sunan Ampel

TERUNGKAPNYA penyerangan yang menewaskan empat tahanan di Lembaga Pemasyarakatan (Lapas) IIB Cebongan, Sleman, Yogyakarta, 23 Maret 2013 lalu, oleh 11 oknum Grup 2 Kopassus Kandang Menjangan, Kartasura, Solo, Jawa Tengah, membuka celah bagi DPR untuk merevisi Undang-Undang Nomor 31 Tahun 1997 tentangPeradilanMiliter. Upaya ini sebagai bentuk reformasi di sektor keamanan. Sehingga kejadian demi kejadian yang melibatkan anggota TNI terhadap sipil sebagai korbannya,tidakterusterjadi. TNI mencatat, selama 2012, kasus demi kasus kriminal yang dilakukan oleh anggotanya cukup mencolok. Penganiayaan yang melibatkan prajurit TNI mencapai 355 kasus, terlibat narkoba sebanyak 161kasus,sertapenyalahgunaansenjataapisebanyak 49 kasus. TNI juga mencatat sebanyak 3.634 prajurit terlibat pelanggaranhukumdansedangdiproses.Darijumlah tersebut, TNI telah menyelesaikan perkara sebanyak 3.298 kasus. Narapidana dan tahanan militer, sisa tahanan tahun 2012 sebanyak 414 orang. Tahanan masuk 1.812 orang, tahanan bebas 1.795 orang. Jumlah tersebut tentu bukan angka kecil, dan akan terus bertambah setiap tahunnya bila penegakan hukum dikalangan militer tidak segera ditertibkan. Karena itu, perlunya DPR merevisi RUU Peradilan Militer, apakah perlu prajurit TNI yang terbukti melakukan tindak kejahatan dapat disidangkan di pengadilanumum. Dengan begitu, masyarakat perlu tahu, dan bagi mereka keterbukaan, transparansi dan juga keseriusan dari aparatur negara, khusus militer tidak lagi jadi barang yang tabu. Selamaini,tindakanparatersangkamasukkategori pidana umum, mereka akan ditangani oleh pengadilan militer. UU Peradilan Militer memang secara tegas menyebutkan, setiap anggota TNI yang melakukan tindak pidana, termasuk pidana umum, diadili di pengadilan militer.(*)


Enam Negara Kembali Gelar Dialog Nuklir Iran KAZAKASTAN-Enam negara yakni AS, Rusia, China, Perancis, Inggris, dan Jerman menghelat kembali dialog nuklir Iran. Kali ini, Almaty, ibu kota Kazakstan, menjadi lokasi penyelenggaraan, tulis AP pada Jumat (5/4/). Selama dua hari ke depan, mitra dialog enam negara itu adalah juru runding Iran. Sebelumnya, pembicaraan terakhir mengenai dugaan pengayaan uranium oleh Iran itu diselenggarakan pada Februari. Dalam kesempatan itu, Kepala Urusan Kebijakan Luar Negeri Uni Eropa, Catherine Ashton, meminta agar pihak Iran memberikan jawaban nyata dan resmi. “Hal ini diperlukan untuk membangun kepercayaan lebih baik,” katanya. Sampai kini, Iran dan pihak Barat memang belum menemukan kata sepakat terkait dugaan pengayaan uranium tersebut. Barat khawatir upaya Iran bisa menciptakan bom nuklir yang mengancam stabilitas dunia. Iran mengatakan bahwa program nuklirnya hanya dimanfaatkan untuk energi dan perdamaian. (kcm/int)

AS Siaga Hadapi Kemungkinan Serangan Korut SEOUL-Amerika Serikat (AS) mengatakan, pihaknya tengah mengambil semua langkah pencegahan yang diperlukan setelah Korea Utara (Korut) melancarkan ancaman terbaru dalam krisis yang terus meningkat dengan memindahkan rudal jarak menengahnya ke pantai timur, Kamis (4/4). Menteri Pertahanan Korea Selatan (Korsel) Kim Kwan-Jin mengatakan, rudal itu bisa mencapai “jarak yang cukup jauh”, tetapi bukan daratan AS. Kim mengatakan hal itu saat mengemukakan kepada anggota parlemen Korsel bahwa pemindahan rudal itu “bisa saja bertujuan untuk melakukan uji tembak atau latihan militer”. Itu merupakan langkah terbaru Korut yang telah mengeluarkan serangkaian ancaman perang nuklir yang bakal menghancurkan dalam beberapa pekan terakhir. Korut marah dengan sanksi terbaru PBB dan latihan militer bersama Korsel-AS. Juru Bicara Gedung Putih, Jay Carney, mengatakan rentetan ancaman itu “disesalkan tapi memang akrab” dengan pola perilaku Korut. “Kami sedang mengambil semua langkah pencegahan yang diperlukan,” kata Carney. Ia mengatakan, AS mengambil “sejumlah langkah yang hati-hati” untuk menanggapi ancaman serangan rudal yang mungkin terjadi. Pentagon telah mengatakan pihaknya akan mengirim sistem pencegat rudal untuk melindungi pangkalannya di Guam, sebuah wilayah AS yang terletak 3.380 kilometer di tenggara Korut dan tempat tinggal bagi 6.000 personel militer Amerika. Sumber-sumber intelijen Korsel dilaporkan telah mengidentifikasi rudal Korut itu sebagai Musudan yang punya jangkauan menengah. Musudan belum pernah diuji coba, tetapi diyakini punya jangkauan sekitar 3.000 kilometer, yang secara teoretis bisa didorong untuk berjangkauan 4.000 kilometer dengan muatan ringan. Juru Bicara Kementerian Pertahanan Korsel mengatakan, dia tidak bisa mengonfirmasi jenis pasti rudal itu, tetapi mengatakan Musudan bisa menimbulkan ancaman bagi pasukan AS di Guam. Namun, banyak pakar menduga bahwa Korut belum mampu memasang perangkat nuklir pada rudal balistik yang mampu menyerang pangkalan militer atau wilayah AS. Kamis kemarin, militer Korea Utara mengatakan bahwa pihaknya telah menerima persetujuan final untuk aksi militer, yang mungkin melibatkan “beragam” senjata nuklir, melawan ancaman pesawat pengebom siluman B-52 dan B-2 AS yang berpartisipasi dalam latihan militer bersama dengan Korsel. Retorika Korut itu telah memicu kekhawatiran internasional. Sekjen PBB Ban Ki-moon menggambarkan ancaman yang rutin dari Pyongyang itu sebagai “benar-benar mengkhawatirkan dan meresahkan”. “Saya pikir mereka sudah terlalu jauh dalam retorika mereka dan saya khawatir jika ada salah pertimbangan, salah perhitungan ini akan punya implikasi yang sangat serius,” kata Ban. (kcm/int)

SUZUKI MAIN DEALER RESMI; PT TRANS SUMATERA AGUNG, Jl. H Adam Malik No. 103 Medan.Ready Stock (Cash&Kredit):• All New SUZUKI; • Carry Pick up Dp 13 jt-an Angs 2jt-an; • APV Pick Up Dp 20jt-an angs 2jt-an; • Ertiga Dp 40jt-an angs 3 jt-an, dll. Full discount dan hadiah. Berkas dan data dapat di jemput. Bukan janji, tapi bukti. Hubungi: Chandra Damanik - HP. 0852 6066 3829.


TOLAK RUU ORMAS Hizbut Tahrir Indonesia, melakukan unjuk rasa di depan gedung DPR RI, Jumat (5/4) di Jakarta. Dalam aksinya mereka menolak Rancangan UndangUndang (RUU) Organisasi Masyarakat, yang dianggap jauh dari semangat reformasi.

Asas Tunggal Pancasila Dicabut RUU ORMAS AKAN DISAHKAN 12 APRIL

JAKARTA - Asas tunggal Pancasila yang ditolak oleh Fraksi PKS DPR telah dicabut. RUU Ormas dijadwalkan disahkan 12 April 2013 mendatang. “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985 tentang Ormas memang asas yang sama dengan UU Parpol,” kata Ketua Pansus Revisi UU Ormas, Abdul Malik Haramain, saat

berbincang, Jumat (5/4). Malik menuturkan, UU Parpol mengatur asas dasar Pancasila dan UUD 1945 dan diperbolehkan memasukkan asas lain yang tidak bertentangan dengan Pancasila dan

UUD 1945. Jadi tidak ada lagi klausul asas tunggal Pancasila. “Kalau semua bisa segera disepakati kita jadwalkan minggu depan tanggal 12 April masuk Paripurna DPR,” tegasnya. Asas ormas diatur di Bab II tentang asas, ciri, dan sifat ormas. Aturan tersebut diatur di pasal 2 RUU Ormas. “Asas ormas adalah Pancasila dan Undang-Undang Dasar Negara


„ Komite Etik KPK saat menyampaikan keputusan penyelidikan terkait bocornya sprindik Anas Urbaningrum.

Polri Belum Temukan Unsur Pidana Kasus Sprindik Anas JAKARTA-Penyidik Badan Reserse Kriminal Polri belum menemukan dugaan pelanggaran pidana dari kasus bocornya draf surat perintah penyidikan (sprindik) atas nama Anas Urbaningrum. Untuk itu, kepolisian belum dapat mengusut kasus yang sempat dilaporkan mantan Ketua DPC Cilacap Partai Demokrat Tri Dianto. “Jadi kita belum melihat apakah ini berkaitan dengan adanya pelanggaran hukum pidana yang menjadi ranah dari kepolisian,” kata Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar di Mabes Polri, Jakarta Selatan, Jumat (5/4). Sebelumnya, Tri Dianto berulang kali mendatangi Gedung Bareskrim Polri untuk melaporkan kasus tersebut, baik sebelum maupun sesudah

CAPELLA PEMATANGSIANTAR • All New Xenia Angsuran 1,1 jt • Terios Angsuran 1,9 jt • Luxio Diskon menarik • Pick up Dp 12 jt an • Mini Bus Dp 15 % • Ayla 80-110 jt hub. SONNY SEMBIRING, HP 0812 6471890; 0811 6114 455 Proses cepat data dijemput. Menyediakan TEST DRIVE!! PT. TRANS SUMATERA AGUNG • Carry Pick Up Dp. 12 Jutaan angsuran 2,5Jutaan • APV Pick Up Dp. 20 Jutaan angsuran 2,6Jutaan • APV Arena Dp. 30 Jutaan angsuran 3,9Jutaan • Ertiga Double Blower Dp. 45 Jutaan angsuran 4Jutaan • New Swift Dp. 47 Jutaan angsuran 4,4Jutaan AYO INDENT sekarang Ertiga AC Double Blower Hub: HENDRY SIAHAAN ST- 0852 7681 3610;Pin BB: 2A4CFC6E

TOYOTA SIANTAR • All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

SUZUKI BARU NIK 2013 • Pick Up 1.5 FD Rp. 103.500.000 • Real Van (Carry Minibus) Rp. 119.800.000 • APV Pick Up Rp. 109.500.000 • APV GE (Minibus) Rp. 149.800.000 • APV Arena Rp. 162.800.000 • Ertiga GA Rp. 158.800.000 • New Swift GL Rp. 182.800.000 • SX4 Over Rp. 227.800.000 • New Grand Vitara Rp. 351.800.000 Dapatkan Triple Bonus (Cash Back, Hadiah langsung & Undian Bulanan). Cash dan Kredit, data bisa dijemput. PT. Trans Sumatera Agung - Medan Dealer Resmi Suzuki David Sinaga: 081361324071,PIN BB: 2A18B40C


Komite Etik KPK mengumumkan hasil penyelidikan. Menurut Tri, Komite Etik belum mengungkap dalang pembocor draf sprindik yang beredar sebelum Anas resmi ditetapkan menjadi tersangka oleh KPK. Tri meminta kasus itu ditangani oleh kepolisian. Komite Etik KPK sebelumnya juga memutuskan bahwa pelaku utama pembocoran dokumen sprindik Anas adalah Sekretaris Ketua KPK Abraham Samad, Wiwin Suwandi. Wiwin yang tinggal satu rumah dengan Abraham itu menghubungi media untuk memberikan fotokopi draf sprindik Anas. Hal ini merupakan keputusan Komite Etik dalam jumpa pers di Gedung KPK, Rabu (3/4). Wiwin akhirnya dipecat sebagai sekretaris Abraham. Adapun Abraham dianggap lalai dalam

DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio

TOYOTA PROMO Dapatkan Hadiah Langsung tanpa diundi setiap pembelian Mobil TOYOTA Khusus Februari. Grand Prize "1 unit Honda Beat" dan hadiah lainnya: Kulkas, LCD 32", Mesin cuci, BlackBerry, dll. Ready Stock; Avanza, Veloz, Rush, Innova, Fortuner. Cash & Credit, Data dijemput, Proses Cepat Penawaran terbaik. Ayo Buruuan..!! Hub: Ricky A. Manik (Sales Executive); 0812 6505 3191 - 0853 7199 9499 SUZUKI PUSAT READY STOCK: ERTIGA GL 172.400.000 & GX 185.000.000; CARRY PU 97.500.000.; APV PU 111.000.000.; & ARENA 150.800.000.; SX4 214.800.000.; SWIFT 182,800,000.; dan VITARA 346.800.000.; DP MURAH & ANGSURAN RINGAN, PROSES CEPAT, DATA DI JEMPUT & PELAYANAN SEPENUH HATI. HUB: 081363092631 PIN 2255D0AA DAIHATSU BARU. BILA RUGI UANG KEMBALI DP. 30 JT ANGS 3,8 X 48 BLN DP. 62 JT ANGS 2,8 X 48 BLN TERIOS DP. 76 JT ANGS 3,6 X 48 BLN DP. 41 JT ANGS 4,9 X 48 BLN PICK UP DP. 14 JT ANGS 2,480 DP. 17,6 JT ANGS 2,250 DATA DIJEMPUT & PASTI OK. HUBUNGI : 0812 6359 5744 XENIA

DIJUAL AVA N Z A G T h n 2 0 1 0 , Simpanan jd KM rendah, Warna Silver mettalic, Harga Rp. 141 Jt. Mobil terawat, bukan eks rental, M A A F t p K H U S U S PEMAKAI. Hub: 0813 9624 6777 (No SMS) DIJUAL CEPAT. MURAH, MOBIL SEDAN CIVIC WONDER 1985, Metalic, Power Stering. BK Siantar. Berminat, Hubungi: 0813 7624 3282. Jl. Durian Raya No.1 Perumnas Batu 6

mengawasi sekretarisnya sehingga terjadi pembocoran dokumen sprindik tersebut. Menurut Komite Etik, Abraham tidak terlibat secara langsung dalam proses pembocoran sprindik. Atas pelanggaran ini, Komite Etik menjatuhkan sanksi berupa peringatan tertulis kepada Abraham. Komite Etik juga meminta Abraham memperbaiki sikap dan perilakunya serta memegang teguh kode etik pimpinan KPK. Komite Etik dipimpin Anis Baswedan dan beranggotakan Wakil Ketua KPK Bambang Widjojanto, penasihat KPK Abdullah Hehamahua, mantan pimpinan KPK Tumpak Hatongaran Panggabean, serta mantan hakim Mahkamah Konstitusi Abdul Mukti Fadjar. (kcm/int)

CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS& Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar.

CASH & CREDIT: 1.908 M2 cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar

CASH & CREDIT TANAH: 5 x 25 m, 5 x 20 m cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 5x20 m, 10x20 m, 15x20 m, 20x20 m Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DIJUAL MERCEDEZ BENZ C200 thn 97, Manual, Tape, CD, Velg racing, mobil simpanan. Hub: 0812 8903 3990

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DAIHATSU 100% BARU; TERIOS TX (AC DOUBLE BLOWER): DP 37 JT ANGS. 4.985.000 X 48 | DP 78 JT ANGS. 3.321.000 X 47; XENIA X DELUXE (AC DOUBLE BLOWER): DP 30 JT CICILAN 3.910.000 X 48 | DP 63 JT CICILAN 2.620.000 X 47; GRAN MAX PICK UP: DP 12 JT CICILAN 2.575.000 X 48 | DP 32 JT CICILAN 1.823.000 X 47. INFO & PEMESANAN: RAHMAT (081361329496-082362009080)

CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL Tanah di Jl. Melanthon Siregar Gg. Sipahutar depan BK3D Marihat, 10x21M. HP. 0852 9604 9188

Republik Indonesia Tahun 1945 serta dapat mencantumkan asas lainnya yang tidak bertentangan dengan Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945,” demikian bunyi pasal 2 RUU Ormas. Fraksi PAN Minta Tunda Pengesahan Badan Musyawarah (Bamus) DPR telah mengagendakan pengesahan revisi UU Ormas pada Sidang Paripurna DPR 12 April mendatang. Menyambut penolakan berbagai LSM dan Ormas, Fraksi Partai Amanat Nasionalo (F-PAN) dengan tegas meminta agar pengesahan RUU Ormas ditunda. “Kami secara resmi sudah mengirimkan surat ke pimpinan DPR agar pengesahan RUU Ormas ditunda,” kata Ketua F-PAN, Tjatur Sapto Edy, kepada wartawan di gedung DPR, sesaat lalu (Jumat, 5/4). Menurut dia, pembahasan RUU

tersebut telah menyita perhatian publik yang cukup besar. Terjadi penolakan dari ormas dan komponen masyarakat sipil. DPR, kata Tjatur, perlu menyerap aspirasi masyarakat yang berkembang dalam merespons RUU Ormas tersebut. Selain itu, fraksi PAN memahami respons masyarakat dan meminta pimpinan DPR untuk menerima aspirasi masyarakat yang berkembang dan menjadikan itu sebagai bahan masukan yang penting terkait pembahasan RUU Ormas. Selain meminta ditundanya pengesahan RUU Ormas, F-PAN meminta agar di waktu mendatang dilakukan uji publik serta forum sosialisasi yang lebih intensif kepada seluruh pemangku kepentingan agar produk hukum yang dilahirkan DPR, terutama yang menyangkut hidup orang banyak, dapat disepakati dan dipahami bersama. (kcm/rml/int)

Warga NTT di Jogya Lega Penyerang LP Cebongan Terungkap YOGYAKARTA-Empat tahanan yang tewas ditembak oleh oknum Kopassus di LP Cebongan adalah warga NTT. Warga NTT sempat resah pasca kejadian itu. Tapi setelah kasus itu terungkap, mereka lega. Salah satu sesepuh warga NTT di Yogyakarta, Jhon S Keban, mengatakan, warga mengapresiasi kerja baik Polri maupun Tim Investigasi TNI AD. Mereka kini menunggu proses hukum yang adil dan akuntabel. “Kami hormat pada prajurit yang sudah mengakui perbuatannya dan siap untuk bertanggung jawab. Kami menyerahkan proses hukum sepenuhnya,” kata Jhon saat dihubungi, Jumat (5/4). Warga NTT di Yogyakarta percaya pada temuan Tim Investigasi TNI AD. Langkah cepat dalam

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442; P. Siantar CASH & CREDIT: 10 x 21,8 m 20 x 22 m jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL CEPAT: Rumah Tua dan 3 petak kolam ikan,di Jl. Damar No 24 Pancur Nauli Parluasan Pematang siantar. Luas tanah sekitar 2.500M2. Cocok untuk Kavling. Hub Pak Gultom: 0813 1687 2844; 0853 6112 3856.

DIKONTRAKKAN 1 (SATU) RUKO 2 lantai (5x20), Jl. SM Raja No. 158 P.Siantar (depan USI). Hub: 0812 6475 999 Permanen 11x19; 4 KT, 2 KM, Garasi. DIJUAL: Rumah

Jl. Asahan KM. 4, Komp. Simalungun Permai II No. 10. Berminat Hubungi: 0813 9748 5519

K L I N I K : P u s a t p e n y e m b u h a n To n g Chang Jhiang Tiongkok, megobati: •Diabetes • Ginjal •Lever, hub. 0853 5973 PIJAT 9 5 2 3DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar HP 0813 7658 8917

mengungkap pelaku ini diyakini akan diikuti oleh proses hukum yang adil dan transparan. Warga NTT di Yogyakarta yang sebelumnya takut karena banyak beredar isu-isu sweeping, kini lega. Namun sebagian warga yang mayoritas mahasiswa itu, saat ini belum kembali ke Yogya pasca peristiwa penyerangan LP Cebongan. “Masih ada 10-15 persen belum kembali ke Yogya dari total mahasiswa NTT di Yogya sekitar 13 ribu. Tapi pertengahan bulan ini, setelah mengetahui kabar pelaku terungkap, dipastikan akan kembali semuanya,” katanya. Dari kasus tersebut, warga NTT di Yogya sepakat untuk menjadi pelajaran bersama. Mereka juga sepakat untuk menghargai pluralisme di Yogya dan menjadi bagian dari keistimewaan Yogyakarta. (kcm/int)

INVESTASI: Perhari dapat 5% selama 88 hari (Tanpa Rekrut). KLIK? / ID.8880044 /SMS "BERMINAT" HP. 0878 01710 444; HP. 0813 7928 5333; Tel.021-41013414 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” JOVNI CELLULER Promo Hp Murah dengan Fitur Lengkap, seperti: • Dual Sim • MP3 • Kamera • Layar Warna • Radio • Video • Bluetooth • Memory 2GB Hanya: Rp.,- , Masih Banyak Lagi!!! Alamat: Jl. Cipto No. 59, P. Siantar WA R U N G 1 6 5 : J l . M e l a n t h o n S i r e g a r N o . 3 1 A menyediakan: • Bakso • Mie Ayam • Siomay • Es dawet Ayu Mas Toni, datang dan rasakan nikmatnya. DIJUAL HONDA KHARISMA X tahun 200 5, body & mesin terawat, BK P.Siantar, Hitam/Silver. Maa f tanpa perantara Khusus pemakai, siapa cepat-dia dapat, hubungi: 0813 9624 6777 (NO SMS)

YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 LOWONGAN KERJA: Perusahaan baru yg bergerak di bidang distributor membutuhkan banyak karyawan/i usia 17 s/d 28 tahun, pendidikan min SMA/SMK sederajat (semua jurusan). Gaji Rp 1.800.000 - Rp 3000.000 untuk posisi : ADM, Marketing, Staf gudang, Pengawas, Debt collector, dan OB/OG. Bawa lamaran langsung ke Jl. Medan KM 6 No.61 (± 10 m sebelum simpang bongbongan) P.Siantar DIBUTUHKAN SEGERA: Karyawati Untuk Administrasi. Syarat: Wanita Min 20 Thn pendidikan SMA Sederajat, Penampilan menarik, Rajin, Jujur, supel, belum menikah, & tidak sedang dalam kuliah.Segera Antarkan lamaran lengkap ke Jl Cipto No. 39 Pematangsiantar LOWONGANKERJA:PenguasahaPangkasPria“TIGAPUTRA”membutuhkanTUKANG PANGKASdngnsistemMitra(bagihasil).bagiyangberminathubungi:HP.082164114611082167348321(BapakLEO).Alamat:Jl.StasiunKeretaApiNo.1P.Siantar



6 April 2013

Pengganti Ketua KPU Harus Berpengalaman MEDAN - Komisi Pemilihan Umum Sumatera Utara (KPU Sumut) berharap agar segera menentukan pengganti Irham Buana Nasution yang telah mengundurkan diri sebagai Ketua KPU. Sebab, selama kekosongan tersebut, KPU kesulitan untuk mengambil keputusan karena hanya memiliki tiga anggota komisioner. Salah seorang komisioner KPU Sumut Rajin Sitepu, Jumat (5/4) mengatakan, pengganti Irham haruslah orang berpengalaman yang berasal dari KPU Sumut atau dari kabupaten/ kota, “Sebaiknya penggantinya berasal dari tubuh KPU itu sendiri. Sehingga dalam pelaksanaan tugas selanjutnya, tidak ada lagi kesulitan dan memang sudah memahami tugas tersebut,” ujarnya. Dia mengungkapakan, pengalaman sangatlah perlu. Sebab jika penggantinya datang dari lembaga luar, pasti membutuhkan proses lagi untuk mempelajari tugas-tugas pokok KPU. “Bayangkan jika orang luar yang ditunjuk sebagai pengganti Irham, itu bakal menjadi masalah. Sementara KPU Sumut saat ini sedang dihadapkan dengan Pemilihan Legislatif (Pileg) yang sudah ada di depan mata,” tegasnya.(ial/smg)

Pungli di Jembatan Timbang

Rentan Libatkan Banyak Pihak MEDAN- Ketua Komisi A DPRD Sumut Oloan Simbolon memberi apresiasi positif dan sangat setuju pengusutan dugaan pungli yang terjadi di jembatan timbang oleh oknum petugas di Dinas Perhubungan Sumut. Pasalnya, Oloan berkeyakinan, tidak tertutup kemungkinan kasus pelanggaran hukum tersebut melibatkan banyak pihak, baik dari internal Dishub Sumut maupun di luar instansi tersebut. “Pungli di jembatan timbang jangan justru menjadi alat kongkalikong berbagai pihak, karena praktik itu merupakan kejahatan yang sangat merugikan keuangan daerah dan masyarakat,” kata Oloan, Jumat (5/4) Menurut dia, disinyalir praktik pungli di jembatan timbang ini diperkirakan sudah lama berlangsung. Bahkan, ada juga pihak-pihak yang menginginkan perbuatan yang merugikan masyarakat dan keuangan negara ini berlangsung terus. Padahal, tindak kejahatan tersebut, kata politisi Partai Persatuan Daerah (PPD), sering dikeluhkan masyarakat tanpa ada upaya dan tindakan tegas dari penegak hukum. Karena itu, Komisi A yang salah satunya membidangi persoalan hukum, sangat mendukung langkah tegas Kejaksaan Tinggi Sumut, untuk mengungkap kasus pungli tersebut hingga tuntas. “Baru-baru ini, tim penyidik Kejatisu telah memanggil dan memeriksa beberapa staf dan pejabat Dishub Sumut terkait dugaan pungli di jembatan timbang. Salah seorang pejabat yang telah memenuhi panggilan Kejatisu yakni Plt Sekretaris Dishub Sumut Ali Amas,” ujarnya. Menurut Oloan, pemeriksaan terhadap jajaran staf dan pejabat Dishub Sumut tersebut dilakukan bergantian selama dua pekan terakhir Sejalan dengan upaya kejaksaan tersebut, Gubsu Gatot Pujo Nugroho juga perlu mengambil sikap tegas terhadap oknum-oknum pejabat dan staf di jajaran Dishub yang terbukti secara hukum ikut dalam kasus kejahatan tersebut “Tanpa tindakan dan sanksi tegas, praktik pungli di jembatan timbang sulit diberantas hingga tuntas. sehingga Gubsu harus benarbenar serius menuntaskan persoalan ini. Karena masyarakat khususnya para supir sangat dirugikan,” terangnya. Sementara itu, anggota Komisi A DPRD Sumut Syamsul Hilal juga berharap Kejatisu serius mengungkap dugaan pungli tersebut. Bahkan, segera meningkatkan proses pemeriksaan oknum-oknum yang terlibat dari tahap verifikasi, menjadi penyelidikan, penyidikan hingga ada yang ditetapkan sebagai tersangka.(adz/smg)


GELAP- Seorang anak memasang lilin untuk menerangi ruangan. Di Sumut masih banyak kepala keluarga yang masih belum menikmati aliran listrik.

421.660 KK Sumut Belum Nikmati Listrik

MEDAN- Hingga Maret 2013, sebanyak 421.660 Kepala Keluarga (KK) di Sumatera Utara (Sumut) masih belum menikmati aliran listrik. Umumnya, mereka berasal dari desa ataupun dusun yang daerahnya masih tergolong sulit dijangkau. Sekretaris Dinas Pertambangan dan Energi Sumut Indra Ginting, Jumat (5/4) mengatakan, pemenuhan kebutuhan engeri listrik untuk KK di Sumut belum mencapat 100 persen. “Saat ini ada 2.611.977 pelanggan KK PLN di Sumut. Namun, rumahnya yang belum dialiri listrik sebanyak 421.660 pelanggan,” sebutnya. Kata dia, rasio elektrifikasi di Sumut hingga Maret 2013 masih sebesar 86,45%. Sementara jumlah KK yang belum

menikmati listrik itu, semuanya tersebar di 1.154 desa dari 5.779 desa yang ada. 165 desa atau dusun berasal dari Kabupaten Tapanuli Utara. “Itulah jumlah KK di Sumut yang belum dialiri listrik baik oleh PLN maupun non PLN,” ujarnya dihadapan peserta Musrenbang 2013 Pemprovsu di Santika Hotel Medan. Ia memprediksi, jumlah KK yang belum dialiri listrik itu akan terus bertambah di masa depan. Sebab, prediksi itu mengacu

Ikan Habis Dipukat , Nelayan Terjepit MEDAN- Peringatan Hari Nelayan Nasional kali ini masih mengidentikkan kawasan pesisir Indonesia sebagai kantong kemiskinan. Begitu juga dengan Sumatera Utara (Sumut), kesejahteraan nelayan tradisional jauh dari harapan. Salah satu penyebabnya karena ikan semakin habis, lingkungan rusak, illegal fishing semakin merajalela dan banyak persoalan lain. “Nasib nelayan tradisional dari dulu sampai sekarang tak berubah, begini-gini saja,” kata Jamaludin, Ketua Pelaut Rakyat Penunggu Indonesia di Desa Paluh Sibaji, Kecamatan Pantai Labu, Kabupaten Deli Serdang, Jumat (5/4). Menurut Jamal, 20 tahun lalu, nelayan dengan mudah mendapatkan ikan dengan memancing di pinggiran pantai. Ibu-ibu sebagai nelayan perempuan bisa mencari kepah dan kerang di pinggiran pantai dan berpenghasilan lebih dari Rp 75 ribu per hari. Penghasilan ini membantu ekonomi keluarga. Selain pendapatan suami yang saat itu lebih besar, karena tangkapan banyak dan harga bagus. Hanya dengan peralatan sederhana, hasil tangkapan nelayan terbilang besar, meski lokasi tak sampai 10 mil dari garis pantai. Menurut dia, seiring pergeseran waktu terjadi perubahan drastis. Ikan semakin sulit didapat karena lingkungan rusak. Terumbu karang yang menjadi tempat pemijahan ikan hancur dengan beroperasinya pukat trawl di wilayah tangkap nelayan tradisional. Akibatnya, nelayan terpaksa mencari ikan di

wilayah yang semakin jauh ke laut lepas bahkan sering ke perbatasan perairan Indonesia dan Malaysia. Di sini, para nelayan berhadapan dengan kapal-kapal besar pencari ikan dengan kapasitas ribuan ton. Mereka pun terpaksa mengambil risiko ditangkap patroli Malaysia. Jika tertangkap, seluruh hasil tangkapan berikut peralatan tangkap dirampas dan disuruh kembali ke darat dengan minyak yang tersisa. ”Itu masih untung, kalau tidak dipukuli, atau di penjara di Malaysia,” ucapnya sedih. Jamal menilai, seharusnya ada perlindungan terhadap nelayan tradisional. Misalnya dengan jaminan 12 mil dari garis pantai bebas dari operasional kapal penangkap ikan yang peralatannya modern. “Jangan sampai bercampur di lokasi yang sama dan saling berhadapan, nelayan tradisional pasti kalah,” kata Jamal.(kps/int)

kepada rasio pertumbuhan kebutuhan listrik di Sumut yang rata-rata mencapai 7 persen per tahun. Sementara menurut data Bank Indonesia pada triwulan II-2012, Sumut mencatat pertumbuhan ekonomi sebesar 6,29 persen. “Kalau mengacu pada data tersebut, maka kebutuhan listrik pada tahun 2013 mengalami kenaikan 101,08 MW (mega watt) atau menjadi 1.545,08 MW dari 1.444 MW pada Waktu Beban Puncak (WBP) di tahun 2012, dengan daya mampu system sebesar 1.539 MW,” lanjutnya. Indra menjelaskan, berdasarkan daya mampu sistem pembangkitan Sumut pada

2012, maka cadangan listrik ideal yang dimiliki harus sebesar 461,7 MW. Namun, akibat kondisi mesin pembangkitan yang sudah uzur dan adanya komponen yang tidak diproduksi lagi, menyebabkan kelebihan daya listrik dari daya mampu hanya sebesar 95 MW. “Sehingga, apabila terjadi kerusakan di salah satu pembangkit utama di PLTGU Sicanang, Belawan atau Paya Pasir, maka pasokan listrik pasti akan terganggu. Kondisi inilah yang dialami KK Kota Medan dalam beberapa pekan terakhir,” tutut Indra.(ram/smg) (FOTO:INT)

IKAN- Nelayan tengah menjaring ikan di tengah laut.


6 April 2013

KRETA GADAI DIGELAPKAN Sambungan Halaman 8 sudah dibawa kabur sama tukang gadai,” kata korban sewaktu di Polres Siantar. Tak berapa lama masuk ke ruang SPKT, korban kembali keluar. Karena kasus yang dilaporkan si korban butuh saksi. Terutama orang yang menggadaikan kreta. Kebetulan memang siang itu, korban datang seorang diri tanpa

ditemani kakaknya. “Kata polisinya. Kalau mau melapor harus ikut kakakku. Karena kakakku yang menggadaikan,” kata korban berlalu pergi. Informasi dari pihak SPKT membenarkan kedatangan calon pelapor ke Polres Siantar. Karena tak cukup bukti, calon pelapor terpaksa diminta menghadirkan kakaknya untuk menjelaskan kronologis soal gadai tersebut. (eko)

Dua Jurtul Togel Ditangkap

Sambungan Halaman 8 Tampubolon, Jumat (5/4) mengatakan, penangkapan terhadap kedua tersangka berawal dari informasi disampaikan masyarakat menyebutkan, di Dusun III Desa Ledong Timur judi Togel dan KIM marak. Berdasarkan informasi itu, pihaknya langsung melakukan penyelidikan dan melakukan penggerebekan di salah satu rumah di Dusun III Desa Ledong Timur,

dan berhasil menangkap kedua tersangka sedang beraktivitas merekap an menerima angka tebakan. Terpisah, Khairul salah seorang tokoh pemuda di Kisaran menuturkan, bahwa praktik perjudian togel masih terjadi, namun peredarannya sudah tersembunyi. “Judi togel masih ada, namun peredarannya tidak seperti dulu lagi yang semi terang–terangan, saat ini peredaran judi togel serta KIM dilakukan melalui handpone,“ ungkap Khairul. (sus)

3 Pencuri Diamankan

Sambungan Halaman 8 “Operasi Palm ini adalah operasi khusus tindak pidana pencurian tanaman kelapa sawit serta CPO, hasilnya telah ditangkap 3 pelaku pencurian,” terang Kasat Reskrim AKP Roni Sidabutar, Jumat (5/4). Dia menyebutkan, tersangka pertama adalah Boy Sumandar (19), warga Tanah Jawa. Boy melakukan pencurian di PTPN III Bah Jambi. Saat beraksi, Boy menggunakan sepedamotor dan

mengambil 10 tandan buah segar (TBS) kelapa sawit. Sedangkan Irpan (46), warga Nagori Sei Merbau, Kecamatan Ujung Padang, dibekuk saat melakukan aksinya di PTPN IV Tinjowan, Senin (1/4). Dari tangan pelaku, polisi mengamankan 8 tandan buah segar kelapa sawit dan membawanya dengan sebuah beko. Sementara Rikki Manullang (23), warga Bandar juga melakukan aksi pencurian di kebun hingga akhirnya diringkus petugas. (pra)

Diduga Stres, Warga Sipahutar Mengamuk di RS Pirngadi Sambungan Halaman 8 Paulus juga memecahkan sejumlah kaca nako. Pasien lain yang dalam perawatan pun panik dan berlari keluar ruangan walaupun sedang diinfus. “Tak tahu kenapa, tiba-tiba dia mengamuk dan memecahkan kaca ruangan,” kata Davidson, salah seorang sekuriti rumah sakit. Khawatir tindakan Paulus mengancam keselamatan pasien lain, petugas keamanan rumah sakit mengamankan Paulus dan membawanya ke ruang Instalasi Gawat Darurat

(IGD) dengan diikat di kursi roda. “Terpaksa diikat, soalnya dia ngamuk terus, bahkan ibunya sendiri pun pergi entah kemana karena mau dipukulnya,” kata David. Kabag Hukum dan Humas RSUD dr Pirngadi Medan, Edison Perangin-angin ketika di konfirmasi mengatakan akan menyelidiki kasus pasien tersebut. “Masalah ini akan kita selidiki terlebih dahulu, kabarnya pasien itu mengalami stres, walaupun dia telah merusak barangbarang milik negara,” pungkasnya.(int)

3 Warga BDB Luka-luka Sambungan Halaman 8 daranya Kevin dan Mariani naik Jupiter MX BK 6449 WM. Ketiganya melaju dari arah Bandar Pulo menuju arah Perdagangan dengan kecepatan sedang. Dari arah berlawanan, satu unit sepedamotor (belum diketahui identitasnya) melaju dengan kondisi oleng hingga terjadi tabrakan. Ketiga korban terhempas ke beram jalan dan mengalami luka-luka. Sementara pengendara sepedamotor yang datang dari arah berlawanan langsung tancap gas ke arah Perdagangan. Beruntung warga sekitar yang

mengetahui kejadian langsung melarikan korban ke Rumah Sakit Umum Perdagangan. Tak berselang lama, petugas kepolisian tiba di lokasi kejadian untuk mengamankan sepedamotor korban. Sampai saat ini, identitas pengendara yang menabrak korban masih dalam penyelidikan polisi. Rustam (34), warga Bandar Pulo mengaku sempat melakukan pengejaran. Namun ia kalah cepat. Kapos Lantas Polsek Perdagangan Aiptu W Aritonang, ketika ditemui METRO, Jumat (5/4) membenarkan kejadian ini. “Kita masih melakukan penyelidikan soal kasus kecelakaan ini,” ujarnya. (bli/dro)

Ganja & Sabu Seharga Rp10 Miliar Dibakar MEDAN- Mengantisipasi indikasi penyimpangan dan rusaknya barang bukti, Satuan Narkoba Polresta Medan membakar barang bukti narkoba jenis sabu dan ganja seharga Rp10 miliar, Jumat (5/4). Pembakaran dilakukan di halaman Mapolresta Medan dipimpin Wakapolresta Medan AKBP Pranyoto, dan Kasat Narkoba Kompol Dony Alexander. Menurut Wakapolresta, barang bukti sabu seberat 10.375 gram dan ganja kering 10.368 gram hasil penyitaan selama sebulan dengan empat

laporan serta enam orang tersangka. “Pemusnahan ini untuk menjaga agar tidak terjadi penyalahgunaan serta rusaknya barang bukti yang tersimpan lama. Barang bukti diperoleh selama Maret dengan enam orang tersangka,” kata Pranyoto. Dalam acara itu, hadir perwakilan jaksa dari Kejari Medan, Kejari Lubuk Pakam, penasehat hukum prodeo para pelaku yang terdiri dari Marnaek Pasaribu, Zulhemi, Mulyadi, Zulfikar, Arkius, dan Armansyah. Kepala Badan Narkotika Nasio-

nal Provinsi (BNNP) Sumut Kombes Rudi Tranggono mengatakan, untuk skala nasional Sumut ranking kedua terbesar dalam peredaran narkoba. “Sumut ranking dua terbesar secara nasional. Kita berharap dengan Polri dan BNN mampu mengurangi angka peredaran dan penyalahgunaan narkoba,” ucap Rudi. Memberantas narkoba bukan hanya mengharapkan petugas, lanjut Rudi. Akan tetapi, andil masyarakat juga sangat diharapkan. “Kita berharap masyarakat ikut membantu

memerangi narkoba. Selama ini masyarakat menganggap narkoba bukan masalah nasional, asumsi itu yang membuat masyarakat diam. Padahal ini masalah nasional bahkan dunia,” katanya lagi. Dia mengatakan, periode 20112012 penyalahgunaan narkoba terbesar untuk pelajar masih dipegang oleh Sumut. “Untuk pelajar secara nasional kita cukup tinggi, namun persentasenya kita kurang tahu persis karena datanya di kantor. Atau bisa buka situs BNNP Sumut,” pungkasnya. (pmg)

Uang Tunai Ratusan Juta Rupiah Ludes Dijambret MEDAN- Nasib sial menimpa Suwandi (27), warga Jalan Kancil, Kecamatan Medan Area, yang bekerja sebagaikaryawanPTMultiArtaSemesta di Grand Aston City Hall. Pasalnya, dia dijambret dua orang tak dikenal saat akan menyetorkan uang perusahaan sebanyak Rp 119.942.000, Jumat (5/4). Informasi di Mapolsekta Medan Timur, uang cek tunai dan giro milik perusahaan itu dibawa korban menuju

bank menggunakan sepeda motor jenis Yamaha Vega R BK 2505 CR. Menyandang tas samping berisi uang tersebut, dia melintasi Jalan Timur Baru, Kecamatan Medan Timur. Rencananya, Suwandi akan mendatangi rumah atasannya terlebih dahulu untuk menandatangani cek dan giro tersebut. Belum sampai di rumah atasannya, Suwandi dipepet dua pelaku yang mengendarai sepeda motor jenis

bebek. Pelaku langsung menarik tas sandang yang dibawanya. Meski sempat terjadi aksi saling tarikmenarik, pelaku berhasil menguasai barang dan meninggalkan Suwandi yangjatuhdarisepedamotornya.Kedua pelaku melarikan diri ke arah Jalan Sutomo Medan. Walau dia sempat berteriak rampok, tapi pelaku berhasil melarikan diri dari upayapengejaranyangdilakukanwarga

sekitar yang mendengar jeritan korban. “Aku rupanya sudah diikuti. Sempat kami tarik-tarikan sampai aku jatuh,” ucapnya. Ditemani beberapa rekan kerjanya, korban langsung membuat pengaduan ke Mapolsekta Medan Timur. Kanit Reskrim Medan Timur AKP Ridwan Danil saat dikonfirmasi wartawan mengatakan kejadian ini masih dalam pemeriksaan. (int)

4 TSK & 5 Kreta Diamankan Sambungan Halaman 8 Sidabutar, kepada METRO, Jumat (5/4). Roni mengatakan, butuh waktu relatif lama untuk membongkar sindikat para pelaku. Dia mencontohkan kasus pencurian sepedamotor yang dialami Sahala Lingga (41), warga Kecamatan Raya. Sahala kehilangan sepedamotor YamahaScorpiodarihalamanrumahnya pada 16 Oktober 2012. Setelah dilakukan penyelidikan terus menerus, akhirnya pelaku Yusuf Sinaga berhasil ditangkap pada Maret. Dari tangan tersangka, polisi

berhasil mengamankan sepedamotor korban. Demikian halnya dialami Septi Suryando(22),wargaNagoriBosar,Kecamatan Pane, pada 25 Okotober 2012, kemarin, sepedamotorYamahaXeonmiliknyajuga diembat maling. Dari hasil penyelidikan kepolisian akhirnya pelakunya berhasil diringkuspadaRabu(3/4),yakniRijalLubis (26),wargaJalanDiponegoro. Kemudian aksi pencurian sepedamotor kembali terulang pada 25 Maret kemarin,yakniyangdialamikorbanRomy Siregar (24), warga Tanah Jawa. Ketika itu

sepedamotor Yamaha Vixion, miliknya diparkirkan di Huta Timuran, Nagori Mariah Jambi, Kecamatan Jawa Maraja Bah Jambi, dicuri maling. Setelah dilaporkan kepada petugas kepolisian, Polres Simalungun kembali membentuk tim hingga akhirnya menciduk Sandy Syaputra Lubis (22), warga Panombean Pane pada akhir Maret kemarin. Setelah dilakukan pemeriksaan, Sandy mengakuimenjualsepedamotortersebut kepada salahseorang rekannya bernama Isban (19) di Kabupaten Batubara. Ketika itu, petugas pun kemudian menjemput

Isban, serta barang buktinya ke Kabupaten Batubara. Roni menyebutkan, untuk Isban dikenakan pasal 480 KUHPidana yang berperan sebagai penadah. Sementara ketiga tersangka lainnya dijerat pasal 363 KUHPidana tentang pencurian. “Dari hasil pemeriksaan, dalam melakukan aksinya pelaku menggunakan kunci palsu. Kunci itu untuk menghidupkan sepedamotor targetnya. Saat ini, kita masih melakukan pemeriksaan untuk dilakukan pengembangan,” ujar Roni. (pra/dro)

Nasabah CIMB Niaga Mangamuk Sambungan Halaman 8 pihak perusahaan menolak uang tunggakan angsuran yang hendak dibayarkannya selama 7 bulan. “Saya menunggak angsuran ke-14 sampai angsuran ke-21. Jumlah angsurannya setiap bulan sebesar Rp3.740.000 selama 4 tahun. Jadi sayamau membayar tujuh bulan angsuran yang tertunggak. Namun pihak perusahaan tidak mau menerimanya. Dengan alasan harus

dibayar lunas. Inikan tidak sesuai lagi dengan kontrak. Makanya saya mengamuk,” katanya. DijelaskanNurbaiti,mobilKijangInnova miliknyatelahdiambilpaksaolehdebtcollector pada hari Minggu (31/3) lalu. “Minggusemalammobilkuitudiambil paksa oleh debt collector. Anehnya, debt collector tersebut ditemani salah seorang oknum Brimob dengan menggunakan laras panjang. Bahkan, Brimob itu menakuti kami dengan mengatakan kami

melakukan penggelapan mobil. Karena saya takut, mobil itu saya serahkan. Kata debt collector itu, jika mau menebus mobil itu, harus dibayar semua angsuran yang tertunggak. Namun, saat saya mau membayar mereka tak mau menerimanya. Tadi saya sempat mengamuk. Baru lah mereka mau menyelesaikan masalah ini Senin depan. Mudah-mudahanlah mobilku itu bisa keluar,” kata Nurbaiti. Terpisah, Manager CIMB Niaga melalui admin penarikan Ilham Nainggolan

mengatakanmobilKijangInnovatersebut sudah kategori WO, sehingga pihak perusahaan melakukan penarikan. “Mobil itu sudah tertunggak selama 6 bulan. Dan saat ini mobil itu kategori WO, dan harus ditarik. Nah, jika pihak konsumenmaumembayartunggakantersebut maka kami akan mengembalikannya. Tapi, hari ini kami tidak bisa menerima angsuranitu,karenapimpinanlagikeluar kota. Jadi, hari Senin masalah ini akan diselesaikan,” kata Ilham. (CR-02)

Siswa SMK Curi HP TNI Sambungan Halaman 8 korban merasa lapar kemudian pergi ke dapur untuk mengambil roti. Begitu keluar dari dapur, korban kaget melihat handphone-nyasudahtidakada. Korban pun menanyakan pada istrinya. Namun istri korban mengaku tidak tahu dan tidak melihat ada orang yang mengambil handphone tersebut. Tapi korban tak habis akal, ia pun menghubungi nomor kontak Hp yang hilang itu pakai handphone istri. Begitu dihubungi, suara nada panggil terdengar jelas dari samping rumah. Setelah

didekati, ternyata Hp itu sudah berada dalam tas milik BG. Walau sudah ketahuan mencuri, BG sempat berdalih dan mengatakan bukan mencuri melainkan menemukan. Setelah dipaksa mengaku, pelaku tetap ngotot mengatakan bukan mencuri melainkan menemukan. Takut diamuk massa, korban menghubungi petugas kepolisian Polsek Siantar Timur. Tak berapa lama, personel polsek terjun ke TKP untuk mengamankan pelaku. Kepada METRO, BG mengaku, nekad mencuri karena sudah tidak punya uang

untuk bayar rumah kos di Jalan Bali. Sementara uang kiriman yang diberi orangtua setiap bulan habis dijudikan. “AkumencuriuntukbayaruangkosBang, karena sudah banyak hutangku di rumah kos di Jalan Bali. Makanya, aku berniat pindah,” aku pelaku. Tak berapa lama, Guru pelaku bermargaMarpaungmendatangipolsek. Kepada METRO, dia mengatakan pelaku pencuri handphone itu sudah enam bulan tidak membayar uang sekolah. Jika ditotalkansekitarRp900ribu.Selainkanitu pelaku juga dikenal sering bolos dari sekolah.

L Sinaga, korban pencurian menyampaikan kepada Kapolsek Siantar Timur AKP Altur Pasaribu bahwa dirinya tidak keberatan. Apalagi setelah mengetahui bahwa pelaku baru saja kehilangan orangtua laki-laki. “Mendengar pengakuan BG kalau orangtuanya baru saja meninggal dunia, saya turut berduka. Atas kejadian ini saya tidak keberatan,” ujar korban kepada Kapolsek. Altur Pasaribu mengatakan korban tidak jadi membuat laporan pengaduan. Sementara pelaku sudah dibawa pulang olah gurunya. (eko)

Sambungan Halaman Satu Tangkap Bandar Togel! Sambungan Halaman 1 Tambunan, mendesak aparat kepolisian segera menangkap bandar judi togel yang menjadi tempat Kosdin Sumbayak menyetorkan hasil penjualan togelnya. Pdt Abraham Josua Tambunan yang depada METRO, Jumat (5/4) mengatakan, peristiwa tewasnya kapolsek menjadi peringatan agar judi togel tidak dibiarkan marak. Aparat penegak hukum, khususnya pihak kepolisian didesak segera menangkap para bos-bos judi (bandar togel). “Para bandar judi itu harus segera ditangkap dan dihukum seumur hidup,

supaya tidak bolak-balik melakukan perjudian. Jangan hanya menangkapi penulisnya,” tegasnya. “Kenapa mantan Kapolri Jendral Sutanto, bisa memberantas perjudian togel di Sumatera Utara dalam seminggu. Sementara oknum-oknum Kapolsek tidak sanggup menghentikan judi di setiap wilayah kecamatan yang dipimpin,” tukasnya. Dia menambahkan, jika judi ditutup, dampaknya kepada warga sangat positif. Di mana nantinya, jika pihak kepolisian dapat menghentikan perjudian, maka polisi telah menemukan salah satu cara untuk menghentikan bentrok dalam rumah tangga,

menghilangkan tendensi animo pencuri dan perampokan,” jelasnya. “Dulunya, di Kecamatan Dolok Pardamean, tidak ada kudengar terjadi pencurian dan penodongan. Namun sekarang, sejak maraknya judi togel, pencurian, perampokan dan penodongan sudah banyak terjadi. Di mana, saya dulunya tidak takut melintas di Tanjung Dolok menuju Saribu Dolok. Namun sekarang ini, kulihat jalan yang sering kulalaui dulu sudah tampak sudah sepi. Hal ini dikarenakan warga sudah takut dengan kondisi yang sudah sangat rawan,” terangnya. (th)

Merambah ke Pelosok Sambungan Halaman 1 Dia mengatakan, judi jenis togel ini telah merambah dan dijual bebas di warung-warung. Katanya, peminatnya tidak hanya para preman, bapak-bapak, anak sekolah bahkan ibu-ibu pun sudah mulai ikut-ikutan. “Kami sangat khawatir kalau bandar judi togel ini tidak segera ditangkap, akan dapat merusak

tatanan masyarakat. Untuk itu kami sangat berharap ada keseriusan pihak kepolisian mengatasi masalah ini,” katanya Masih kata Indra, sejumlah berita yang beredar di media massa soal kasus togel memang sering tersiar. Namun untuk bandar togel sendiri, tampaknya masih jarang bahkan nyaris tidak pernah ditangkap. “Kita sering baca di koran, lihat di TV dan dengar di radio. Polisi tangkap penulis

togel, tapi jarang pula kita dengar polisi tangkap bandar togel,” tambahnya. Ketika ditanya dari sudut pandang agama, Indra mengatakan orang yang terlibat perjudian tidak dibenarkan, karena dapat menimbulkan dosa. Dari sisi hukum, perjudian juga dilarang beredar karena dapat menimbulkan keresahan bagi masyarakat. Memang untuk memberantas kegiatan ini sedikit sulit, tentu harus didukung bukti-bukti yang kuat

Dendam Ayahnya Tewas Diguna-guna

Petani Disembelih Saudara PAKPAK BHARAT- Ukuk Tinambunan (40), seorangpetanitewasdibacokdandigorokMManik (28) yang masih merupakan saudaranya. Pembunuhan sadis tersebut terjadi Jumat (5/4). Informasi dihimpun dari kepolisian, pembunuhan tersebut terjadi di Desa Pagindar, Kecamatan Pagindar, Kabupaten Pakpak Bharat, tepatnya tak jauh dari ladangnya. Pembunuhan ini diketahui setelah tersangka ManikmendatangiPolmasPolsekSuroAcehSingkil usai menghabisi nyawa korban. Petugas yang mengetahui hal itu langsung menyerahkan tersangka ke Polres Pakpak Bharat, karena tempat kejadianperkaranyadiPakpakBharat. Kepadapolisi,MManikmengakuiperbuatannya atas keberadaannya. Namun jika polisi serius, tak ada yang tidak mungkin bisa ditangkap. Kenapa teroris bisa di tangkap, sementara bandar togel bebas berkeliaran. “Informasi ini tentu sangat berguna sebagai acuan dalam menjalankan tugas bagi pihak berwenang dalam permasalahan ini. Kami akan selalu dukung jika polisi dapat segera menangkap para bandar togel khusunya yang bermukim di Siantar,” tutup Ustad Indra. (eko)

Jalan Kaki Melewati Hutan, Honor Rp150 Ribu Sebulan Sambungan Halaman 1 Turunan, Kecamatan SDH. “Saya sejak 2007 sudah mengajar di Turunan,” ucap ibu satu anak itu memulai perbincangan singkat bersama awak koran ini ketika melintasi jalan di tengah hutan (Gotting Babiat) yang kebetulan rombongan mobil Turdes Bupati Tapsel sedang mengalami mogok akibat sulit melewati jalan setelah diguyur hujan. Aktivitas mengajar tetap dipertahankannya sekalipun telah menikah dengan Ritonga (27). Sekitar empat tahun terakhir, ia harus menempuh jarak yang cukup jauh ke sekolah. Karena ia ikut

suami dan tinggal di Desa Baringin, Kecamatan Dolok, Kabupaten Padang Lawas Utara (Paluta). “Saya ingin terus mengabdikan diri berbagi ilmu dengan anak-anak kampung kelahiran saya. Apalagi di sana, tenaga saya masih dibutuhkan,” ujarnya sambil menjelaskan dalam seminggu dirinya hanya masuk tiga kali saja. Lebih lanjut, Alumni D2 kependidikan Universitas Muhammadiyah Tapanuli Selatan (UMTS) tersebut mengungkapkan, pada hakikatnya upah yang diterimanya dalam mengambdikan diri di bangku sekolah tidaklah memenuhi kebutuhan hidup. Namun karena dorongan ingin tetap menga-

jar, berbagi ilmu dan juga berharap adanya perhatian pengangkatan status honor menjadi Pegawai Negeri Sipil (PNS), dirinya terus bertahan dengan penuh kesabaran. Sekalipun untuk memenuhi kebutuhan hidup harus dibarengi membantu suami dengan kerja keras di sawah, ladang dan kebun milik mereka. “Selain mengajar, saya membantu suami bertani, kadang ke sawah, ke kebun untuk menderes agar kebutuhan ekonomi keluarga bisa terpenuhi,” sebutnya. Ia mengaku hanya menerima honor sekali dalam tiga bulan (per triwulan) dengan jumlah Rp450 ribu. Ketika mengarungi hutan lebat menuju tempat mengajar, Siti Mariani mengaku,

sama sekali tidak merasa takut lagi, walau harus berjalan sendiri. “Saya sudah biasa mungkin dengan lingkungan hutan ini, hanya takut hujan saja. Dan terkadang akibat hujan saya jadi sering terlambat,” ucapnya sambil menjelaskan untuk menempuh sekolah dibutuhkan waktu satu hingga 1,5 jam. Di hadapan Sekda Tapsel Aswin Siregar yang kebetulan berada di lokasi ketika perbincangan awak koran ini dengannya, Siti Mariani juga berseloroh dengan harapan agar ada perhatian pemerintah terhadap guru seperti dirinya. “Kalau bisa ada kejelasanlah Pak,” ucapnya. (***)

dengan menyerahkan barang bukti berupa sebilah parangyangtelahberlumuranberdarah. Tersangka M Manik mengutarakan, dirinya menuding Ukuk Tinambunan mengguna-gunai ayahnya Rikwan Manik hingga meninggal empat hari lalu. Hal ini dikuatkan karena sebelumnya TinambunanterlibatcekcokdenganRikwanManik. Setelah percekcokan itu, ayah tersangka terbaring sakit. Sejakitu,MManikmenaruhdendamkepada Ukuk Tinambunan yang masih berikatan saudara dengannya. Pada hari naas itu, tersangka yang sedang berada diladangnyamelihatkorbanberjalanmenujuladang cabainya. Kebetulan, lokasi ladang keduanya berdekatan.Melihat Tinambunan, seketika Manik emosi. Tersangka lalu mengambil parangnya dan menyerangkorbandaribelakang. Sabetan parang tersangka mengenai kepala korban.SeketikaitujugaUkukTinambunanroboh. Namun bacokan tersebut bukan membuat tersangka berhenti. Manik langsung menarik leher Tinambunanlalumenggoroknya.Korbanpuntewas bersimbahdarah. WakapolresPakpakBharatKompolSupriatmono ketika dikonfirmasi melalui telepon selulernya, kemarin(5/4)membenarkanadanyapembunuhan tersebut.(buyung/pmg)

Dahlan Iskan Pastikan Penuhi Undangan DPR Sambungan Halaman 1 DPR yang menjadi mitra kerja BUMN tersebut. “Kalaupun ada halangan karena tidak bisa datang pasti sudah disepakati terlebih dahulu,” ujarnya. Dahlan Iskan juga mengatakan siap untuk membicarakan masalah apapun yang terkait dengan BUMN bersama-sama mitra kerjanya di Komisi VI. (int)



6 April 2013



„ A Siringoringo, korban penggelapan sepedamotor.

SIANTAR- Naas dialami A Siringoringo (30), warga Jalan DI Panjaitan, Siantar Selatan. Dia terpaksa mendatangi Polres Siantar guna membuat laporan penggelapan. Sebab kabarnya, sepedamotor Honda Revo (lupa plat BK) digelapkan oleh tukang gadai, Jumat (5/4) sekira pukul 11.00 WIB. Ceritanya, selama ini, Revo itu sering dipakai kakaknya I br Siringoringo. Beberapa waktu juga Revo pernah digadai dengan uang sebesar Rp3 juta. Setelah lunas, si kakak kembali menggadaikan kepada orang lain dengan nilai Rp1,5 juta. Begitu korban ingin menebus, ternyata penggadai sudah kabur. Setelah ditunggu beberapa hari, pelaku tak kunjung timbul di kampung. “Aku tidak kenal sama siapa kreta itu digadaikan kakakku Bang. Tapi yang pasti, kreta sudah tidak kelihatan lagi. Dugaanku


SIMALUNGUN– Polisi berhasil membongkar sindikat pencurian sepedamotor (curanmor) di wilayah Simalungun. Sebanyak empat tersangka dan lima kreta diamankan.


DIAMANKAN- 4 tersangka pencurian sepedamotor berikut dengan 5 unit kreta curian diamankan di Mapolres Simalungun, Jumat (5/4).

Pura-pura Tanya Tempat Kos

„) Baca Kreta ... ...Hal 7

Siswa SMK Curi HP TNI

Tabrakan di Perdagangan

3 Warga BDB Luka-luka PERDAGANGAN- Jonathan Matias Lalay (27), Kevin Lalay (2) dan Mariani boru Panjaitan (49), ketiganya warga BDB Lorong 20, Kelurahan Siopat Suhu, Keca-

SIANTAR- BG (19), siswa SMK swasta di Kota Pematangsiantar, nekat mencuri handphone (Hp) milik oknum TNI. Ceritanya, Jumat (5/4), sepulang sekolah, BG mengajak HM mencari tempat kost baru. Selama ini, BG ngekos di Jalan Bali. Kebetulan HM juga berencana pindah dari tempat kost lamanya di Lorong I, BDB. Alasannya klise, HM ingin bebas. Sebab banyak kegiatan ekstrakulikuler yang ditekuninya sehingga dia tidak bisa pulang tepat waktu. Keduanya pun pergi ke Lorong 22.

matan Siantar Timur, mengalami luka akibat tabrakan di jalan umum Perdagangan Bandar Pulo Km 3,4 Nagori Bahlias, Kamis (4/4) malam sekira pukul 21.30 WIB. Keterangan dihimpun, malam itu, Jonathan berboncengan dengan sau„) Baca 3 Warga ... ...Hal 7

„ BG, tersangka pencuri Hp milik TNI

Foto Susilawady

„ Dua tersangka jurtul togel masing – masing Indra Syahputra Guci dan Riki Rizki Hasibuan berikut barang bukti yang berhasil diamankan saat berada di Mapolsek Pulo Raja,

Dua Jurtul Togel Ditangkap ASAHAN- Indra Syafutra Guci (39) dan Riki Rizki Hasibuan (28), warga Dusun III Desa Ledong Timur, Kecamatan Aek Ledong ditangkap personil Polsek Pulo Raja saat transaksi angka togel melalui handpone, Sabtu (30/3) lalu pukul 22.00 WIB. Dari tangan kedua tersang-

ka, personil mengamankan barang bukti berupa 5 handphone, 1 lembar kertas rekap, 3 buah pulpen serta uang tunai Rp4,5 juta. Kapolsek Pulo Raja AKP SM Sitanggang saat dikonfirmasi melalui Kanit Reskrim Ipda H

„) Baca Dua ... ...Hal 7


Tiba di Lorong 22, warga menginfokan bahwa ada warga yang menerima anak kos. Lalu, keduanya bergegas dan menanyakan langsung tarif kos. Sementara Serka L Sinaga (46), bertugas di Kodim 0207/Simalungun, sedang asyik menyusun beberapa pot bunga. Sore itu, sekira pukul 14.30 WIB, korban menaruh handphone-nya bersama satu gelas air putih di atas kursi teras. Selesai menyusun pot bunga,

„) Baca Siswa SMK ... ...Hal 7

„ Paulus Edi Susanto, sempat membuat onar di rumah sakit.

„) Baca 4 TSK ...Hal 7

Operasi Palm

3 Pencuri Diamankan SIMALUNGUN– Da lam op era si Palm Toba 2013, sejak 1 April, Polres Simalungun telah menangani tig a ka su s pe ncurian terhadap buah kelapa sawit milik PTPN III dan IV. Ke tig a pe laku ser ta ba ran g bu kti diamankan di Polres Sim alungun. „) Baca 3 Pencuri .Ha l7

„ Nurbaiti keluar dari dalam kantor CIMB Niaga usai mengamuk.

Diduga Stres, Warga Sipahutar Mengamuk di RS Pirngadi MEDAN- Paulus Edi Susanto (25), warga Desa Siabalabal II, Sipahutar, Kabupaten Tapanuli Utara, mengamuk di ruang terpadu E RSUD dr Pirngadi, Medan, Jumat (5/4). Aksi Paulus itu membuat pasien lain ketakutan dan berhamburan lari keluar ruangan. Paulus memecahkan kaca jendela ruangan yang bersebelahan dengan tempat pasien rawat inap. Informasi

Keempat tersangka yakni Yusuf Sinaga (41), warga Jalan Baja Purba, Kecamatan Siantar, Sandu Syaputra Lubis (22), warga Jalan Naga Huta, Nagori Bosar, Kecamatan Panomban Pane. Kemudian Isban (19), warga Kecamatan Sei Suka, Kabupaten Batu Bara, selaku penadah dan yang terakhir Rijal Lubis (26), warga Jalan Diponegoro, Pematangsiantar. “Tiga pelaku ini diringkus pada Pebruari dan Maret lalu. Kecuali Rijal Lubis, ditangkap tiga hari lalu dari rumahnya,” ungkap Kasat Reskrim AKP Roni

di rumah sakit plat merah ini, Paulus sedang dalam masa perawatan di ruang 18 karena mengidap penyakit paru sejak enam hari lalu. Diduga stres, tiba-tiba dia berlari ke ruang E terpadu dan membolak-balikkan meja serta tempat tidur yang ada di situ. Tak hanya itu, seperti kesurupan,

„) Baca Diduga ... ...Hal 7

Kijang Innova Ditarik Debt Colektor

Nasabah CIMB Niaga Mangamuk RANTAU-Nurbaiti Siregar (48), warga Jalan Sisingamangaraja Kecamatan Rantau Selatan mengamuk di kantor leasing CIMB Niaga di Jalan Ahmad Yani Rantauprapat, Jumat (5/4). Pasalnya, pihak perusahaan menolak menerima angsuran pembayaran mobil Kijang Innova BK 1238 JE yang tertunggak selama enam bulan. Kepada METRO, Nurbaiti mengatakan,

„) Baca Nasabah ... ...Hal 7


6 April 2013

Jeritan Hati Ibu Bayi Penderita DBD

“Tolong Bantu Anakku” BOSAR MALIGAS–Seorang ibu rumah tangga, Murni (28) warga Kelurahan Pasar Baru Kecamatan Bosar Maligas, Simalungun membutuhkan uluran tangan dermawan dan pemerintah. Pasalnya, dia tidak memiliki uang untuk biaya berobat anaknya Butet boru Tarigan berusia dua bulan yang menderita demam berdarah dangue (DBD).


„ Bayi malang penderita DBD yang dirawat di RS Tiara. Ibu bayi Murni, membutuhkan uluran tangan dermawan dan pemerintah untuk biaya berobat anaknya yang sakit.

Lampu Jalan Padam

Raya Rawan Kriminal RAYA-Warga Kecamatan Raya mendesak Perusahaan Listrik Negara (PLN) menghidupkan seluruh lampu jalan di Kota Raya dan sekitarnya, termasuk di kompleks kantor satuan kerja perangkat aderah (SKPD) Kabupaten Simalungun. Pasalnya, padamnya lampu jalan beberapa bulan terakhir, mengakibatkan warga was-was terjadi tindakan kriminal dengan memanfaatkan situasi gelap. “Sebelum adanya pemadaman oleh PLN, jalan-jalan di Raya terang benderang. Aktivis warga di malam hari, termasuk menjelang pagi ketika warga berolahraga di jalan,” kata Daswinson Saragih SE, tokoh masyarakat Kecamatan Raya, Kamis (4/4). Dijelaskan Daswinson Saragih, Raya sebagai Ibukota Kabupaten sudah seharusnya memberikan rasa nyaman kepada warga dan pengunjung, baik siang maupun malam hari. “Segeralah dinyalakan kembali, karena kewajiban

‹ ‹ Baca Raya ...Hal 10

„ Pdt T Gultom Sth, guru-guru jemaat dan Hernando Sinaga AMd memberikan bantuan kepada korban kebakaran, Rabu (3/4).

HKI Resort Hutabayuraja

Bantu Korban Kebakaran HUTABAYU- HKI Resort Hutabayuraja, merasa terpanggil untuk membantu korban kebakaran di Dusun Simangonai, Nagori Jawa Baru, Hutabayu Raja. Anna Ria boru Sirait adalah pemilik rumah

yang terbakar, Kamis (21/3) lalu. Kebakaran yang terjadi pukul 15.00 WIB itu, meratakan rumah korban dengan tanah.

‹ ‹ Baca Bantu ...Hal 10

“Tolonglah saya dibantu. Saya tidak punya uang dan tidak punya apa-apa untuk dijual buat biaya perobatan anakku yang menderita DBB,” ujar Murni lirih sambil menitikkan air mata melihaat anaknya ketika dijumpai METRO di ruang ICU Rumah Sakit Tiara Siantar, Jumat (5/4) (F:METRO/RANO)

‹ ‹ Baca “Tolong Bantu ...Hal 10


Warga Antre Dapatkan Air

Eks Kantor Pajak Telantar

SIDAMANIK–Pompa air penyedia pasokan air untuk warga Simantin, Kecamatan Sidamanik rusak. Akibatnya, warga harus rela antrean panjang untuk mendapatkan pasokan air bersih dari salah satu sumur bor milik seorang warga. Pantauan METRO, Rabu (3/4) pukul 17.00 WIB kemarin, walau gerimis tidak menyurutkan semangat warga untuk mendapatkan pasokan air bersih untuk keluarga. Puluhan warga yang membawa jeregen dan ember terlihat bersabar antre. Warga yang membawa jeregen didominasi kaum laki-laki sedangkan ember

‹ ‹ Baca Warga ...Hal 10

„ Faawoza Zebua menujukkan bong kaca di ruangan eks Kantor dan Perumahan Perpajakan.

Puntung Rokok dan Bong Kaca Berserak


„ Warga Simantin antre untuk dapatkan air bersih, Rabu (3/4).

SIANTAR – Eks Kantor dan perumahan Perpajakan di Jalan Bane, Kelurahan Bane, Siantar Utara telantar tidak terawat. Tempat ini sepertinya sengaja dijadikan orang tak bertanggungjawab melakukan hal-hal negatif. Pantauan METRO, di sekitar kantor dan perumahan rum-

put-rumput sudah tinggi dan sampah yang berserak. Di dalam gedung terlihat sampah seperti puntung rokok, plastik klip, pipa kaca (bong), kondom yang mengindikasi gedung telantar dijadikan untuk hal negatif.

‹ ‹ Baca Puntung...Hal 10


6 April 2013

“Tolong Bantu Anakku” Sambungan Halaman 9


„ Terlihat bangunan kios-kios yang diduga liar bertdiri di atas saluran irigasi dan memakan trotoar jalan.

Kios Liar Marak di Atas Irigasi SIMALUNGUN- Saat ini banyak bangunan kios-kios yang diduga liar karena tidak punyai izin mendirikan bangunan (IMB) berdiri di atas saluran irigasi di Jalan Akasia Raya, Perumnas Batu VI, Nagori Sitalasari Kecamatan Siantar. Kios-kios yang diduga liar ini dan kerap dijadikan sebagai tempat ngumpul anak-anak muda sekitar, telah merusak keindahan dan menambah kesan kumuh di daerah itu. Karenanya, warga sekitar mulai banyak yang keberatan akan keberadaan kios-kios tersebut. Pantauan METRO, Jumat (5/4) bangunan kios-kios yang dibangun di atas saluran irigasi dan diduga liar ini sepertinya sudah berdiri beberapa tahun lalu. Pemilik kios kerap kali terlihat membuang sampah ke saluran irigasi di bawah kiosnya yang mengakibatkan tersumbatnya aliran irigasi. Walau warga banyak yang protes dengan keberadaan bangunan kios-kios tersebut, namun mereka tidak berani protes secara langsung ke pemilik kios, dengan alasan takut dianggap iri. Tapi, warga sudah beberapa kali melaporkan hal tersebut ke Pangulu Sitalasari dan belum ada tindakan. Menurut warga sekitar kios yang tidak ingin disebutkan namanya, kios-kios didirikan di atas irigasi dan memakai trotoar menimbulkan kemacetan terutama saat usia jam belajar. “Selain membuat macet, jalan ini terlihat kumuh, apalagi kalau saat terik matahari, jadi semakin gersang kampung ini,” terangnya wanita berkaca mata tersebut. Perumnas Batu VI merupakan sebuah kota di Kecamatan Siantar, dan sudah seharusnya ditata, dan kemungkinan besar kios-kios itu tidak memiliki izin yang resmi. Sementara itu Pangulu Sitalasari, Celestinus Damanik ketika di ditemui METRO mengatakan, pihaknya sudah beberapa kali menyurati pihak kecamatan untuk menata kios-kios tersebut dan sampai saat ini belum ada realisasi. “Kami tidak bisa secara langsung mengeksekusi kios-kios tersebut, karena ada prosedurnya. Kebanyakan warga yang mendirikan bangunan itu adalah warga Nagori Nusa Harapan. Walau demikian, saya tidak mempermasalahkan hal tersebut,” terangnya. Terpisah, Camat Siantar, Samepta Pasaribu ketika dihubungi METRO melalui selularnya membenarkan atas surat yang dikirimkan pihak pangulu Sitalasari. Katanya, pihaknya akan memanggil kedua pangulu untuk membicarakan hal tersebut. “Dalam waktu dekat ini akan kami panggil Pangulu Sitalasari dan Nusa Harapan karena kios-kios berada di perbatasan antara keduanya. Kami akan membicarakan mengenai kebaraan bangunan kios-kios tersebut,” ucapnya. (Mag-10/mer)

Diceritakannya, penyakit DBD mulai menyerang bayi malang ini sejak Selasa (2/4) lalu. Saat itu, Murni terkejut sangat pilu melihat anaknya selalu menangis meskipun sudah diberi makan. Khawatir dengan kondisi putrinya tersebut, ibu muda ini langsung mengecek kesehatan anaknya di klinik Pandu Perdagangan. Di sana diketahui, putrinya menderita penyakit DBD dan mulai menyebar. Akhirnya dokter yang memeriksanya di klinik tersebut menyarankannya agar bayi ini dirujuk ke RS Vita Insani Kota Pematangsiantar. Dengan uang yang pas-pasan, Murni membawa putrinya ke RS Vita Insani. Selama satu malam dirawat di sana, kondisi kesehatan bayinya tak kunjung sembuh dan uang dikantungnyapun sudah minim. Akhirnya bayi malang itu kembali dirujuk ke RS Tiara Siantar, karena kondisi ruangan ICU di RS Vita

Insani sudah penuh. ”Bagaimanalah bang. Saya tidak punya uang dan sejak pagi saya belum makan. Adapun sedikit uang saya hanya untuk keperluan berobat anak saya ini. Sejak tadi malam Bapak Tua saya sudah pergi ke sana ke mari mencari pinjaman uang untuk biaya berobat anak saya,” ujar tersedu-sedu. Dijelasakan Murni, suaminya pergi merantau ke Pekan Baru dan sejak enam bulan lalu tidak pernah lagi mengirimkan uang. Saat ini ibu muda ini hanya mengandalkan bantuan biaya dari keluarganya yang juga hidup paspasan. ”Saya sangat mengharakan uluran tangan dari dermawan dan Dari Pemkab Simalungun. Tolonglah dibantu biaya perobatan anakku yang menderita DBD ini, karena kondisi putri sayapun kelihatannya semakin tidak sehat saja. Saya tidak punya uang dan hidup keluargakupun pas-pasan.

Tolonglah saya,” harapnya dengan lirih. Terpisah, Kepala Puskesmas Bosar Maligas Dr Darlianti ketika dihubungi METRO, Jumat (5/4) mengaku kecewa dengan sikap ibu bayi ini yang tidak melaporkan kondisi anaknya ke Puskesmas Bosar Maligas. Menurutnya, pihak Klinik Pandu Perdagangan yang sudah mengecek positif DBD pada anak ini harusnya juga berkordinasi dengan Puskesmas Bosar Maligas untuk mengambil tindakan cepat. ”Seperti inilah yang kami kesalkan. Seharusnya ibu Murni tanggap dong. Jangan dirujuk ke klinik tanpa izin kami, karena penyakit DBD inikan bisa menyebar dan harus segera ditanggulangi dengan segera,” ujarnya. Saat ini, pihaknya menyarankan agar keluarga yang kesulitan biaya rumah sakit segera merujuk anaknya ke RSUD Siantar untuk mendapatkan pelayanan Jamkesda (Jaminan Kesehatan Daerah).

“Kami bersedia membantu segala urusannya,” ujar Dr Darlianti. Namun, Dr Delianti berjanji, Besok, Sabtu (6/4) dia akan kordinasikan dengan pegawainya untuk terjun ke lokasi.“Saya dan anggota akan turun ke perumahan warga untuk nencek semua rumah warga. Jika dimungkinkan, kami akan lakukan fogging untuk mencegah DBD lanjutan bagi anak-anak lain,” ujarnya. Dijelaskannya, penyakit DBD ini umumnya berkembang biak dari nyamuk yang membawa virus. Kemudian, langkah yang akan diambil pihaknya untuk awal yaitu melakukan aksi 3 M meliputi menguras tempat penampungan air, menutup bak air dan mengubur barang bekas. Dan jika langkah ini tidak dapat diatasi maka pihaknya akan melakukan fogging yaitu menyemprotkan asap anti nyamuk ke perumahan warga yang diyakini menjadi penyebaran DBD. (bli/mer)

Puntung Rokok dan Bong Kaca Berserak Sambungan Halaman 9 Rumput di luar gedung sudah mencapai ketinggian sekitar satu meter yang membuat eks gedung kantor pajak itu tertutup. Pagar dan gerbang gedung juga sudah rusak. Selain itu, pintu ke tiga ruangan terlepas dan rusak, kaca nako ruangan terlihat pecah. Rumput yang tinggi dapat menjadi sarang ular dan binatang berbisa lainnya hingga membayakan warga sekitar Ketua LPM Bane Faawoza Zebua, Jumat (5/4) pukul 14.00 WIB saat berada di Kantor Lurah Bane yang posisinya tepat berada di depan eks gedung perpajakan mengatakan, pihak

Sambungan Halaman 9

kelurahan sudah pernah melayangkan surat kepada Kantor Perpajakan agar gedung itu dirawat dan dipergunakan kembali atau di pinjam pakaikan. “Pihak kelurahan dan LPM Bane sudah pernah mengajukan permohonan agar gedung itu dipinjam pakaikan kepada kami. Pasalnya, keberadaan Kantor Lurah Bane sudah tidak mampu lagim menampung banyak anak didik Pendidikan Anak Usia Dini (PAUD) yang belajat,” katanya. Akibat kantor lurah terlalu kecil, renacana kelurahan dan LPM adalah menggunakan eks Kantor Perpajakan itu menjadi tempat belajar anak-anak PAUD. “Kantor perpajakan harusnya

tidak membiarkan gedung itu telantar. Kami siap menyewa atau meminjamnya untuk jadi lokasi PAUD,” ujarnya. Saat METRO dan Faawoza Zebua memasuki gedung kosong itu, ditemukan banyak sampah yang berserakan di luar dan dalam gedung. “Puntung rokok, pipa kaca, plastik klip, bong kaca, lelehan lilin dan juga kondom ditemukan di dalam gedung ini. Artinya, gedung ini sudah menghawatirkan warga sekitar karena diduga menjadi tempat-tempat melakukan hal-hal negatif,” ujarnya. Dikatakan Faawoza Zebua, ketika pihaknya bersama LPM mengajukan permohonan, pihak kantor pajak

mengatakan, harus berkoordinasi dulu dengan Kantor Pajak Pusat. Sayangnya, jawabannya sampai sekarang tak kunjung terealisasi. “Yang penting bagi warga, kehadiran gedung itu jangan menimbulkan masalah bagi warga sekitar khususnya masyarakat Kelurahan Bane,” ujarnya. Salah seorang staff Kantor Pajak Siantar Chrisdedy Hutabarat ketika dikonfirmasi melalui telepon mengatakan, akan menyampaikan masalah perawatan gedung itu ke kantor pusat. “Saya tidak bisa pastikan kapan gedung itu akan digunakan dan direhab. Untuk masalah aset adalah tanggungjawab kantor pusat,” ujarnya. (mag-05/mer)


umumnya dibawa ibu-ibu. Pemilik sumur bor A br Limbong mengatakan, kerusakan pompa air yang disediakan pemerintah membuat warga kesulitan mendapatkan air bersih. Kerusakan pompa air sudah berlangsung sejak 3 hari lalu. “Jika sudah sore, maka warga akan antre untuk mendapatkan air. Satu

jeregen harga air bersih sebesar Rp250,” ujar wanita paruh baya tersebut sambil mengisi jeregen warga. Seorang wrga Simantin Rinto Sitio (34) yang menunggu antrean agar jeregennya diisi mengatakan, di daerah mereka air bersih dari PDAM Tirtalihou belum masuk ke dalam rumah warga. Yang ada hanya sumur bor yang disediakan pemerintah. “Warga sangat berharap agar

pemerintah segera dapat mamasang pipa PDAM Tirtaulihou ke rumahrumah warga. Jika pipa rusak seperti ini, maka warga harus rela antre mendapatkan air. Di samping antre, warga juga harus membayar Rp250 per jeregen,” ujarnya. Sedangkan salah seorang ibu S Situmorang (36) mengatakan petugas sudah berjanji akan memperbaiki segera pompa air tersebut namun

hingga saat ini belum juga diperbaiki. “Untuk ke depan, pemerintah sudah dapat memasukkan PDAM Tirtalihou ke rumah-rumah warga. Air adalah salahsatu kebutuhan pokok masnuaia yang tidak bisa tergantikan. Jika beras tidak ada, mungkin masih bisa memakan ubi atau yang lain. Tapi kalau tidak ada air bersih maka manusia tidak bisa hidup,” ujar wanita paruh baya itu. (mag-05/mer)

Raya Rawan Kriminal

Sambungan Halaman 9 pelanggan setiap bulan tetap dijalankan termasuk pembayaran PPJ sebesar 10 persen dari biaya rekening listrik per bulan,” katanya. Hal senada disampaikan Roy Saragih. Warga Jalan Kartini, Kelurahan Raya ini berharap dalam waktu dekat lampu jalan di Raya sekitarnya dinyalakan, sehingga aktivitas warga pada malam

hari tidak terganggu oleh rasa khawatir. Sementara Menejer PLN Cabang Sidamanik Ferdinan Damanik ketika dikonfirmasi terkait lampu jalan yang padam di sebagian wilayah Kecamatan Raya mengatakan, soal penangan lampu jalan telah diserahkan pengelolaannya kepada Pemkab Simalungun melalui Dinas Pertambangan dan Energi. “Silakan konfirmasi ke Tamben Sima-

lungun saja,” kata Ferdinan Damanik. Sementara Kepala Dinas Pertambangan dan Energi Kabupaten Simalungun Raja Sianipar mengatakan, seluruh lampu jalan di Kecamatan Raya dalam waktu dekat akan segera dinyalakan. Disebutkan Raja Sianipar, pihaknya bersama PLN sedang menunggu pemindahan tiang milik PLN dalam rangka pelebaran jalan di Raya.

“Mungkin Minggu depan semua akan dihidupkan, kita menunggu pemindahan tiang PLN,” katanya. Dijelaskan Raja Sianipar, pihak PLN memutuskan sambungan lampu jalan karena terkendalanya pembayaran dari Pemkab Simalungun. “Kami dengar masalah pembayaran sudah tuntas, lampu jalan akan dinyalakan setelah tiang PLN di pindah,” katanya. (esa/mer)

Bantu Korban Kebakaran

Sambungan Halaman 9

Dalam musibah kebakaran rumah milik Anna Ria boru Sirait yang juga Guru Huria HKI Simangonai Jawa Baru itu, tidak ada korban jiwa. Di mana, di dalam rumah itu ada Anna Ria br Sirai bersama anaknya Lambok Sinaga dan istrinya br Simanjuntak. Pemberian bantuan tali asih oleh HKI Resort Hutabayu, yang disampaikan majelis Resort melalui Pdt T Gultom Sth, guru-guru jemaat, salah salah satu di antaranya GR Aruan sekalu Sekretaris Resort dan R Sianturi selaku Bendahara Resort. Bantuan diberikan, Rabu (3/4) di depan rumah yang hangus terbakar itu. Bantuan tersebut berupa uang yang dikumpulkan dari jemaat untuk membantu korban mengurangi beban dalam membeli keperluan sehari-hari. Selain itu Ketua PA (Punguan Ama) HKI Daerah 1 Sumatera Timur 1, Hernando Sinaga Amd, juga memberikan bantuan dana dan semen sebanyak 20 sak. Dalam menyampaikan bantuan tersebut, Hernando Sinaga AMd mengatakan, pemberian bantuan itu sebagai bentuk kepedulian kepada sesama masyarakat yang terkena musibah. “Kami juga merasakan yang Ibu rasakan. Musibah ini adalah cobaan. Kami berharap ibu

Dp. 40 Jtan Angs 3Jtan

jangan larut dalam kesedihan, hidup harus terus berjalan. Mudah-mudahan rejeki akan melimpah,” ujar Bacaleg dari Partai Demokrat itu. Dia menambahkan, bantuan dan tersebut untuk mengurangi beban korban kebakaran untuk memenuhi kebutuhan sehari-hari. Sementara itu, bantuan semen yang diberikan Hernando Sinaga itu, untuk membantu Ibu Anna Ria br Sirait membangun kembali rumahnya yang terbakar. “Saya sebagai masyarakat merasa terpanggil untuk membantu. Selagi kita bisa membantu, akan kita Bantu. Sebab, kami juga merasakan apa yang dirasakan Ibu Anna boru Sirait,” kata Ketua PAC Partai Demokrat Hutabayuraja tersebut. Hernando Sinaga juga mengimbau, agar masyarakat setempat juga peduli dengan menyumbangkan tenaga untuk membantu korban kebakaran itu. “Bisa melalui tenaga, misalnya membantu mengangkati barang-barang kalau Ibu Anna boru Sirait nantinya membangun rumah. Bisa juga menjaga agar bahan-bahan bangunannya kelak tidak diambil orang,” katanya mengajak masyarakat untuk saling bergotong-royong membantu sesama yang terkena musibah. (leo)

*) Syarat & ketentuan berlaku

Dapatkan Segera.... *) DP + Angsuran & Harga Super Murah Setiap Pembelian Sepeda Motor Honda Cash/Credit di

CV. APOLLO MOTOR hanya di CV. APOLLO MOTOR, Jl.Tanah Jawa No. 98-100 P. Siantar, Tel. 0622-22882 Sensasi Goyang Siantar





** Menyuguhkan lagu-lagu Dangdut dan Daerah **

On-Air : 05.30 - 18.00 : Lagu Dangdut & India On-Air : 18.00 - 24.00 : Lagu Daerah

Kantor & Studio : Jl. A Yani No. 2-4 Pematangsiantar Sumut Telp Kantor : 0622 - 75 500 55 Fax: 7550968 Telp Studio : 0622 - 7551799; SMS 0821 6356 3000

Website : Email :

didukung oleh :


6 April 2013

BlackBerry 10 R-Series Dilego Rp2 Jutaan? JAKARTA - BlackBerry telah memperkenalkan dua model smartphone yang berjalan pada sistem operasi Kabarnya, perusahaan juga akan meluncurkan model entry-level dari perangkat berjalan dari platform anyar itu. Dari gambar yang tersingkap melalui situs daring BlackBerryOS, perusahaan asal Kanada itu akan memperkenalkan model baru dari smartphone yang mengusung fitur keyboard QWERTY. Tak seperti BlackBerry Q10 yang dirancang untuk memenuhi dahaga konsumen kelas atas, Meski dipatok dengan harga

yang jauh lebih murah, namun S-Seris tetap memiliki fitur yang sama dengan perangkat BlackBerry 10 terdahulu, Jumat (5/4). Kabarnya, R-Series akan dikemas dengan memori internal 8GB yang dapat diperluas dengan microSD dan diperkuat dengan RAM yang lebih kecil dari BlackBerry Q10. Dan pastinya, smartphone ini mengusung fitur keyboard fisik QWERTY. BlackBerry R-Series juga akan dilego pada di kisaran harga USD300-USD400. Keluarga baru BlackBerry dengan platform baru ini juga dilengkapi dengan baterai berkapasitas 1800mAh. (oz/nik)

Setelah Diimpor

Harga Bawang Merah Turun Rp30 Ribu per Kg JAKARTA- Kementerian Perdagangan sudah resmi mendatangkan 60 ribu ton bawang merah impor. Importasi ini dilakukan untuk menekan tingginya harga bawang merah saat ini. (INT)


enteri Perdagangan Gita Wirjawan meya kini, dengan membanjirnya bawang merah impor di pasaran, maka harga bawang merah akan terkoreksi hingga Rp 10 ribu/kg. ”Untuk sementara kita masih yakin bahwa akan datangnya banyak posokan untuk bawang merah dalam beberapa bulan ke depan datang yaitu 60 ribu ton. Itu sangat cukup untuk menurunkan harga dari Rp 40 ribu ke Rp 10-15 ribu,” ungkap Gita usai Rakor Pangan di kantor Kemen-

terian Menko Perekonomian, Jalan Lapangan Banteng, Jakarta, Jumat (5/4). Sampai saat ini, menurut Gita, baru 90 kontainer isi bawang merah impor yang datang, dari 2.000 kontainer total secara keseluruhan. ”Hari ini tiba 90 kontainer lebih dan dalam beberapa bulan ini akan datang lagi dari 2.000 kontainer. Dengan kedatangan pasokan itu tidak ada alasan bawang merah untuk tidak turun lagi,” cetusnya. (oz/nik)

TURUN-Harga bawang mengalami penurunan Rp30 ribu perkilogramnya setelah pemerintah mengimpor barang seberat 60 ribu ton.

Bulog Bakal Tambah Pasokan Beras Bulan Depan JAKARTA – Menteri Koordinator Perekonomian Hatta Rajasa mengatakan, kebutuhan stok bahan-bahan pokok tidak dalam posisi kekurangan. Khusus untuk beras, Bulog pun siap menambah stoknya. ”Secara kebutuhan, stok bahan-bahan pokok kita cukup, dan sumbangan kepada sektor hortikultura cukup tinggi,” ujar Hatta, di kantornya, Jakarta, Jumat (5/4). Hatta mengatakan, Bulog

„ BlackBerry 10 R-Series

Dahlan Luncurkan Mobil Listrik Aneka Tipe menyebutkan siapa mereka, namun dalam waktu dekat mobil tersebut akan diluncurkan. ”Mobil listrik sekarang 3 tim lagi kerja keras. Banyak, nanti pada saatnya,” katanya di Jalan Bontang, Jakarta Pusat, Jumat (5/4). Dahlan mengatakan, sekitar 2-3 bulan mendatang dirinya akan meluncurkan mobil listrik terbarunya itu. Tak hanya satu, janjinya, dia akan mengeluar-

„ Ilustrasi

Bisnis Tas dari Batik Menguntungkan

3 Bulan Lagi

JAKARTA-Menteri Badan Usaha Milik Negara (BUMN) Dahlan Iskan belum menyerah soal mobil listrik made in Indonesia. Setelah sempat menjajal Tucuxi si ‘Ferarri’ listrik, kini ia berencana akan meluncurkan produk terbarunya, salah satunya bernama Selo. Dikatakan Mantan Bos PLN ini, saat ini rencananya tersebut sedang dikaji dan dikerjakan oleh 3 tim ahli. Dia tak

akan melakukan penambahan pasokan beras pada bulan depan. “Stok ini akan meningkat dan harga akan turun,” ujarnya. Sedangkan untuk kedelai, lanjut Hatta, Bulog diminta mengatur stabilitas kedelai. “Kedelai akan diberikan kepada Bulog untuk memberikan stabilisasi, peraturan presiden akan dirampungkan, tidak beras saja tapi kedelai,” ujar Hatta. (oz/nik)

kan beberapa model mobil listriknya yang baru. ”Dua-tiga bulan lah. Meluncurkan dan banyak, banyak jenisnya banyak unitnya, banyak jenisnya,” jelasnya. Sayangnya, Dahlan enggan merinci lebih jauh mengenai rencana peluncuran mobl listri barunya itu. Ia mengaku, pada saatnya nanti akan ia beberkan semuanya.”Nanti lah,” singkatnya. (oz/nik)

BISNIS pakaian, alas kaki, tas dari berbahan dasar batik, songket, tenun dan berbagai motif sangat menguntungkan. Hal ini diakui Nina, (35) Warga Jalan Rawasari Barat. Ia mengaku membangun bisnisnya dengan membuat Raiya Butik sejak tahun 2009. Menurutnya, Raiya Butik berawal dari menjual produknya ke teman-temannya. ”Lalu saya mikir kayaknya sayang kalau cuma kain aja. Dan saya mikir bukan baju karena baju udah banyak banget, akhirnya saya mikir tas batik dan alas kaki,” kata Nina Mulai dari saat itu, tepatnya akhir 2010, Nina memberanikan diri untuk membuat produk tas dan alas kaki yang berbahan dasar kain khas Indonesia seperti jumputan, batik, songket dan jenis kain lainnya. Pada saat itu, Nina mengangkat 2 orang pekerja yang bertugas masing-masing sebagai pembuat tas dan sepatu. Mendapatkan respons yang baik dari para konsumen, akhirnya usaha Nina berkembang hingga saat ini. ”Karyawan saya asalnya 2, yang bikin tas dan sepatunya. Sekarang Alhamdulillah terakhir untuk tas itu 5 orang, sepatu 3 orang, kemudian untuk operasional dan marketing itu 2 orang. Jadi total itu 10 orang,” paparnya. Dalam sehari butik Raiya yang

diadopsi dari nama ketiga anak Nina ini dapat memproduksi hingga 100 tas dan 100 sepatu. Harganya bervariatif, tergantung dari bahan yang digunakan. Untuk 1 tas yang terbuat dari kain batik atau kain lainnya, dan dikombinasikan dengan kulit genuine (ular, domba, sapi) dihargai Rp 600.000-1.500.000. Sedangkan yang dikombinasikan dengan kulit imitasi atau sintetis dihargai Rp 350.000-500.000. Untuk sepasang sepatu berlabel Raiya, Nina mematok harga Rp250.000-550.000, tergantung model dan bahan yang digunakan. Nina mengaku, produknya ini memiliki keunggulan yang mungkin produk lain tidak akan punya. Pasalnya, bahan baku yaitu kain yang didapat Nina adalah klain yang bersifat “limited edition”, yang diketahui seperti contoh sebuah kain batik tulis yang hanya dibuat 1 lembar di Indonesia. Pemesan pun diberi penawaran menarik, yaitu bebas memilih menggunakan kain apa dan modelnya. ”Karena custom itu juga bisa jadi one of a kind (unik). Misalnya kalau batik tulis itu aja, itu kan cuma satu atau dua gitu. Nah ketika menjelma menjadi tas atau sepatu, itu bisa menjadi satu-satunya mungkin. Kalau batik saya nggak mau yang printing, tapi yang cap. Kalau tenun juga yang pakai tangan,” jelas-

nya. Pemasaran yang dilakukan Nina masih banyak bertumpu pada pemasaran online, melalui website, facebook, twitter atau jejaring sosial lainnya. Sayangnya, Nina belum berniat untuk diajak atau mengajak investor lain untuk mengembangkan bisnisnya meskipun usahanya ini memiliki potensi yang sangat besar, dengan alasan masih ingin berbisnis menggunakan modal sendiri. Pasarnya pun tersebar luas, para konsumen yang membeli produknya bukan hanya dari kalangan dalam negeri saja tapi mancanegara. ”Saya kalau ekspor skala besar itu belum. Konsumen ada yang dari Amerika, Hungaria, Korea, Singapura, India, China, Maroko. Beli perorangan, karena web atau twitter,” katanya. Omset yang didapat Nina dari usaha yang telah ia geluti selama 2 tahun ini mencapai Rp 50 juta/bulan. Dari situ, dia mengambil keuntungan bersih hanya 30% atau sekitar Rp 15 juta. Dia mengaku, tak mengambil keuntungan banyak dari produk yang dijualnya. Namun, ada pesan yang sangat mendalam dari orientasi bisnisnya ini. ”Orientasi saya bukan mengambil keuntungan, tapi membuka lapangan pekerjaan. Nambah terus. Jadi kalau kayaknya orang nanam modal saya

takut orientasi saya nggak kesitu lagi. Saya sebenarnya pengen lebih banyak misi sosialnya, karena saya rasa yang namanya uang itu akan mengikuti ya. Kalau keuntungan pribadi sih ada lah kecil-kecilan,” kata Nina. Oleh karena itu, Nina mengaku indikator paling nyata dari perkembangan bisnisnya ini adalah dengan bertambahnya tenaga kerja yang awalnya hanya 2 orang, kini menjadi 10 orang yang terdiri dari 9 orang lakilaki dan 1 wanita. ”Saya ingin menambah orang, tapi saya tetap akan mengandalkan modal sendiri,” katanya. Sebenarnya apa yang membuat seorang psikolog berusia 35 tahun ini terjun ke bisnis tanpa mengesampingkan pekerjaannya? Selain atas dasar ingin membuka lapangan pekerjaan dan melestarikan budaya khas tanah air, Nina mengaku sejak kecil dan semasa remaja, dia memang hobi untuk berjualan, dan pandai melihat peluang. ”Kalau dari kecil saya sudah apa saja saya jualin. Saya SMP saya jual stiker. Ada kenikmatan pribadi kalau bisa menjual sesuatu. Kalau jaman kuliah saya kerjasama sama tukang fotokopi,” tutupnya. Ingin tahu lebih lanjut mengenai produk Raiya Butik? Anda bisa datang ke showroom Raiya di Jalan Rawasari Barat I No 5A, Cempaka Putih Timur, Jakarta Pusat.(oz/nik)


MOBIL LISTRIK-Rencana Dahlan Iskan akan meluncurkan mobil listrik Tucuxi Ferarri made in Indonesia.

Kementan Tangani Produksi Sapi JAKARTA-Menteri Koordinator Bidang Perekonomian Hatta Rajasa memastikan tidak ada lagi distorsi atau tumpang tindih kewenangan antara Kementerian Perdagangan (Kemendag) dengan Kementerian Pertanian (Kementan) soal kebijakan tata niaga dan impor daging. Kementan hanya akan fokus pada produksi daging dan sapi, sementara Kemendag fokus pada ekspor dan impor. “Sehingga dengan demikian tidak terjadi policy yang membuat distorsinya situasi di pasar. Oleh sebab itu diperbaiki. baik hal yang berkaitan dengan daging,” ungkap Hatta di kantorn-

ya, Lapangan Banteng, Jumat (5/4) Ia mengatakan, pemerintah juga menerapkan sistem satu atap terkait impor daging dengan poros yang berada di Kemendag. Namun, Hatta menambahkan Kementan tetap akan memberikan rekomendasi untuk memastikan kebutuhan dan pasokan. ”Rekomendasi inilah yang selama ini menjadi distorsi, maka dari itu disederhanakan,” cetusnya. Menurutnya, persoalan akan selesai jika ada data yang benar akurat. “Yang penting pendataan dan pencatatan supply and demand akurat. Sepanjang

data yang akurat, kita bisa menghitung berapa kekuatan dalam negeri, kita bisa melindungi peternak kita,” jelas Hatta. Dengan itu, lanjutnya harga daging dalam waktu dekat akan diturunkan, yaitu dengan meminta perusahaan pemegang kuota daging agar segera realisasikan dalam waktu dekat. ”Realisasi impor yang sudah mereka berikan masih belum memadai. Oleh sebab itu mendag (menteri perdagangan) akan memanggil seluruhnya itu dan meminta agar mereka segera realisasi, sebab kalau tidak harga akan tetap tinggi karena suplainya kurang,” pungkasnya. (dtc/nik)


BAHAN BATIK- Aneka tas berbahan dasar batik, songket, tenun yang produksi Maharsi Anindyajati. Berlabel Raiya harga jual hanya Rp 250 ribu per buah.


SABTU, 06 APRIL 2013


Smart Computer Jln. Merdeka No 80 ( 0622-7072808 Fax.0622-7346080 E_mail :


LOWONGAN KERJA PT. Prudential Agency membuka lowongan kerja untuk menjadi Agen Asuransi Prudential. Tidak terikat waktu (Free Lance), dan hanya bagi orang yang ingin sukses dan ingin berpenghasilan uang besar. Dengan syarat: • Pria/Wanita usia 20 - 45 thn, punya KTP dan masih berlaku. • Mempunyai relasi yang luas • Bersedia mengikuti ujianAAJI, Anda akan mendapatkan: • Komisi selama 5 thn per nasabah • Bonus Tambahan Rp.1 juta • Jalan jalan Gratis kedalam/Luar negeri • Jenjang karir yang bergengsi

Segera hub. 0812

6354 0888

Prudential Manager



Telah Hilang Surat Tanah An. Johan Pardede, Lokasi tanah di Dsn Sipalaka Pardomuan Nauli Pematang Bandar Simalungun. Tercecer disekitar Jl. Imam Bonjol, pada bulan Desember 2012. Bagi yang menemukan, harap dikembalikan dengan meng-hubungi HP. 0812 6340 5609 Tidak akan dituntut tapi diberi hadiah yang sepantasnya

1 (satu) ASLI Sertifikat Hak Pakai No. 0098/Bantan. Terdaftar An. Siti Aisyah. Tercecer pada hari Rabu tanggal 03 April 2013 di sekitar jalan Sutomo. Bagi yang menemukan agar dapat mengembalikan dengan menghubungi RUDI DAMANIK, Jl. Pelindung No. 16 P. Siantar. Tidak akan dituntut, tapi akan diberikan imbalan sepantasnya



6 April 2013



(21 Desember -19 Januari)

Karier: Kalau memungkinkan, selesaikan pekerjaan yang tertunda. Asmara: Harus lebih percaya sama dia, bukan sama temanny


(20 Januari - 18 Februari)

Karier: Tim kerja membutuhkan seseorang yang bisa menjadi perencana yang baik. Asmara: Cinta tidak bisa dipaksakan.


19 Februari - 20 Maret

Karier: Jangan terlalu membayangkan hal-hal sempurna. Asmara: Salah satu rencana bersama dia akan terlaksana.


(21 Maret - 20 April)

Karier: Jangan habiskan hari-hari hanya untuk memikirkan pekerjaan. Bisa jenuh. Asmara: Aman-aman saja.


(21 April - 20 Mei)


(21 Mei - 20 Juni)

Karier: Mainkan kartu dengan tepat, kamu pasti bisa maju. Asmara: Cinta mulai merasuki hidup Anda.

Karier: Awas stres karena sedang tak ada kesibukan atau pekerjaan. Lakukan sesuatu. Asmara: Yang namanya hubungan cinta memang tidak selalu mulus.


(21 Juni- 20 Juli)

Karier: Gunakan sejumlah pemikiran rasional. Hadapi hari esok dengan tenang dan percaya diri. Asmara: Semakin lengket.


(21 Juli-21 Agustus)

Karier: Anda tidak mempunyai rencana yang baik dalam menjalani pekerjaan. Sikap ini membuat Anda cepat merasa bosan. Segeralah susun rencana dan target.


(23 September - 22 Oktober)

Karier: Bakal ketemu orang yang akan mengubah hidup kamu. Tetapi semua butuh proses. Asmara: Jangan kecewakan si dia.


(23 Agustus-22 September)

.Karier: Akan ada keberuntungan di kantor Anda Asmara: Bagaimanapun juga hati Anda masih untuk si dia.


(23 Oktober – 22 November)

Karier: Curahkan kreativitas Anda. Percaya diri sajalah. Asmara: Anda diminta si dia untuk bersabar.


( 23 November - 20 Desember)

Karier: Jangan menumpuk pekerjaan, jika memang bisa Anda selesaikan hari ini. Asmara: Makin akrab, makin asyik.

PASUKAN khusus kepolisian (SWAT) Los Angeles menyerbu rumah Rihanna, Kamis (4/4) malam. Langkah tersebut dilakukan setelah seorang pria tak dikenal menghubungi hotline darurat 911. Disebutkan pemilik hit "Umbrella" itu dalam bahaya besar. Dua pria bersenjata berhasil memaksa masuk rumah serta seorang diantaranya berulangkali melepas tembakan. Kepolsiain dan pasukan SWAT dengan kendaraan lapis baja langsung diturunkan. Hasilnya, dua orang bersenjata tadi ternyata tak ada. Rihanna yang dalam laporan per telepon disebut berada dalam rumah, malah baru muncul beberapa jam setelah penyergapan berlangsung. Pejabat kepolisian Los Angeles (LAPD) khawatir kasus serupa akan terus berlangsung. Laporan palsu yang memaksa SWAT turun atau biasa disebut SWATED ini, dikhawatirkan meminta korban orang tak bersalah. Bisa saja kepolisian menembak penghuni rumah sendiri yang kesal rumahnya diserbu pihak berwajib. Belum lagi properti rumah rusak akibat penyerbuan polisi yang terpaksa harus menerobos. Swated kini seperti jadi epidemi yang sulit diberantas kepolisian Ameika Serikat. Selebriti lain seperti Justin Bieber, Clint Eastwood, Miley Cyrus, dan Tom Cruise sempat jadi korban. Kasus ini sempat membuat seorang bocah berumur 12 tahun ditahan karena diduga membuat laporan palsu lewat 911. (jpnn)

ATIQAH Hasiholan belum menentukan bagaimana konsep pernikahannya bersama sang kekasih, Rio Dewanto. Namun, ia ingin pernikahannya nanti berlangsung sederhana, intim, dan indah. "Yang pasti sederhana, kan dasarnya simpel, aku mau kelihatan elegan tapi juga simpel. Simpel yang elegan," ucapnya ditemui di Hotel Ritz Carlton, Pacific Place, Jakarta. Namun, wanita kelahiran Jakarta, 3 Januari 1982 itu, masih merahasiakan jadwal pernikahannya. Ia berkilah tanggal pernikahannya memang belum ditentukan. Makanya, ia belum bisa membeberkan. "Kan saya sudah lamaran ya, terus kalau tanggalnya ada berita di bulan Agustus, tapi sebenarnya kami belum tahu tanggalnya kapan. Yang jelas, karena sudah lamaran pasti tujuannya ke sana," ucapnya. Pokoknya, lanjut dia, secepat mungkin. Tapi, pernikahan itu nampaknya tidak akan dilangsungkan Agustus 2013. Mengingat kesibukannya yang padat. Demikian pula Rio. "Yang pasti setelah Agustus, karena kan ya kesibukan masing-masing," ucapnya. Setelah Lebaran? "Insya Allah," tandasnya. (tr/int)


AKTRIS dan bintang sinetron Risty Tagor mulai mengurangi aktivitasnya di depan layar kaca sejak memiliki anak, Arsen Raffa Balweel yang sudah menginjak dua tahun. "Semua kegiatanku bisa di-manage dan suami syuting sinetron, jadi quality time saat bangun tidur, ngurus sarapan dia dan diatur sedemikian rupa dan cari nyamannya. Karena aku nggak mau ninggalin anak kalau nggak ada suami atau keluarga," ujarnya di kawasan Kebayoran Baru, Jakarta Selatan, Jumat (5/ 4). Dengan membatasi aktivitas, bintang film Bestfriend tersebut kini

bisa lebih memaksimalkan waktu bersama anak semata wayangnya. "Kami lebih sering kumpul bareng-bareng kalau Rifky libur kami berenang. Kalau ada event ultah kami usahain ngumpul dan biasanya keluarga besar aku juga akhir minggu selalu kumpul," papar dara berusia 23 tahun tersebut. Risty pun menikmati menjadi ibu muda dengan satu anak. Namun, belum ingin tambah anak. "Kalau di mulut sih, pingin, tapi di hati Allah tahu yang terbaik dan anak aku masih butuh banyak didampingi," tuturnya. (idc/int)

15 14


6 April 2013

Bukan Hari TERBAIK Pedrosa

Jorge Lorenzo mengawali kiprahnya di MotoGP Qatar dengan baik. Pebalap andalan Yamaha itu mencatat waktu tercepat dalam sesi latihan bebas pertama, di depan Cal Crutchlow dan Valentino Rossi. LORENZO, Crutchlow, dan Rossi bersaing ketat dalam sesi di Sirkuit Losail. Namun, Lorenzo-lah yang akhirnya sukses mengukir waktu tercepat dengan catatan 1 menit 56,685 detik. Crutchlow harus puas menempati posisi kedua. Pebalap Yamaha Tech 3 itu membukukan waktu 1 menit 56,743 detik atau berselisih 0,058 detik dari catatan waktu Lorenzo. 1. Jorge Lorenzo 2. Cal Crutchlow 3. Valentino Rossi 4. Marc Marquez 5. Andrea Dovizioso 6. Alvaro Bautista Gresini 7. Stefan Bradl LCR 8. Dani Pedrosa 9. Aleix Espargaro 10. Nicky Hayden 11. Bradley Smith 12. Andrea Iannone Pramac 13. Ben Spies Pramac 14. Hector Barbera Avintia 15. Randy de Puniet 16. Karel Abraham Cardion 17. Colin Edwards Forward 18. Yonny Hernandez PBM 19. Hiroshi Aoyama Avintia 20. Claudio Corti Forward 21. Danilo Petrucci 22. Bryan Staring Gresini 23. Lukas Pesek 24. Michael Laverty

Rossi yang kembali bernaung di bawah bendera Yamaha juga terlihat sangat kompetitif. Catatan waktunya 1 menit 56,756 detik. Posisi keempat jadi milik pebalap debutan yang membela Repsol Honda, Marc Marquez. Andrea Dovizioso juga meraih hasil cukup bagus bersama Ducati dengan duduk di urutan kelima. Dani Pedrosa hanya menduduki posisi kedelapan,

di belakang Alvaro Bautista dan Stefan Bradl. Aleix Espargaro dan Nicky Hayden melengkapi posisi sepuluh besar. (int)

Hasil Free Practice I MotoGP Qatar Yamaha 1m56.685s Tech 3 Yamaha 1m56.743s + 0.058s Yamaha 1m56.756s + 0.071s Honda 1m57.276s + 0.591s Ducati 1m57.538s + 0.853s Honda 1m57.601s + 0.916s Honda 1m57.670s + 0.985s Honda 1m57.749s + 1.064s Aspar Aprilia 1m57.843s + 1.158s Ducati 1m57.926s + 1.241s Tech 3 Yamaha 1m58.369s + 1.684s Ducati 1m58.559s + 1.874s Ducati 1m58.575s + 1.890s FTR-Kawasaki 1m59.608s + 2.923s Aspar Aprilia 1m59.633s + 2.948s Aprilia 1m59.758s + 3.073s FTR-Kawasaki 2m00.341s + 3.656s Aprilia 2m00.426s + 3.741s FTR-Kawasaki 2m00.563s + 3.878s FTR-Kawasaki 2m01.227s + 4.542s Ioda-Suter-BMW 2m01.438s + 4.753s FTR-Honda 2m01.942s + 5.257s Ioda-Suter-BMW 2m02.079s + 5.394s PBM-Aprilia 2m02.135s + 5.450s

DANI PEDROSA secara mengejutkan hanya mampu finis kedelapan pada free practice atau sesi latihan bebas perdana MotoGP Qatar. Pembalap Repsol Honda itu mengaku, ”Ini bukan hari saya.” Penampilan mengecewakan diperlihatkan Pedrosa. Pebalap yang sedang dalam kondisi terbaik selama tes itu hanya mampu mencatat waktu 1 menit 57.749 detik. Pedrosa tertinggal jauh 1.064 detik dari Jorge Lorenzo yang menjadi pembalap tercepat. Motor pebalap yang tahun lalu menjadi runner up itu ternyata harus melebar sebanyak dua kali dalam tes itu. Pedrosa mengatakan motornya memiliki masalah saat hendak memasuki tikungan di Sirkuit Losail. “Hari ini bukan terbaik buat kami. Kami tidak mampu mengendarai motor dengan baik karena saya memiliki sedikit masalah saat hendak memasuki tikungan,” jelas pebalap asal Spanyol itu, diberitakan Crash. Dalam sesi pembuka itu, Pedrosa memang terlihat tidak mampu bersaing dengan motor tim Yamaha yang mendominasi pada sesi ini. Selain Lorenzo, pembalap Yamaha Tech 3, Cal Crutchlow juga mampu menempati peringkat kedua dan Valentino Rossi

ada di posisi ketiga. “Itu yang membuat kami tidak mampu mencat atkan waktu terbaik. Kami berharap semua membaik pada sesi besok dan kami bisa mencatatkan waktu lebih baik lagi,” tandasnya. (int)


SABTU 6 April 2013



Bursa METRO WBA ½ : 0 Arsenal Prediksi Skor WBA 1-2 Arsenal

DUO pemain Arsenal Theo Walcott dan Jack Wilshere tengah menepi karena bekapan cedera. Keduanya diprediksi absen saat Arsenal melawat ke kandang West Bromwich Albion (WBA), dan mungkin kembali bermain mulai pekan depan.


ilshere kembali menda patkan cedera pada 12 Maret lalu. Dia diprediksi membutuhkan waktu selama tiga pekan untuk menyembuhkan cedera pergelangan kaki yang membekapnya. Belum juga Wilshere pulih, satu

„ Walcott dan Wilshere

Chelsea 3-1 Rubin Kazan


Ketajaman El Nino DUA gol yang diciptakan Fernando Torres ke gawang Rubin Kazan membuat manajer interim Chelsea, Rafa Benitez, puas. Benitez pun berharap Torres bisa mencetak gol lagi di laga selanjutnya. Torres tampil cemerlang saat Chelsea menjamu Rubin di leg pertama perempatfinal Liga Europa, Jumat (5/4) dinihari. El Nino mencetak dua gol dan membantu The Blues menang dengan skor 3-1. Dengan tambahan dua gol itu, Torres sudah mencetak 19 gol dalam 52 laga di semua kompetisi musim ini. “Ini bagus untuk kepercayaan dirinya. Tapi, kinerjanya di lapangan juga sangat bagus. Jadi, saya sangat senang dengannya,” aku Benitez yang dikutip BBC. Saat ini Torres tak mendapatkan jaminan sebagai starter di lini depan Chelsea. Striker asal Spanyol itu harus menghadapi persaingan dengan Demba Ba. “Dia berlatih dengan sangat baik setiap hari, jadi ini cuma masalah waktu saja. Dia mencetak dua gol hari ini dan semoga akan begitu lagi di pertandingan berikutnya,” kata Benitez. Harusnya Menang Besar Skor 3-1 yang didapat The Blues tak lantas memuaskan Rafael Benitez yang merasa skuatnya layak unggul lebih besar. Di Stamford Bridge, Jumat (5/4) dinihari, dua gol kemenangan Chelsea dibuat Fernando Torres sementara satu lainnya dilesakkan oleh Victor Moses. Gol balasan tim tamu datang dari eksekusi penalti Bebars Natcho. Meski meraih kemenangan, Rafael Benitez tak sepenuhnya puas dengan hasil tersebut. Chelsea disebutnya bisa tampil lebih baik lagi dan mencetak keunggulan dengan skor lebih besar. “Itu bisa saja lebih baik lagi, tapi saya tak bisa mengubah keadaannya sekarang. Penalti itu keputusan yang keras, tapi Anda tak bisa mengubah keputusan itu, jadi Anda harus melanjutkannya dan mencetak gol ketiga. Kami berhasil me-

„ Torres lakukannya (mencetak gol ketiga) tapi saya mengharapkan gol keempat,” sahut Rafa usai pertandingan seperti diberitakan BBC. Kecolongan satu gol saat bermain di kandang bisa jadi membahayakan peluang Chelsea lolos. Di leg kedua yang dilangsungkan pekan depan, Chelsea bakal terdepak andai wakil Rusia itu bisa menang 2-0. Namun Rafa yakin dengan kemampuan timnya yang punya banyak pemain top dunia. “Akan lebih sulit (di leg kedua) karena mereka akan bermain menyerang dan menyerang, tapi kami punya kualitas di tim kami,” lanjut pelatih berkebangsaan Spanyol itu. Jalan Pertandingan Percobaan Ramires pada menit ke-11 tak terlalu membahayakan gawang Rubin. Sepakan kerasnya dari luar kotak

kabar kurang menggembirakan didapat oleh Arsenal. Walcott mengalami cedera kunci paha usai memenuhi panggilan membela Inggris di kualifikasi Piala Dunia. Terkait kondisi Walcott dan Wilshere, asisten manajer ‘Gu-

dang Peluru’, Steve Bould, menyampaikan kabar positif. Dia mengungkapkan bahwa kedua pemain itu diprediksi bakal comeback pekan depan. “Kami mempunyai kabar bagus terkait keduanya,” ungkap Bould seperti dilansir situs resmi Arsenal. “Jack (Wilshere) dan Theo (Walcott) sudah bisa berlari di luar latihan tim dan memiliki peluang untuk bisa masuk dalam pertandingan melawan Norwich (City) pada hari Sabtu pekan depan,” tambahnya. (int)

penalti masih melambung tinggi. Lima menit kemudian, Chelsea membuka skor. Umpan panjang David Luiz dari tengah lapangan diterima Torres yang berlari di kotak penalti. Meski dikawal satu bek lawan, Torres masih bisa menceploskan bola ke dalam gawang melewati hadangan kiper Sergei Ryzhikov. Rubin hampir saja menyamakan kedudukan pada menit ke-20. Tendangan Natcho dari luar kotak penalti melaju deras ke gawang Chelsea, tapi Petr Cech mampu mementahkannya. Tim tuan rumah menggandakan keunggulannya pada menit ke-32. Moses yang mendapatkan bola liar di kotak penalti Rubin melepaskan tendangan voli yang tak bisa diantisipasi Ryzhikov. Berselang delapan menit, Rubin mendapatkan hadiah penalti menyusul handball John Terry di area terlarang. Natcho maju sebagai eksekutor dan sukses mengelabui Cech. Chelsea 2, Rubin 1. Rubin nyaris menyamakan skor pada menit ke-45. Sial buat mereka, sepakan keras Cristian Ansaldi masih melenceng tipis. Empat menit setelah babak kedua dimulai, Juan Mata punya kesempatan untuk mencetak gol. Namun, tendangannya bisa digagalkan Ryzhikov. Peluang yang didapat Terry pada menit ke-60 juga tak mengubah keadaan. Sundulannya meneruskan sebuah sepak pojok masih melambung. Beberapa saat kemudian, gawang Chelsea diancam Salomon Rondon. Tapi, tembakan Rondon dari depan kotak penalti bisa diamankan Cech. Memasuki menit ke-70, Torres kembali mencatatkan namanya di papan skor. Diawali umpan silang Mata dari sisi kiri, dia mengalahkan Ansaldi dalam duel udara dan menanduk bola ke dalam gawang. Ramires menjajal peruntungannya lagi pada menit ke-90 lewat tendangan voli dari luar kotak penalti. Tapi, arah bola masih melebar. (int)

- Arsenal berhasil menaklukkan West Bromwich Albion 2-0 pada pertemuan pertama kedua tim musim ini di Emirates Stadium, berkat dua penalti Mikel Arteta. Ini adalah kemenangan ketiga Arsenal atas West Brom secara beruntun. Arsenal juga berhasil mengalahkan West Brom 3-2 pada pertemuan terakhir kedua tim di Hawthorns musim lalu. West Brom belum pernah lagi mengalahkan Arsenal di Hawthorns sejak Oktober 2005. - West Brom belum beranjak dari peringkat-8 klasemen dengan 44 poin dari 31 pertandingan, terpaut sembilan poin dari Arsenal di zona Eropa. West Brom menyerah 1-3 dari West Ham akhir pekan lalu, dan harus rela kehilangan gelandang

Youssouf Mulumbu yang mendapat kartu merah. - Performa West Brom sedang tidak konsisten, hanya mampu meraih tiga kemenangan dari 12 laga terakhirnya di Premier League dan menelan tujuh kekalahan. - West Brom juga selalu kebobolan dari enam laga kandang terakhirnya di Premier League, dengan tiga kemenangan dan menelan dua kekalahan. Sebanyak 26 dari total 41 kebobolan West Brom tercipta di babak kedua. - Striker West Brom Romelu Lukaku adalah topskor klub dengan 13 gol. - Arsenal belum beranjak dari peringkat-5 klasemen dengan 53 poin dari 30 laga, terpaut hanya dua poin

dari zona Champions. Arsenal berhasil membantai Reading 4-1 akhir pekan lalu di Emirates Stadium. - Arsenal hanya kalah sekali dari delapan laga terakhirnya di Premier League, meraih enam kemenangan dan sekali imbang. Performa tandang Arsenal di Premier League sejauh ini adalah enam kemenangan, lima imbang, dan empat kekalahan. - Arsenal tidak pernah gagal mencetak gol pada sembilan laga terakhirnya di Premier League. Arsenal juga tidak pernah gagal mencetak gol pada delapan laga tandang terakhirnya. - Gelandang Arsenal Santi Cazorla adalah topskor klub dengan 12 gol. Sebanyak 36 dari total 59 gol Arsenal tercipta di babak kedua

Musim Bale Terancam Habis LONDON- Gareth Bale terkapar di atas lapangan dan mengerang kesakitan sebelum ditandu keluar lapangan. Terpelintir di bagian pergelangan kaki, Tottenham Hotspur terancam ditinggal pemainnya itu sampai akhir musim. Sempat tertinggal dua gol, Tottenham Hotspur akhirnya bermain imbang 2-2 saat menjamu FC Basel di leg pertama babak delapan besar Liga Europa. Kubu Spurs jelas tak puas dengan hasil tersebut, namun ada hal lain yang membuat mereka masih merasakan kegetiran terkait kondisi Gareth Bale. Saat pertandingan memasuki periode injury time babak kedua, Bale terjatuh dalam posisi yang tidak sempurna usai berebut bola dengan pemain Basel. Tayangan ulang memperlihatkan pergelangan kaki pemain Wales itu seperti

terpelintir. Kondisi tersebut membuat dia dikhawatirkan mengalami cedera parah di pergelangan kaki dan bisa menyebabkan dirinya absen hingga musim ini tuntas. Bale langsung terkapar di atas rumput usai momen tersebut. Dia terlihat mengerang kesakitan dan langsung dihampiri tim medis The Lillywhites. Pesepakbola yang telah mencetak 22 gol di sepanjang musim 2012/2013 itu kemudian ditandu keluar lapangan. AbsennyaBaleakanjadipukulan buat Spurs di sisa musim ini. Selain akan ditunggu laga sengit pada leg kedua di kandang Basel, mereka masih bertarung untuk meraih posisi empat besar demi meraih tiket Liga Champions musim depan. Newcastle Kalah Sementara itu di Stadion Da Luz, Newcastlekalah1-3melawanBen-

fica. Keunggulan yang diciptakan PapissCissedimenitke-12menjadi tidakberarti.Setelamenerimaumpan dari Moussa Sissoko, Cisse dengan mudah melepaskan sontekan kaki kanan. Keunggulan ini hanya bertahan sampai menit ke25. Rodrigo membuat tim tuan rumah menyamakan kedudukan lewat sebuah tendangan dari jarak dekat.Sebelumgolitutercipta,Tim Krul sempat memblok seranngan Oscar Cardozo. Babak pertama berakhir dengan skor 1-1. Namun, Benfica yang tampil relatif lebih dominan, dan melepaskan sebanyak 20 tembakan sepanjang laga, menambah dua gol lagi di babak kedua. Kedua gol itu diciptakan oleh Lima Dos Santos pada menit ke-65 dan penalti Cardozo di menit ke-71 — setelah Steven Taylor handball di dalam kotak penalti.(int)






25 2

3 70-31


2 Man City


18 8

4 55-26


3 Tottenham


17 6

8 53-38


4 Chelsea


16 7

7 59-32


5 Arsenal


15 8

7 59-33


6 Everton



5 47-35


7 Liverpool


13 9

9 59-40


8 West Brom


13 5



9 Swansea City 31




10 Fulham


10 9



11 West Ham


10 6



12 Southampton 31

8 10



13 Stoke City


7 13



14 Norwich City 31

7 13



15 Newcastle






16 Sunderland


7 10



17 Wigan






18 Aston Villa






19 QPR


4 11



20 Reading








24 3

2 90-33


2 Real Madrid


19 5

5 72-28


3 Atlético Madrid 29

19 4

6 51-25


4 Real Sociedad 29

13 9

7 51-37


5 Málaga


13 8

8 41-28


6 Valencia


13 7

9 42-41


7 Real Betis


13 5



8 Getafe


12 7



9 Rayo Vallecano 29

13 2



10 Levante


11 7



11 Sevilla


11 5



12 Espanyol






10 5



13 Athletic Club 29



23 3

1 78-13


2 Dortmund


15 7

5 62-32


3 Leverkusen


14 6

7 50-35


4 Schalke 04


12 6

9 46-43


5 Mainz 05


10 9

8 34-30


6 Frankfurt


11 6

9 39-37


7 Freiburg


10 9

8 35-33


8 M’gladbach


9 11

7 35-37


9 Hamburger SV 27

11 5



10 Hannover 96 27

11 4



11 Nürnberg

8 10

8 29-32



12 Stuttgart






13 Bremen






14 Wolfsburg






15 Düsseldorf






16 Augsburg






17 Hoffenheim






18 Greuther









BARCELONA akan menyambut kembalinya Tito Vilanova di bench pertandingan La Liga. Akankah sang pelatih juga membawa kembali superioritas Barca yang sempat menurun?


arca akan menghadapi Real Mallorca pada Minggu (7/4) dinihari di Camp Nou. Menghadapi peringkat 19 klasemen sementara, tentu bukan perkara yang sulit untuk Los Cules. Namun Xavi Herandez dkk patut waspada, karena statistik menunjukkan mereka selalu kebobolan dalam dua partai terakhir di liga, meski melawan tim yang di atas kertas jauh di bawahnya. Dengan cederanya Lionel Messi dan baru pulangnya mereka dari lawatan ke Paris Saint Germain, peluang lawan agak membesar. Bahkan pelatih Mallorca, Gregorio Manzano, telah menyatakan ketidakhadiran Messi sebagai berkah. Tapi kembalinya Vilanova tentu akan membuat skuad Barca lebih bergairah. Barca yang mendapatkan hasil seri dan kekalahan di dua El Clasico di liga musim ini hanya perlu menghindari terjadinya krisis dan kesalahan seperti yang terjadi beberapa saat lalu agar tidak tersusul Madrid. Meski Messi cedera, namun kehadiran Vilanova di tepi lapangan tentu memberi suntikan moral pada para pemain. Patut diingat bahwa Vilanova berhasil membawa anak-anak asuhnya menembus rekor me-

Prediksi Skor Barcelona 3-1 Mallorca Bursa METRO Barcelona 0 : 1 ½ Mallorca

raih 55 poin dari 57 di paruh pertama musim ini. Tanpa Messi Bertandang ke Camp Nou membuat pelatih-pelatih di Liga Spanyol harus berpikir keras untuk meraih hasil terbaik. Tiadanya Lionel Messi setidaknya membuat pelatih Mallorca berkurang pusingnya. Mallorca akan menjadi tamu berikutnya yang berkunjung ke Camp Nou dalam lanjutan Liga Spanyol akhir pekan ini. Meski The Catalans baru bertarung habis-habisan di Liga Champions, tuan rumah tetap dijagokan bisa meraih hasil maksimal dalam laga yang akan digelar. Sadar laga akan sangat sulit, Mallorca setidaknya dapat sedikit kabar baik karena Lionel Messi dipastikan absen. Pemain terbaik dunia itu mengalami cedera hamstring saat berlaga di Paris. Dan disebut pelatih Gregorio Manzano, ketiadaan Messi mengurangi sakit kepala yang dia rasakan jelang laga tersebut. “Sakit kepala menjadi berkurang satu. Dengan Messi absen kami tak harus menghadapi mimpi buruk sepakbola atau mencoba menghentikan pemain yang mencetak gol lebih banyak dari tim yang jumlahnya

s a y a bahkan tidak tahu di Liga Spanyol ini,” seloroh Manzano di Football Espana. “Saya tidak bermaksud mengatakan kalau tanpa Messi berarti Barcelona bisa dikalahkan, karena masalahnya bukan itu. Kondisi yang sebenarnya adalah mereka kehilangan salah satu sumber golnya, pemain yang dikatakan mampu menentukan hasil pertandingan,” lanjut Manzano. Meski tipis, peluang Mallorca meraih poin dari lawatan ke Barcelona terbuka lebar. Selain karena faktor kelelahan, The Catalans fokusnya akan terbagi ke Liga Champions karena tengah pekan depan mereka akan gantian menjamu PSG. “Ya, hal itu jelas, tapi juga sangat relatif karena mereka tak ingin mengecewakan fansnya sendiri dan mencoba meraih kemenangan di akhir pekan ini,” papar dia lagi. (int)



21 5

4 59-19


2 Napoli


17 8

5 55-29


3 Milan


17 6

7 53-32


4 Fiorentina


15 6

9 54-37


5 Internazionale 30

15 5 10 47-39


6 Lazio


15 5



7 Roma


14 5


47 45

8 Catania


13 6


9 Udinese



8 38-38


10 Parma


10 8



11 Cagliari


10 8



12 Sampdoria


10 7



13 Bologna


10 6



14 Torino


8 12



15 Chievo


10 5



16 Atalanta


10 6



17 Genoa






18 Siena






19 Palermo


4 12



20 Pescara






AGENDA METRO SABTU (6/4) 15.30 WIB :Persija 21.45 WIB :Rennes 22.00 WIB :WBA 23.45 WIB :Juventus 23.45 WIB :Real Madrid

vs vs vs vs vs

Persiram (ISL) : PSG (Ligue 1 Prancis) : Arsenal (Liga Inggris) : Pescara (Serie A Italia) : Levante (Liga Spanyol) :

MINGGU (7/4) 00.45 WIB :Montpellier 03.40 WIB :Barcelona 15.30 WIB :Persib 18.30 WIB :Fiorentina 18.45 WIB :Saint-Etienne 19.00 WIB :Mitra Kukar 21.00 WIB :Sampdoria 20.30 WIB :Liverpool 21.45 WIB :Reims 22.00 WIB :Chelsea

vs vs vs vs vs vs vs vs vs vs

Valenciennes (Ligue 1 Prancis) : B Channel (Live) Mallorca (Liga Spanyol): (Trans TV) Persiba Balikpapan (ISL) : ANTV (Live) AC Milan (Serie A Italia) : TVRI (Live) Evian TG (Ligue 1 Prancis) : B Channel (Live) Barito Putera (ISL) : ANTV (Live) Palermo (Serie A Italia) : TVRI (Live) West Ham United (Liga Inggris) :Global Tv (Live) Lyon (Ligue 1 Prancis) : B Channel (Live) Sunderland (Liga Inggris) : Global Tv (Live)

ANTV (Live) B Channel (Live) Global TV (Live) TVRI (Live) Trans TV (Live)



Manfaatkan Euforia Champion WALAU peluang untuk mengejar Barcelona dalam perebutan gelar juara La Liga 2012/2013 sulit, Real Madrid tetap mematok poin penuh saat menjamu Levante akhir pekan nanti. Euforia kemenangan atas Galatasaray di leg pertama perempatfinal Liga Champion 2012/2013, akan menjadi penyemangat bagi skuad lapis kedua Los Blancos saat laga melawan Levante. Poin penuh wajib diusung skuad asuhan Jose Mourinho ini guna menghindari kejaran Atletico Madridyanghanyaberselisih1poindariRealMadrid. Jose Mourinho diprediksi akan menurunkan pemain pelapisnya pada laga melawan Levante nanti, guna memberi kesempatan untuk beristiraht bagi para pemain inti, karena tengah pekan depan Real Madrid kembali akan bertarung melawan Galatasaray di leg kedua babak perempat final Liga Champion 2012/2013. El Real yang tertinggal 13 poin dari Barcelona akan berusaha mengamankan posisi dua sekaligus menjaga peluang menjuarai Copa Del Rey dan meraih Liga Champions ke sepuluh. Mereka harus fokus bersaing dengan Atletico di liga dan final Copa. Meskipun pertengahan pekan ini Real Madrid harus melakukan pertandingan krusial di saat berhadapan dengan Galatasaray, namun El Real memiliki skuat hebat yang berlapis-lapis. Jika pun mereka menurunkan pemain lapis kedua pada pertandingan melawan Levante, hal itu tetap membuat Real Madrid lebih diunggulkan. Levante yang menempati posisi sepuluh klasemen sementara La Liga dengan koleksi poin sebanyak 40 angka, sejauh ini masih aman dari ancaman zona degradasi. Untuk itu, mereka akan

bermain bertahan dengan mengincar hasil minimal imbang dalam pertandingan ini. Hal itu sangat logis untuk dilakukan, mengingat skuad yang dimiliki oleh Levante masih kalah jauh secara kelas dari para pemain Real Madrid. Pada pertandingan pertama kedua tim di musim ini,RealMadridsuksesmengalahkanLevantedalam laga tandang di markas Levante. Saat itu, skuat besutan Jose Mourinho menang dengan skor tipis 2-1. (int)





Sabtu, 6 April 2013



Edisi 255 „ Tahun IX

8 WNA Myanmar Tewas Dibantai MEDAN- Suasana hening di Rumah Detensi Imigrasi (Redenim) di Kelurahan Belawan, Kecamatan Medan Belawan, berubah dengan suara kegaduhan, Jumat (5/4) sekira pukul 01.30 WIB. Dini hari itu, terjadi pembantaian terhadap delapan warga Myanmar yang dilakukan puluhan warga etnis Rohingya. (foto: Agus)

„ Korban tewas warga Myanmar di Rudinem Mabar, saat berada di kamar mayat RSUD Pirngadi Medan, Jumat (5/4).

Senin, Dahlan Pastikan Penuhi Undangan DPR JAKARTA- Setelah DPR melayangkan surat ke Presiden Susilo Bambang Yudhoyono (SBY), Menteri BUMN Dahlan Iskan memastikan akan menghadiri undangan Komisi VI DPR guna membahas outsourcing tenaga kerja BUMN. “Pak Dahlan Iskan sudah memastikan akan hadir pada hari Senin (8/4) jam 15.00 WIB di Komisi VI DPR-RI,” kata Koordinator BUMN Care, Budi

Baca Senin, Dahlan....Hal 7

2 Penumpang Tewas, 8 Luka Informasi dihimpun METRO, tabrakan tersebut terjadi saat bus L300 BK 1523 GY yang dikemudikan Johan Hutapea (34), warga Laguboti,

Baca 2 Penumpang....Hal 2

Dendam Ayah Tewas Diguna-guna

„ Dahlan Iskan

SIBOLGA- Gangguan kamtibmas akan semakin tinggi jika penghasilan ekonomi para nelayan Sibolga menurun. Karena itu Kapolres Sibolga AKBP Joas F Panjaitan mengingatkan para personelnya, khususnya Satuan Intelkam, agar lebih jeli membaca situasi dan gejolak di masyarakat. “80 persen masyarakat Sibolga hidup dari bidang perikanan

Baca Sibolga....Hal 7

13 Tersangka Bentrokan Dipindahkan ke Lapas SIDIMPUAN- Enam korban penembakan saat bentrok antara warga dengan polisi, yang sebelumnya dirawat di RSUD Kota Padangsidimpuan, kini harus mendekam di Lembaga Permasyarakatan (Lapas) Salambue. Selain keenam korban, tujuh warga yang telah ditetapkan sebagai tersangka dan terlebih


SIMALUNGUN- Kecelakaan tragis terjadi di Jalan Medan, Km 8,5, Kecamatan Tapian Dolok, Simalungun, Jumat (5/4) pukul 03.45 WIB. Bus L-300 laga kambing dengan Karya Agung. Akibatnya dua penumpang Karya Agung, warga Tobasa tewas, sementara delapan penumpang kedua bus tersebut luka-luka.

Sibolga Rawan Gangguan Kamtibmas

„ AKBP Joas F Panjaitan

Baca 8 WNA....Hal 2

dahulu masuk tahanan polres, juga turut dipindahkan ke lapas. Mereka masuk Lapas Salambue, Jumat (5/4) sekira pukul 15.00 WIB. Salah seorang tersangka yang belum dipindahkan ke lapas, Akhmad Jazudi Harahap (26), dari balik jeruji besi tahanan

Baca 13 Tersangka....Hal 2

Petani Tewas Digorok Petani PAKPAK BHARAT- Ukuk Tinambunan (40) tewas dibacok dan digorok M Manik (28). Pembunuhan sadis tersebut terjadi Jumat (5/4). Informasi dihimpun dari kepolisian menyebutkan, pembunuhan tersebut terjadi di Desa Pagindar, Kecamatan Pagindar, Kabupaten Pakpak Bharat, tepatnya tak jauh dari ladangnya. Pembunuhan ini diketahui setelah

tersangka Manik mendatangi Polmas Polsek Suro Aceh Singkil usai menghabisi nyawa korban. Petugas yang mengetahui hal itu langsung menyerahkan tersangka ke Polres Pakpak Bharat, karena tempat kejadian perkaranya di Pakpak Bharat. Kepada polisi, M Manik mengakui perbuatannya dengan menyerahkan barang bukti berupa sebilah parang

yang telah berlumuran berdarah. Tersangka M Manik mengutarakan, dirinya menuding Ukuk Tinambunan mengguna-gunai ayahnya Rikwan Manik hingga meninggal empat hari lalu. Hal ini dikuatkan karena sebelumnya Tinambunan terlibat cekcok dengan Rikwan Manik. Setelah

Baca Petani Tewas....Hal 2

Senin, Film Mursala di Plaza Senayan TAPTENG- Wakil Bupati Tapteng Sukran J Tanjung mengungkapkan, gala premiere film Mursala akan digelar di Bioskop XXI Plaza Senayan, Jakarta, Senin (8/4) nanti. Sejumlah tokoh penting dan berpengaruh di Indonesia ikut diundang untuk menonton. “Tiket undangan nonton bersama gala premiere film Mursala sudah kami serahkan langsung ke sejumlah tokoh penting di Sumut hingga Jakarta. Seperti kepada Kapoldasu, Kajatisu, H Anif Shah, H Rahmad Shah dan lainnya,” sebut Sukran kepada METRO melalui telepon selulernya, Jumat (5/ 4). Sukran mengungkapkan, melalui film tersebut, potensi pariwisata

Baca Senin, Film....Hal 7


„ Jasad Gito korban kecelakaan lalulintas di Tapian Dolok saat divisum di RSUD Djasamen, Pematangsiantar, Jumat (5/4).

Panitia UN Antisipasi Serangan Fajar (foto: istimewa)

„ Wabup Tapteng Sukran J Tanjung menyerahkan tiket undangan nonton gala premiere Film Mursala kepada H Anif Shah (kiri) di Medan, kemarin.

JAKARTA- Serangan fajar tidak hanya terjadi di hari pencoblosan pemilu. Panitia ujian nasional (UN) 2013 juga mencium potensi praktik serangan fajar. Bedanya, serangan fajar UN tidak membagikan sembako atau uang, melainkan kunci jawaban kepada peserta ujian.

Baca Panitia UN....Hal 7

Kisah Guru di Desa Terpencil di Tapsel

Jalan Kaki Tembus Hutan, Honor hanya Rp150 Ribu Sebulan Tugasnya sungguh mulia untuk mencerdaskan anak bangsa. Namun perlakuan yang layak belum dirasakan pahlawan tanpa tanda jasa yang bertugas di wilayah terpencil di Tapsel ini. Apalagi imbalan yang diterimanya hanya Rp150 ribu per bulan. Padahal untuk menemui anak didiknya, ia harus berjalan kaki di tengah hutan lebat, mendaki dan menurun di jalan terjal. Sungguh penuh dengan resiko. Siapa dan bagaimana kisahnya? (foto: Amran Pohan)

„ Siti Mariani sedang melintasi hutan menjumpai anak didiknya di SDN Turunan.

Ia adalah Siti Mariani Pasaribu (27), guru honor komite di SDN Turunan, Desa Sunge Sigiringgiring, Kecamatan Saipar Dolok Hole (SDH), Kabupaten Tapanuli Selatan. Pada awak koran ini, ia menceritakan telah menjadi guru honor komite di SDN Turunan sejak 2007 lalu. Ketika itu dirinya masih gadis dan tercatat sebagai warga Kampung Turunan, Kecamatan SDH. “Saya sejak 2007 sudah mengajar di Turunan,” ucap ibu satu anak itu memulai perbincangan singkat bersama awak koran ini ketika melintasi jalan di tengah hutan (Gotting Babiat) yang kebetulan rombongan mobil Turdes Bupati Tapsel sedang mengalami mogok akibat sulit melewati jalan setelah diguyur hujan. Baca Jalan Kaki....Hal 7



6 April 2013

Senin, Dahlan Pastikan Penuhi Undangan DPR Sambungan Halaman 1 Purnomo Karjodihardjo, di Jakarta, Jumat (5/4). Budi Purnomo mengatakan, Menteri BUMN Dahlan Iskan selalu memenuhi undangan KomisiVIDPRyangmenjadimitra kerja BUMN tersebut.

“Kalaupunadahalangankarena tidak bisa datang pasti sudah disepakati terlebih dahulu,” ujarnya. Dahlan Iskan juga mengatakan siap untuk membicarakan masalah apapun yang terkait dengan BUMN bersama-sama mitra kerjanya di Komisi VI. (int)

13 Tersangka Bentrokan Dipindahkan ke Lapas Sambungan Halaman 1 Polres Tapsel menyebutkan, hanya dua orang yang masih tinggal di tahanan polres, yakni ia dan Banua Nasution(50). Kedua warga Aek Buaton ini ditahan sejak Sabtu (23/3) lalu. Sedangkan tujuh rekannya plus enam korban penembakan yang baru dipindahkan dari RSUD Psp, pada Kamis (4/4) lalu, juga sudah dibawa dengan menggunakan mobil tahanan Polres Tapsel untuk dititipkan ke lapas Salambue. “Jam tiga tadi (kemarin) mereka dibawa. Mungkin besok (hari ini) aku dan Pak Banua Nasution juga dipindahkan,” ujarnya. Saat METRO hendak bertanya lebih lanjut, seorang polisi yang sedang berjaga langsung menyuruh Jazudi kembali. “Sudah sana masuk kau!” ujarnya ketus kepada Jazudi. Ke-13 tersangka yang sudah ditahan serta dibawa ke LP Salambue adalah; Murni Siregar (57), Huala Pulungan (18), Rustam Nasution (35), Masdawiyah Daulay (50), Rayan Pulungan (62) kelimanya warga Aek Buaton, dan Amir Pulungan (52) warga Hutabargot. Sementara itu, tujuh tersangka yang telah ditahan sebelumnya; Maradoli Nasution (45), Zulmanan Nasution (30), Pembina Daulay (36), Ridwan Nasution (60), Saunan Harahap (35), Tongku Nasution (22) dan Rakhmad Pulungan (20). Kepala Pengamanan LP Salambue Maratoguan Harahap, membenarkan kepada METRO, Jumat (5/4) sekitar pukul 15.30 WIB ada 13 tahanan titipan dari Polres Tapsel. “Iya, ada 13 tahanan titipan yang terdiri dari dua wanita, dua remaja dan selebihnya pria dewasa. Dan mereka sudah kita tempatkan di sel berbeda,” jelasnya. Ka Bo Reskrim Polres Tapsel Iptu Kusnadi membenarkan telah membawa 13 tahanan tersebut ke Lapas Salambue. Mereka adalah enam korban yang baru saja dibawa dari RSUD Kota Psp dan tujuh orang yang telah ditahan sebelumnya. Dia juga menjelaskan tentang Huala Pulungan yang sempat diberitakan diberikan penangguhan penahanan, yang bersangkutan tidak diberikan penangguhan penahanan. Yang

bersangkutan tetap ditahan dan dikirim ke Lapas bersama tahanan yang lain. “Informasi semalam salah, kita bawa juga dia (Huala) ke lapas,” kata Kusnadi. Sementara itu, anggota Kompolnas Edi Hasibuan, menyayangkan penahanan keseluruhan korban penembakan, apalagi di antaranya ada perempuan. Dan, penahanan mereka dinilainya sangat tidak manusiawi. “Mereka sudah ditembak, tapi mengapa malah ditahan?” tanya Edi. Namun, sambung Edi, pihaknya memaklumi bahwa penahanan para tersangka merupakan kewenangan penyidik. “Kapolres dan Kapolda sebaiknya mempertimbangkan penangguhan penahanan untuk para tersangka yang ditembak,” ujar Edi. “Dalam waktu dekat, kami akan menyampaikan hal ini ke Kapolri. Saat ini, masih dalam tahap mempersiapkan dokumen-dokumen tentang kasus tersebut,” lanjut Edi. Sebelumnya, sekitar 200-an warga dari tiga desa; Aek Buaton, Sidondong dan Hutabargot bentrok dengan aparat Polsek Barumun Tengah, Palas, Sabtu (23/3) sekira pukul 07.00 WIB. Sembilan warga ditembak, satu di antaranya kritis dan lima polisi luka-luka. Bentrokan ini dipicu kedatangan 200 warga ke Polsek Barumun Tengah yang meminta polisi membebaskan tiga pemuda Desa Aek Buaton; Banua Nasution (50), Tongku Nasution (24) dan Julmanan (30), yang ditangkap pada Sabtu (23/3) sekira pukul 05.00. Informasi dihimpun METRO, tiga pemuda itu, ditangkap aparat Polsek Barumun Tengah (Barteng) saat berjaga di lahan sengketa antara warga Aek Buaton, Sidondong dan Hutabargot, dengan salah seorang warga Desa Sayur Matua, Harapan Harahap. Mendengar kabar tiga temannya ditangkap, sekira pukul 07.00 WIB, secara spontan sekitar 200 warga dari tiga desa yang memang berdekatan ini berkumpul di Desa Aek Buaton. Tidak lama kemudian, sebagian besar warga yang menaiki sepedamotor dan sebagian kecil angkutan umum ini, bersamasama menuju Polsek Barteng, yang berjarak sekitar 10 kilometer dari Aek Buaton. (mag-01)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 443/2004/02/A/2012 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wakil Pimpinan Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Maranatha Tobing Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Darwin Purba Daniel Simanjuntak Vincent Wijaya

2 Penumpang Tewas, 8 Luka Sambungan Halaman 1 Tobasa, melaju dari arah Medan menuju Pematangsiantar. Bus tersebut rencananya akan berhenti di Tarutung, Taput. Bus yang dikemudikan Johan mengangkut surat kabar harian terbitan Medan. Selain mengangkut koran, dia juga membawa empat penumpang, yakni Adi SaputraSimatupang(49)wargaJalanPercut, Medan, Tiurma br Siagian (46) warga Jalan TB Simatupang, Medan, Karne br Nainggolan (77) warga Jalan Narumambing Siraituruk, Kecamatan Porsea, Tobasa, dan supir batangan L-300 bernama Frans yang melarikan diri setelah kejadian. Sementara dari arah berlawanan, melaju bus Karya Agung BK 7655 TL yang dikemudikan Saut Manurung (36), warga Dolok Nauli, Kecamatan Porsea, Tobasa. Bus yang dikemudikan Saut mengangkut enampenumpang,yaituGitoMarpaung(77) warga Jalan Sitorang Jahe, Toba Samosir, Sondang Marpaung (65) warga Lumban Lintong Porsea, Toba Samosir, Jinggar Marpaung (39) warga Toba Samosir, MangiranMarpaung(45),MittonMarpaung (45), warga Toba Samosir dan Nursalam

Napitupulu (58) warga Toba Samosir. Menurut warga sekitar, saat itu kedua bus melaju dengan kecepatan tinggi. Diduga supirL-300mengantuksaatmengemudikan mobildanmengambiljalurterlaluketengah. Karena melaju kencang, bus Karya Agung tak sempat mengelakkan bus yang ada di depannya, hingga tabrakan dengan posisi laga kambing tak terhindarkan. Selanjutnya, kedua mobil bergeser melintang di jalan. Warga setempat selanjutnya berhamburan dan membantu menggeser posisi mobil dari tengah jalan, sementara sebagian wargamenghubungipolisidansebagianlagi memberikan pertolongan kepada penumpang yang terluka. Saat dievakuasi, salah seorang penumpang bus Karya Agung bernama Gito Marpaung dinyatakan tewas di lokasi kejadian, sementara seluruh korban lainnya dibawa ke Rumah Sakit Mina Padi, Sinaksak, Kecamatan Tapian Dolok. Namun setelah sampai di IGD RS Mina Padi, seorang penumpang lagi bus Karya Agung, Sondang Marpaung yang mengalami luka serius di seluruh tubuh dan kepalanya tidak dapat terselamatkan. Dia menghembuskan nafas terakhir di ruang

IGD RS Mina Padi. Sementara, seluruh penumpang di dua bus tersebut tampak mengalami luka dan menjalani perawatan di rumah sakit tersebut. Johan Hutapea, pengemudi bus L-300 ketika ditemui METRO mengatakan, bus tersebut sebelumnya dikemudikan Frans. Karena lelah, Frans memintanya untuk mengemudikan mobil. Tepat di Timbangan Dolok Melangir, Simalungun, Johan yang sebelumnya tidur langsung mengambil alih kemudi. “Sebelumnya aku sudah nolak karena capek dan ngantuk Bang. Tapi kawan itu tetap saja ngotot minta gantian nyetir. Waktu tabrakan, aku tidak sadar karena masih mengantuk dan tiba-tiba mobil sudah ringsek akibat tabrakan. Selain itu laju mobil juga tidak ingat kencang atau pelan. Setelah kejadian aku keluar dari dalam mobil dan tergeletak di pinggir jalan. Begitu sadar, polisi sudah datang,” katanya di RS Mina Padi. Masih kata Johan, dia kenal dengan Frans saat di Medan. Tetapi keduanya tidak terlalu akrabkarenaFransseringkeluarkota.Selama ini dia jarang ikut dengan Frans untuk

mengantarkoran,tetapikarenainginpulang kampung ke Laguboti, Tobasa, dia berniat menumpang. “Aku sama dia belum terlalu dekat Bang. Karenadiaterussibukbekerja,akuikutsama dia karena aku ada janji sama lae (saudara ipar, red) ku Bang. Kami rencananya mau jumpa karena ada urusan keluarga, tapi belum juga sampai aku sudah kayak gini,” tambahnya. Sementara, keluarga korban tewas yang mendapat kabar duka tersebut langsung datangkerumahsakit.Kemudianmembawa jenazah ke rumah duka di Toba Samosir untuk disemayamkan. Korban lainnya terus mendapatkan perawatan intensif. Ada juga beberapa korban yang sudah pulang dan meminta pindah ke rumah sakit lain. Kapos Lantas Dolok Melangir Aiptu E Simanjorang, ketika dikonfirmasi mengatakan, kecelakaan bus L-300 kontrak bus Karya Agung sudah mereka tangani. Begitu juga dengan para korban sudah dievakuasi ke rumah sakit terdekat. Untuk pemeriksaan selanjutnya, pihaknya akan memeriksa Johan Hutapea selaku pengemudi L-300. (mag-10/ eko)

8 WNA Myanmar Tewas Dibantai Sambungan Halaman 1 Data dihimpun POSMETRO MEDAN (grup METRO), peristiwa berdarah itu terjadi dipicu dendamlama.Dimanasejakduabulanterakhir pengungsi etnis Rohingya tidak terima dengan perilaku delapan orang warga Myanmar yang kerap mengganggu, bahkan melakukan pelecehan seksual terhadap keluarga mereka. Persoalan yang sudah berulang kali dilakukan warga Myanmar yang sama-sama ditahan di Rudemin. Dalam beberapa hari, warga etnis Rohingya telah menyimpan rasa dendam dan saling memengaruhi satu sama lain dengan menunjukkan tragedi pembantaian keluarga mereka yang tewas mengenaskan di Myanmar. Dari itu, mereka menyusun rencana untuk melakukan pembantaian secara massal. Tengah malam itu, para pengungsi Rohingya yang umumnya berada di lantai satu, menuju lantai dua membantai delapan warga Myanmar. Dengan luapan dendam dicampur emosi, puluhan etnis Rohingya membawa kursi terbuat dari kayu menuju ke lantai dua, membuat sejumlah penghuni Rudenim lainnya terkejut. Etnis Rohingya langsung mematikan lampu dan memukuli dengan kursi kayu para korban yang saat itu sedang tidur di lantai. Suarakeributanpembantaian,denganjeritan histerisyangdihajardenganbendatumpulyang ada di lantai dua. Pembantaian sadis ini juga menjadi tontonan para penghuni asing dari negara lain yang hanya mampu diam menyaksikan kejadian itu. Pegawai Redenim yang mendengar suara keributan,langsungmenujukamartersebutdan mencoba masuk untuk melakukan pengamanan. Namun karena pintu kamar dikunci dari dalam, para petugas kesulitan masuk. “Waktu kejadian itu saya mendengar suara ribut, suara teriakan, tapi tak ada minta tolong. Saya menduga ada yang mau kabur. Tapi pintu dikunci dari dalam dan saya diancam jangan masukkarenaadayangmaukabur. Kalau saya masuk nanti dibunuh mereka. Ternyata tak lama berselang, saya dengar ada keributan, ada yang mati. Saya langsung melapor ke Polres Pelabuhan Belawan,” kata

pegawai Rudenim Riko Thomas. Setelah pembantai berlangsung, suasana mencekam menyelimuti lokasi Rudenim. Para penghuni lainnya berdiam diri di kamar pasca tragedi berdarah itu. Petugas Polres Pelabuhan Belawan yang menerima informasi, langsung turun ke lokasi kejadian dan melakukan evakuasi terhadap jenazah para korban ke RS Pirngadi Medan. Para korban WNA Myanmar, yakni Aye Min (23), Myo Co (20), Aung Thu Win (24), Aung Than (44), Min-Min (24), Win Tun (32), Nawe (23) dan Sam Lwin (45). Kabid Humas Poldasu Kombes Pol R Heru Prakoso didampingi Kepala Imigrasi Belawan Sunardi dan Kapolres Pelabuhan Belawan AKBP Endro Kiswanto, saat pemaparan di Aula Mako Polres Pelabuhan Belawan, menerangkan motif sementara kejadian berdarah itu, berawal dari pelecehan seksual yang dilakukan warga Myanmar terhadap pengungsi Rohingya. Lokasi itu berada di lantai dua, dan ada sekitar 90 pengungsi Rohingnya yang menempati di bilik itu. “Tak benar motif bentrok karena SARA atau agama, melainkan motifnya karena pelecehan yang sebelumnya telah dicoba diselesaikan pihak Imigrasi namun kemungkinan belum tuntas menyebabkan persoalan berlanjut,” tegasnya. Heru menyebutkan, pada Kamis (4/4) sekira pukul 10.00 WIB, tiga perempuan dari etnis Rohingya yang ada di Rudenim melapor kepada Ali. Ali merupakan sosok yang dituakan oleh 153 pengungsi etnis Rohingya yang ada di Rudenim. Ketiga wanita itu mengaku mengalami pelecehan seksual secara fisik dari kelompok Myanmar lainnya, kelompok anak buah kapal (ABK) Myanmar yang tertangkap karena melakukan penangkapan ikan ilegal di Indonesia. Mereka sama-sama ditempatkan di Rudenim. Atas laporan ini, Ali kemudian menyampaikanpersoalankepadapihakpetugasimigrasi

Departemen Redaksi METRO TAPANULI Dewan Redaksi Group : Marganas Nainggolan (Ketua), Maranatha Tobing, Pandapotan MT Siallagan, Muhiddin Hasibuan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Nasa Putramaylanda, Hermanto Sipayung, Nurjannah. Pjs Redaktur Pelaksana: Nasa Putra Maylanda, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Hezbi Rangkuty, Edi Saragih Kordinator Liputan: -, Ass. Korlip (Taput) : Horden Silalahi, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Hermanto Turnip (Tobasa) METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba, Kordinator Liputan: Pala MD Silaban, Reporter: Tonggo Sibarani, Imelda Purba, Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Raymound Sitanggang, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat) Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi : Ita Butar-butar METRO TABAGSEL Redaktur Pelaksana: Nurjannah, Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Parningotan Aritonang.

yang ada di Rudenim. Pertemuan pun digagas pada Kamis malam sekira pukul 22.00 WIB. Saat itu kedua belah pihak sepakat damai. “Pada saat itu clear, selesai,” tukas Heru. Usai pertemuan itu, kelompok Rohingya melakukan diskusi. Mereka terkesan tidak puas dengan kesepakatan yang diambil dalam pertemuan yang difasilitasi Rudenim. Ketika sedang berdiskusi itu, ada kelompok ABK yang menyeletuk, memancing suasana. Taklamakemudian,siABKyangnyeletuktadi masuk ke dalam dan kemudian keluar lagi membawa senjata tajam. Dia lalu menusuk Ali. Pergumulan terjadi, senjata itu dapat direbut Ali dan tindakan tersebut dibalas. “Di situlah spontan pengungsi Rohingya yang berada di lantai dua melakukan pengeroyokan terhadap delapan ABK WNA Myanmar. Sehingga seluruhnya meninggal di tempat kejadian perkara,” kata Heru. Para korban menderita luka memar dan luka akibat tusukan benda tajam, yang diduga berasaldaripecahanmeubelerberupamejadan kursi yang ada di barak. 18 Orang jadi Tersangka Kepolisian menetapkan 18 orang etnis Rohingya, penghuni Rudenim Medan, sebagai tersangka dalam bentrokan yang menewaskan delapan orang Myanmar. Kabid Humas Poldasu Kombes Raden Heru Prakoso menyatakan, penetapan 18 tersangka itu dilakukan setelah dilakukan pemeriksaan awal terhadap sejumlah saksi. “Semula yang diamankan 21 orang, setelah diperiksa, kita tetapkan 18 orang yang jadi tersangka. Tiga yang lainnya, akan kita pulangkan,” kata Heru. Heru menyebutkan, para tersangka dikenakan dua pasal dalam KitabUndangUndangHukumPidana(KUHP). Masing-masing pasal 170 dan pasal 351, yakni secara bersama-sama melakukan tindak kekerasan sehingga mengakibatkan orang meninggal dunia. “Proses hukumnya nanti akan ditangani Polres Pelabuhan Belawan,” sebutnya. (ril/ pmg/int)

METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Jekson Siahaan (Batubara), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Mounting: Samuel Sihotang (Koordinator), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi Maintenance & IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan : Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan Group: Hariyani Kartini, Piutang Iklan : Tio Maria, Annisa (Medan), Staf Desaign:Reliston Purba, Togap Sinaga.

Petani Tewas Digorok Petani Sambungan Halaman 1 percekcokan itu, ayah tersangka terbaring sakit. Sejak itu, M Manik menaruh dendam kepada Ukuk Tinambunan yang masih berikatan saudara dengannya. Pada hari naas itu, tersangka yang sedang berada di ladangnya melihat korban berjalan menuju ladang cabainya. Kebetulan, lokasi ladang keduanya berdekatan. Melihat Tinambunan, seketika Manik emosi. Tersangka lalu mengambil parangnya dan menyerang korban dari belakang. Sabetan parang tersangka mengenai kepala korban. Seketika itu juga Ukuk Tinambunan roboh. Namun bacokan tersebut bukan membuat tersangka berhenti. Manik langsung menarik leher Tinambunan lalu menggoroknya. Korban pun tewas bersimbah darah. Wakapolres Pakpak Bharat Kompol Supriatmono ketika dikonfirmasi melalui telepon selulernya, kemarin (5/4) membenarkan adanya pembunuhan tersebut. “Tim Reskrim Polres Pakpak Bharat telah diturunkan ke lapangan untuk melakukan olah Tempat Kejadian Perkara (TKP). Kami juga sudah menyita barang barang bukti sebilah parang,” ujar Wakapolres. (buyung/pmg)

Perwakilan Metro Tapanuli Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koordinator Pengembangan: Zulfiandi, Staf Pengembangan: Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 April 2013

Muda-mudi Peduli Lingkungan SIBOLGA- Berangkat dari kesadaran, para muda-mudi Marsaor warga Lingkungan I, Kelurahan Sibolga Ilir, Kecamatan Sibolga Utara melakukan gotong royong di sekitar lingkungan tempat mereka tinggal, Jumat (5/4). Menurut mereka, kebersihan bukan hanya tanggungjawab Dinas Kebersihan saja, namun seluruh masyarakat. Ketua Muda-mudi Marsaor Ketapang Manonga Manalu mengatakan, aksi mereka ini sebagai bentuk kepedulian terhadap lingkungan dan masyarakat. “Kita harus bisa berbuat lebih untuk semua. Kumpulan yang dibentuk sejak awal Januari lalu ini sifatnya ingin membangun ke-

bersamaan,” sebutnya. Dia menerangkan, salah satu program yang mereka rencanakan dan telah dilakukan beberapa kali kegiatan gotong royong. Membersihkan parit dan jalan yang ada di Lingkungan I. Tujuannya, selain menjaga kebersihan dan keindahan lingkungan, juga sebagai contoh untuk menggugah hati masyarakat untuk lebih sadar akan kebersihan llingkungannya. “Selain kegiatan itu, kita juga turut berpatisipasi baik kegiatan suka ataupun duka. Sebab, dengan wadah ini, kita ingin menunjukkan solidaritas kita dan kepedulian kita terhadap sesama. Bahkan, bagi kaum muda se-

makin terhindar terhadap perbuatan kriminalitas yang dapat merusak diri,” ungkap Manalu. Sementara itu, kegiatan positif muda-mudi ini juga mendapat apresiasi dari pihak kelurahan. Lurah Sibolga Ilir Irwan A Huy Sitaggang mengatakan, pihaknya sudah jarang menemukan generasi muda yang peduli terhadap lingkungan dan lainnya. “Saya berharap, kegiatan ini jangan sampai disini saja. Kedepannya agar lebih banyak kegiatan positif yang bermanfaat bagi sesama. Selain itu, agar generasi muda lainnya agar bisa mengikuti jejak ini.(fred/ mua)

Sibolga Berlian yang Belum Diasah SIBOLGA- Kota Sibolga kembali mendapat pujian. Kali ini, atlet asal Singapura yang mengikuti perlombaan Triathlon dalam rangka Hari Jadi Kota Sibolga ke-313 memuji daerah itu. “Sibolga merupakan berlian yang belum diasah sebagai tempat pelaksanaan lomba Triathlon. Hal itu kita lihat dari suksesnya perlombaan dalam rangka memeriahkan Hari Jadi Kota Sibolga. Bahkan, kegiatan ini diikuti oleh atlet nasional dan atlet manca negara khususnya Singapura,” ujar pelatih atlet Triathlon LLyod Ngoh, Selasa (1/4). Melalui penerjemahnya Tiara, LLyod Ngoh datang bersama atletnya Liang le Mint atas undangan dari Pemko Sibolga.

“Sebenarnya kita masih ada satu event Triathlon lagi di daerah lain. Namun, karena ini undangan dari pihak Sibolga dan temannya di Jakarta, maka saya bersama tim bersedia untuk datang ke sini,” ujarnya. Katanya, ia sempat bertanya kepada atletnya, apakah perjalanan itu sepadan dengan hasilnya (kepuasan menikmati perjalanan,red). Namun, setelah mengikuti perjalanan, kenyamanan rute lomba serta keramahtamahan warga Sibolga, ia

bangga bisa hadir ke Kota Berbilang Kaum tersebut. “Ketika perlombaan tengah berlangsung, seluruh kendaraan dilarang melintas. Begitu juga ketika bersepeda, aman dan nyaman. Saya rasa cocok jauhnya perjalanan dengan kepuasan yang kami dapatkan di kota ini,” papar LLyod. Menurut dia, kota ini adalah berlian yang belum diasah. Event ini harusnya bisa dikembangkan menjadi lebih besar hingga tingkat nasional, bersamaan dengan itu, kota ini akan semakin berkembang dan maju. ‘ “Saya berterimakasih atas undangan yang diberikan dan selamat atas kesuksesakan kegiatan

ini. Ini adalah event yang menyenangkan dan saya berharap tahun depan bisa datang lagi,” ujarnya dalam bahasa Inggris. Sementara itu atlet Triathlon Singapura Liang Le Mint, keluar sebagai pemenang juara ke IV pada event yang dilangsungkan di Pelabuhan Lama Sibolga. Sebelumnya pada 2012, ia juga sudah mengikuti kegiatan itu di Kota Sibolga dan berhasil menjadi juara pertama. Kata Liang, jika memang ada penerbangan langsung ke Sibolga, mereka berjanji akan membawa rekannya hingga 200 orang untuk mengikuti perlombaan itu.(son/mua)


„ Atlet Triathlon Singapura Liang Le Mint saat menerima hadiah sebagai pemenang ke IV lomba Triathlon.


„ Dewan Pengawas RRI Pusat Ir Sunaryo Ruslan memaparkan tentang peran RRI di era otonomi daerah.

Peran RRI di Era Otonomi dan Informasi Publik SIBOLGA- Lembaga Penyiaran Publik (LPP) Radio Republik Indonesia (RRI) Sibolga melaksanakan diskusi ‘Focus group discussion’ tentang implementasi peran RRI dalam era otonomi daerah dan keterbukaan informasi publik, Rabu (3/ 4). Kegiatan itu diharapkan mampu menarik minat masyarakat serta semakin berbenah dan memperbaiki kinerja. Kepala Stasiun RRI Sibolga Ir Herman Hidayat mengatakan, selaku lembaga penyiaran publik, tentunya RRI akan terus berbenah. “Kita akan terus memperbaiki kinerja dalam langkah menarik minat masyarakat dalam bidang penyiaran. Ini salah satu sharing untuk menerima masukan tentang apa kekurangan dari kinerja RRI Sibolga selama ini. Untuk itu, silahkan mem-

berikan pendapat, saran maupun masukan untuk menjadi koreksi bagi kami,” katanya. Dia meenrangkan, pelaksanaan diskusi itu dipandu oleh moderator HM Taufik serta dibantu notulen Denni Siahaan. Kegiatan itu diawali dengan pemaparan yang disampaikan Dewan Pengawas RRI Pusat Ir Sunaryo Ruslan. Setelah itu dilanjutkan dengan sesi tanya jawab. Dewan Pengawas RRI Pusat Ir Sunaryo Ruslan menrangkan, RRI Lahir dari wujud perjuangan rakyat Indonesia tahun 1945. “Tahun 1998 RRI berubah sesuai PP No 30 tahun 2000 menjadi perusahaan Jawatan. Saat ini juga sedang dibahas aturan RRI untuk menjadi lembaga penyiaran baru terutama penyiaran public,” terangnya. Kata dia, sejak 2005, dewan pengawas RRI telah menetap-

kan agar RRI dapat meningkatkan parisipasi publik. Selain itu, berupaya agar RRI bisa menjadi radio digital yang mudah diakses oleh masyarakat. Sehingga, radio ini benar-benar memiliki banyak manfaat serta membantu kemajuan di tengah masyarakat. Sementara dalam diskusi ‘Focus Group Discussion’ itu dihadiri peserta dari Kepala Stasiun RRI Sibolga Ir Herman Hidayat, tokoh agama Pdt Singkat Tamba, tokoh pendidikan Drs H Agus Salim Harahap, LSM dari FORCITA, HIMNI, PLt Kabag Humas Pemko Sibolga Drs Saut Parapat, Kabag Humas Pemkab Tapteng Iwan RM Sinaga, Ketua Komisi III DPRD Sibolga Jamil Zeb Tumory, PMI Sibolga Kartika Syahputra dan Ketua IJTI wilayah Tapanuli Dohar F Sianipar.(son/mua)

PENGUMUMUMAN Nomor:170/253/KPU.SBG/2013

Berdasarkan Peraturan Komisi Pemilihan Umum Nomor 06 Tahun 2013 Tentang Perubahan Keempat Atas Peraturan Komisi Pemilihan Umum Nomor 09 Tahun 2012 Tentang Tahapan, Program dan Jadwal Penyelenggaraan PemIlihan Umum Anggota Dewan Perwakilan Rakyat, Dewan Perwakilan Daerah, Dewan Perwakilan Rakyat Daerah Provinsi dan Dewan Perwakilan Rakyat Daerah Kabupaten / Kota Tahun 2014, maka dengan ini Komisi Pemilihan Umum Kota Sibolga menerima pendaftaran Bakal Calon Anggota Dewan Perwakilan Rakyat Daerah Kota Sibolaga dari Partai Politik untuk Pemilihan Umum Legislatif Tahun 2014 yang dilaksanakan mulai tanggal 09 s/d 22 April 2013 pada jam kerja (08 s/d 16.00 wib) di Sekretariat KPU KOTA SIBOLGA dengan persyaratan sebagai berikut: A. PERSYARATAN PENGAJUAN BAKAL CALON: 1. Daftar Bakal Calon yang diajukan oleh partai politik paling banyak 100% dari jumlah kursi yang ditetapkan pada setiap Daerah Pemilihan 2. Daftar Bakal Calon menyertakan sekurang-kurangnya 30% (tiga puluh persen) keterwakilan perempuan pada setiap Daerah Pemilihan dan penempatan pada setiap 3 (tiga) orang Bakal Calon terdapat sekurang-kurangnya 1 (satu) orang perempuan Bakal Calon. B. PERSYARATAN BAKAL CALON: 1. Telah berumur 21 (dua puluh satu) tahun atau lebih 2. Bertakwa kepada Tuhan Yang Maha Esa 3. Bertempat tinggal diwilayah Negara Kesatuan Republik Indonesia; 4. Cakap berbicara, membaca dan menulis dalam Bahasa Indonesia 5. Berpendidikan paling rendah tamat Sekolah Menengah Atas, Madrasah Aliyah, Sekolah Menengah Kejuruan, Madrasah Aliyah Kejuruan atau pendidikan lain yang sederajat. 6. Setia Kepada Pancasila sebagai dasar Negara, Undang-Undang Dasar Negara Republik Indonesia Tahun 1945, dan cita-cita Proklamasi 17 Agustus 1945. 7. Tidak pernah dijatuhi pidana penjara berdasarkan putusan pengadilan yang telah mempunyai kekuatan hukum tetap karena melakukan tindak pidana yang diancam pidana penjara 5 (lima) tahun atau lebih; 8. Sehat jasmani dan rohani 9. Terdaftar sebagai pemilih; 10. Bersedia bekerja penuh waktu; 11. Mengundurkan diri sebagai Kepala Daerah, Wakil Kepala Daerah, Pegawai Negeri Sipil, Anngota TNI, Anggota POLRI, Direksi, Komisaris, Dewan Pengawas dan Karyawan pada Badan Usaha Milik Negara(BUMN) dan/atau Badan Usaha Milik Daerah (BUMD) atau badan lian yang anggarannya bersumber dari keuangan Negara yang dinyatakan dengan surat pengunduran diri yang tidak dapat ditarik kembali. 12. Bersedia untuk tidak berpraktik sebagai Akuntan Publik, Advokat / Pengacara, Notaris, Pejabat Pembuat Akta Tanah (PPAT) atau tidak melakukan pekerjaan penyedia barang dan jasa yang berhubungan dengan keuangan Negara serta pekerjaan lain yang dapat menimbulkan konflik kepentingan dengan tugas, wewenangnya dan hak sebagai Anggota DPR/DPRD Provinsi dan DPRD Kabupaten/Kota sesuai dengan peraturan perundang-undangan. 13. Bersedia untuk tidak merangkap jabatan sebagai pejabat Negara lainnya, Direksi, Komisaris, Dewan Pengawas dan karyawan pada Badan Usaha Milik Negara (BUMN) dan/atau Badan Usaha Milik Daerah (BUMD) atau badan lain yang anggarannya bersumber dari keuangan Negara; 14. Menjadi anggota Partai Politik Peserta Pemilu; 15. Dicalonkan hanya di 1 (satu) lembaga perwakilan; dan 16. Dicalonkan hanya di 1(satu) daerah pemilihan; C. INFORMASI LEBIH LANJUT DAN FORMULIR BESERTA LAMPIRANNYA DAPAT DIPEROLEH DI KANTOR KPU KOTA SIBOLGA JL. S PARMAN NO. 55 SIBOLGA PADA JAM KERJA (08.00 S.D 16.00 WIB). Sibolga, APRIL 2013 Komisi Pemilihan Umum Kota Sibolga Ketua NADZRAN SE

Cegah Anak-anak Kecanduan Lem Dinkes Harapkan Peran Masyarakat

„ Drs Firman Hulu. SIBOLGA- Dinas Kesehatan (Dinkes) Kota Sibolga mengajak seluruh elemen masyarakat untuk proaktif terhadap anakanak yang sering menyalahgunakan lem. Sebab, sampai saat ini masih banyak anakanak yang menggunakan lem untuk mereka hirup. Kepala Dinkes Kota Sibolga Mhd Yusuf Batubara melalui Kepa Bidang Farmasi dan Alat Kesehatan Drs Firman Hulu, Jumat (5/4) mengatakan, mengatasi anak yang sering ngelem, pihaknya secepatnya akan melakukan sosialiasi. “Kita akan segera melakukan sosialisasi kepada anak tentang penyalahgunaan lem. Namun, kita juga akan berkordinasi kepada pihak Puskesmas, kepolisian, Dinas Pendidikan, Badan

Narkotika Kota (BNK) dan tokoh masyarakat tentang penyalahgunaan lem. Apalagi masyarakat, sangat dibutuhkan kerjasama untuk mengatasi salah satu penyakit anakanak saat ini,” ujarnya. Dia mengatakan, rentannya penyalahgunaan narkotika khusussnya lem pada anak usia dini berawal dari pengaruh teman sebaya. Kemudian teman sekolah serta lingkungan sekitar. “Secepatnya kami akan melakukan sosialisasi ke setiap sekolah, khususnya untuk taraf Sekolah Dasar (SD). Karena anak-anak atau remaja yang sering ngelem didominasi anak dibawah mulai yakni mulai dari SD,” terang Fiman. Dia mengatakan, apalagi lem, sangat mudah dicari dan harganya yang relatif murah. Selain itu, anak-anak juga masih belum mengetahui apa bahaya dan dampak ngelem. Sehingga, sebelum mereka kecanduan, alangkah baiknya diberikan pemahaman tentang bahaya ngelem. “Kita sangat perihatin terhadap persoalan ini. Generasi muda khususnya anak dibawah umur mulai hancur dengan terjerumus karena memakai zat berbahaya tersebut. Untuk itu, kita harus mencegahnya. Karena, mungkin sekarang hanya lem yang mere-

ka gunakan, besok bisa saja dia menggunakan ganja atau sabusabu, atau sejenis obat-obatan terlarang lainnya” paparnya. Menurut Firman, bahaya ngelem itu bisa mengakibatkan kematian mendadak. Pengguna bisa kejang karena saluran pernafasan dan irama jantung berdenyut jadi tidak beraturan. Secara bersamaan, itu akan merusak organ tubuh terutama paru-paru dan jantung. Sebelumnya, para orangtua diresahkan karena anak di Kota Sibol-

KADARGULADARAHTURUN,BADANTERASALEBIHSEGAR Indonesia kaya akan sumber daya hayati dan merupakan salah satu n e g a r a megabiodiversity terbesar di dunia. Selain itu, Indonesia juga dikenal sebagai gudangnya tumbuhan obat (herbal) sehingga mendapat julukan live laboratory. Salah salah hasil alam Indonesia yang terbukti bermanfaat bagi kesehatan adalah Gula Aren. Kini, hadir Gentong Mas yang salah satu bahan dasarnya adalah Gula Aren. Saat ini, telah banyak orang yang telah membuktikan manfaatnya, salah satunya adalah Suwarno (60 thn), "Mungkin karena pola makan dan faktor usia, sudah 6 bulan saya menderita penyakit berbahaya ini. Kadar gula darah saya mencapai 600 mg/ dL." Ujar pria yang berprofesi sebagai Wiraswasta tersebut. Ia menambahkan, ketika kadar gula darahnya tinggi, badannya sering terasa lemas, dan kepalanya sering pusing. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme

pengaturan gula normal. Tapi sekarang, kakek 5 orang cucu dapat bernafas dengan lega karena telah menemukan solusi yang tepat untuk mengatasi keluhannya, "Setelah minum Gentong Mas secara teratur selama 2 bulan, kadar gula darah saya sekarang sudah turun, badan pun terasa lebih segar." Ungkap ayah 4 orang anak itu. Setelah merasakan manfaat mengkonsumsi Gentong Mas, ia pun merasa terpanggil untuk membagi pengalamannya itu dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain." Harap warga Bandar Klippa, Kec. Percut Sei Tuan, Deli Serdang, Medan tersebut. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas. Selain itu, indeks glisemik dalam

Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787 Dolok Sanggul : 082129284752 T. Tinggi/Siantar : 081322099495 Binjai/pakam : 081398666166 Langkat/karo : 082167538828 Kisaran : 06237014362 Tanjung Balai : 081263495563 Labura : 081370590972 Labuhan batu : 082365222011 Sibolga :081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114

ga marak menggunakan lem. Mereka berharap kepedulian pemerintah daerah untuk melakukan sosialiasi kepada anak-anak yang menjadi penerus generasi bangsa. “Kami sangat mengharapkan peran serta pemerintah dengan sosialisasi kepada mereka (anak-anak, red) ke sekolah atau lingkungan masyarakat. Sehingga mereka tahu dampak dari penggunaan zat berbahaya itu,” ungkap AH (38), salah seorang warga Sibolga. (Samuel/ mua)


Tercecer Sertifikat Hak Milik atas tanah An. Apoan Situmeang dengan No: HM 00043. Tercecer sekitar Naipos-pos Barat (Sorkam), pada tanggal 28 maret 2013. Bagi yang menemukan harap dikembalikan ke alamat : Dusun Sijambu-jambu Desa Naipospos Barat kec. Sorkam atau hubungi HP: 0852 6276 0784 An Apoan Situmeang. Tidak akan dituntut tapi diberi hadiah yang sepantasnya.

T E R C E C E R Hilang 1 ( satu) buah dokumen Surat Kapal ( GROSSE AKTE ) Nomor 3608, tanggal 28 juni 2005, Nama Kapal: NIAGA MAS BARU, Nama Pemilik: HERDI. Hilang pada hari minggu tanggal 8 mei 2011 di sekitar Jl. Mojopahit Sibolga. Bagi yang menemukan harap dikembalikan ke alamat: Jl. Enggang No.23 Kel. Aek muara Pinang Kota Sibolga atau hubungi ke HP: 0813 6238 7293 An. Jasmin Sidabutar. Tidak akan dituntut tapi diberi hadiah yang sepantasnya

Silahkan Promosikan Usaha Anda di:


Telp: 0631-24676




6 April 2013


Apa Kata Mereka

Sikap Kami

Wakil Ketua DPR RI Priyo Budi Santoso Panja akan melaporkan RUU Ormas untuk disahkan pada paripurna. Tapi kalau masih ada yang krusial yang menjadi perdebatan, saya kira Panja harus lapang dada untuk mendengarkan dari semua elemen. Kalau itu tidak dimungkinkan, saya anjurkan kita tunda sampai persidangan berikut,”

Anggota Komisi I DPR Tjahjo Kumolo “Pada awalnya pendapat saya membela korps elite Kopassus, sangat tidaklah mungkin, sebagai pasukan elite TNI yang tugas utamanya membela bangsa negara. Ternyata, ada oknum Kopassus yang belum mampu menahan emosi,”

Kasus Cebongan, Pintu Masuk Revisi Peradilan Militer

Mendengar Koreksi RUU Ormas POLEMIK mengenai rancangan undang-undang organisasi kemasyarakatan (RUU ormas) terus menggelinding. Hal itu tampak dari pernyataan sikap sejumlah ormas dalam keputusan resmi organisasi, diskusi publik, dan demonstrasi. Desakan agar pasalpasal kontroversial segera direvisi begitu kuat. Bila tidak, begitu disahkan jadi UU ormas, ormas-ormas itu telah berancang- ancang mengajukan judicial review ke Mahkamah Konstitusi (MK). Pemerintah dan legislatif selayaknya mendengar suara kritis in Oleh : Biyanto

Ketua Badan Standar Nasional Pendidikan M Aman Wirakartakusumah “Sekarang setiap kursi akan mendapat setting soal berbeda, sehingga di satu ruang ada 20 setting (soal),”

Ketua Pansus Revisi UU Ormas Abdul Malik Haramain “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985 tentang Ormas memang asas yang sama dengan UU Parpol,”


uhammadiyah ter masuk yang telah bersikap tegas me nolak RUU ormas. Sikap itu diambil karena menurut hasil telaah Muhammadiyah, RUU ormas yang dibahas di DPR dapat membatasi kebebasan berserikat dan berkumpul serta berpotensi menimbulkan kegaduhan dan instabilitas politik (Jawa Pos, 29 Maret). Dalam pertemuan di Kantor Pimpinan Pusat Muhammadiyah, setidaknya ada 96 ormas lain yang juga menolak. Sementara, PB NU mengusulkan pembahasan RUU ditunda terlebih dulu hingga ada titik temu, terutama terkait pasal-pasal yang masih diperdebatkan. Sikap beberapa ormas tersebut dapat dipahami karena mereka ingin memastikan bahwa RUU ormas tidak menjadi pemasung. Apalagi, ormas sekelas Muhammadiyah dan NU yang telah banyak berkiprah dan, berusia jauh lebih tua dari negeri ini. Ormas ingin RUU itu menjamin kebebasan berserikat, sementara pemerintah berkepentingan mengendalikan ormas. Dalam perspektif pemerintah,

UU No 8/1985 tentang Ormas dianggap tidak lagi mampu mengikuti perkembangan. Itu karena perkembangan ormas, terutama pada masa reformasi, terasa sangat dinamis dan meriah. Alasan lain yang dimajukan pemerintah adalah keberadaan ormas anarkistis yang sering mengganggu masyarakat dan merongrong kewibawaan pemerintah. Dalam aksinya ormas anarkistis telah memanfaatkan simbol-simbol agama atau simbol negara. Padahal, Jalaluddin al-Suyuthi, ulama besar dan mujadid Islam, menyatakan bahwa tidak semua orang dapat melaksanakan tugas tersebut. Menurut al-Suyuthi, hanya ulama dan penguasa yang dapat bertugas amar ma’ruf nahi munkar. Ulama mengembang tugas itu karena memiliki ilmu, sedangkan penguasa memiliki kekuasaan. RUU ormas juga dirancang untuk mengatur keberadaan lembaga swadaya masyarakat (LSM), baik yang didirikan WNI maupun warga asing. Dalam penilaian pemerintah, keberadaan LSM harus diatur agar kiprahnya dapat diselaraskan dengan tujuan pemban-

gunan nasional. LSM yang dikelola orang asing pun harus menunjukkan komitmen untuk kepentingan nasional dan turut menjaga keutuhan NKRI. Regulasi ini dinilai penting, karena diduga kuat banyak LSM yang bekerja tidak untuk kepentingan nasional, melainkan untuk funding agency asing. Jika dicermati secara mendalam dari RUU ormas, paling tidak ada tiga poin yang penting diperhatikan. Pertama, RUU ormas berpotensi menggeneralisasi semua lembaga sosial kemasyarakatan. Itu berarti posisi ormas yang telah berkontribusi luar biasa bagi perjuangan kemerdekaan dan berpartisipasi dalam pembangunan nasional, seperti Muhammadiyah dan NU, tak berbeda dengan LSM baru. Berkaitan dengan persoalan ini, RUU ormas harus membedakan secara tegas peraturan untuk ormas dan LSM, apalagi ormas asing. Poin ini penting diperhatikan karena Muhammadiyah dan NU dengan ribuan amal usaha di bidang pendidikan, kesehatan, ekonomi, dan pelayanan sosial lainnya memiliki jaringan yang luas mulai pusat, provinsi, kabupaten/kota, kecamatan, dan kelurahan/desa. Itu berbeda dengan LSM yang hanya menekankan pekerjaan di satu bidang dan bersifat elitis. Karena itu, penyamaan ormas dan LSM jelas sebuah kesalahan yang mendasar. Kedua, RUU ormas membuka peluang munculnya otoritarianisme baru. Apalagi, dalam RUU itu ada ketentuan bahwa Direktorat Jenderal Kesatuan Bangsa

dan Politik (Ditjen Kesbangpol) dapat mencabut izin ormas. Jika itu yang terjadi, akan muncul budaya represif atas nama undangundang. Padahal, kebebasan berserikat dan berkumpul jelas diatur dalam konstitusi. Apalagi, konteks pembuatan UU No 8/1985 dan RUU Ormas jauh berbeda. UU No 8/1985 dibuat suasana rezim otoritarian Orde Baru. Sementara RUU ormas kini disusun dalam suasana demokratis. Karena itu, RUU ormas seharusnya menjamin ormas untuk menampilkan kekhasan asal tidak bertabrakan dengan nilainilai Pancasila dan kepentingan nasional NKRI. Ketiga, RUU ormas mewajiban pencantuman Pancasila sebagai asas bagi setiap ormas. Eloknya, RUU ormas memberikan kelonggaran bagi ormas yang ingin menggunakan asas lain, dengan syarat tidak bertentangan dengan Pancasila. Jika itu yang dilakukan, ormas berbasis agama tidak harus mengganti asasnya dengan Pancasila. Jangan korek lagi trauma sosial dan politik asas tunggal eraOrdebaruyangjustrumenyempitkan keterbukaan ideologi Pancasila. Tak perlu ada tafsir tunggal atas Pancasila dengan mena-fikan indahnya pelangi keragaman yang membentuk Indonesia tercinta. Jika beberapa hal yang berpotensi memicu pertentangan itu kembali didialogkan, rasanya masing pihak, yakni pemerintah, legislatif, dan ormas yang menjadi sasaran RUU, pasti menemukan jalan keluar. Aamin. (*) Penulis adalah Dosen IAIN Sunan Ampel

TERUNGKAPNYA penyerangan yang menewaskan empat tahanan di Lembaga Pemasyarakatan (Lapas) IIB Cebongan, Sleman, Yogyakarta, 23 Maret 2013 lalu, oleh 11 oknum Grup 2 Kopassus Kandang Menjangan, Kartasura, Solo, Jawa Tengah, membuka celah bagi DPR untuk merevisi Undang-Undang Nomor 31 Tahun 1997 tentang Peradilan Militer. Upaya ini sebagai bentuk reformasi di sektor keamanan. Sehingga kejadian demi kejadian yang melibatkan anggota TNI terhadap sipil sebagai korbannya, tidak terus terjadi. TNI mencatat, selama 2012, kasus demi kasus kriminal yang dilakukan oleh anggotanya cukup mencolok. Penganiayaan yang melibatkan prajurit TNI mencapai 355 kasus, terlibat narkoba sebanyak 161 kasus, serta penyalahgunaan senjata api sebanyak 49 kasus. TNI juga mencatat sebanyak 3.634 prajurit terlibat pelanggaran hukum dan sedang diproses. Dari jumlah tersebut, TNI telah menyelesaikan perkara sebanyak 3.298 kasus. Narapidana dan tahanan militer, sisa tahanan tahun 2012 sebanyak 414 orang. Tahanan masuk 1.812 orang, tahanan bebas 1.795 orang. Jumlah tersebut tentu bukan angka kecil, dan akan terus bertambah setiap tahunnya bila penegakan hukum dikalangan militer tidak segera ditertibkan. Karena itu, perlunya DPR merevisi RUU Peradilan Militer, apakah perlu prajurit TNI yang terbukti melakukan tindak kejahatan dapat disidangkan di pengadilan umum. Dengan begitu, masyarakat perlu tahu, dan bagi mereka keterbukaan, transparansi dan juga keseriusan dari aparatur negara, khusus militer tidak lagi jadi barang yang tabu. Selamaini,tindakanparatersangkamasukkategori pidana umum, mereka akan ditangani oleh pengadilan militer. UU Peradilan Militer memang secara tegas menyebutkan, setiap anggota TNI yang melakukan tindak pidana, termasuk pidana umum, diadili di pengadilan militer. Apabila para tersangka tersebut dibawa ke pengadilan militer, dikhawatirkan proses di pengadilan militer tersebut tidak bisa berlangsung secara transparan, terbuka, dan akuntabel. Para pelaku tidak mendapat hukuman yang setimpal. Sehingga,akanmunculimpunitas-impunitasbaru yang kemudian jadi pijakan bagi mereka untuk membuka kemungkinan terjadinya hal yang sama di masa mendatang. Padahal, seharusnya adalah dapat memberikan efek jera terhadap pelakunya. Dalam kasus Cebongan ini, diharapkan proses hukum ini tuntas dalam waktu singkat dan juga transparan. Terlebih, korban dari aksi brutal pasukan baret merah ini menyangkut korban sipil. Bila sudah demikian, akan semakin jelas bahwa reformasi TNI yang sudah berjalan maju, betul-betul berjalan, tidak jalan ditempat atau tidak tuntas sama sekali, seperti yang sering di gaung-gaungkan oleh para petinggi TNI pascareformasi. Lalu, akankan kasus Cebongan ini, dengan 11 tersangka oknum anggota Kopassus dapat diadili dan disidangkan secara terbuka dan transparan, pelaku yang bersalah harus dilakukan pemecatan atau hanya sekedar hukum disiplin saja? Kita tunggu saja. (*)

LOWONGAN KERJA Kami lembaga keuangan yang Non Bank yang bergerak di bidang simpan pinjam yang bekerja sama dengan Beberapa Bank terkemuka dan PT Pos Indonesia Persero membutuhkan karyawan/ti untuk di tempatkan di SIBOLGA dengan posisi sebagai:


Persyaratan: 1. Pria/Wanita Usia Min 20 tahun 2. Pendidikan Terakhir Min SMA/SMK 3. Berpenampilan Menarik 4. Dapat bekerja dengan baik,Jujur,Teliti dan bertanggung jawab 5. Mampu mengoperasikan Komputer 6. Berwawasan Luas,Komunikatif 7. Berpengalaman lebih dibutuhkan Lamaran diterima paling lambat 2minggu setelah iklan ini diterbitkan, Dengan melampirkan FC KTP,FC Ijazah Terakhir,Pas foto 3X4 Dua(2) Lembar dan daftar riwayat hidup Hanya Lamaran yang dikirim melalui pos yang akan diproses

Nasari Simpan Pinjam KCP Sibolga Jl. Brigjen Katamso No.16 D Sibolga Telp. 0631-21341



6 April 2013


4 TSK & 5 Kreta Diamankan SIMALUNGUN– Polisi berhasil membongkar sindikat pencurian sepedamotor (curanmor) di wilayah Simalungun. Sebanyak empat tersangka dan lima kreta diamankan. Keempat tersangka yakni Yusuf Sinaga (41), warga Jalan Baja Purba, Kecamatan Siantar, Sandu Syaputra Lubis (22), warga Jalan Naga Huta, Nagori Bosar, Kecamatan Panomban Pane. Kemudian Isban (19), warga Kecamatan Sei Suka, Kabupaten Batu Bara, selaku penadah dan yang terakhir Rijal Lubis (26), warga Jalan Diponegoro, Pematangsiantar. “Tiga pelaku ini diringkus pada Pebruari dan Maret lalu. Kecuali Rijal Lubis, ditangkap tiga hari lalu dari rumahnya,” ungkap Kasat Reskrim AKP Roni Sidabutar, kepada METRO, Jumat (5/4). Roni mengatakan, butuh waktu relatif lama untuk membongkar sindikat para pelaku. Dia mencontohkan kasus pencurian sepedamotor yang dialami Sahala Lingga (41), warga Kecamatan Raya. Sahala kehilangan sepedamotor Yamaha Scorpio dari halaman rumahnya pada 16 Oktober 2012. Setelah dilakukan penyelidikan terus menerus, akhirnya pelaku Yusuf Sinaga berhasil ditangkap pada Maret. Dari tangan tersangka, polisi berhasil mengamankan sepedamotor korban. Demikian halnya dialami Septi Suryando (22), warga Nagori Bosar, Kecamatan Pane, pada 25 Okotober 2012, kemarin, sepedamotor Yamaha Xeon miliknya juga diembat maling. Dari hasil penyelidikan kepolisian akhirnya pelakunya berhasil diringkus pada Rabu (3/4), yakni

Rijal Lubis (26), warga Jalan Diponegoro. Kemudian aksi pencurian sepedamotor kembali terulang pada 25 Maret kemarin, yakni yang dialami korban Romy Siregar (24), warga Tanah Jawa. Ketika itu sepedamotor Yamaha Vixion, miliknya diparkirkan di Huta Timuran, Nagori Mariah Jambi, Kecamatan Jawa Maraja Bah Jambi, dicuri maling. Setelah dilaporkan kepada petugas kepolisian, Polres Simalungun kembali membentuk tim hingga akhirnya menciduk Sandy Syaputra Lubis (22), warga Panombean Pane pada akhir Maret kemarin. Setelah dilakukan pemeriksaan, Sandy mengakui menjual sepedamotor tersebut kepada salahseorang rekannya bernama Isban (19) di Kabupaten Batubara. Ketika itu, petugas pun kemudian menjemput Isban, serta barang buktinya ke Kabupaten Batubara. Roni menyebutkan, untuk Isban dikenakan pasal 480 KUHPidana yang berperan sebagai penadah. Sementara ketiga tersangka lainnya dijerat pasal 363 KUHPidana tentang pencurian. “Dari hasil pemeriksaan, dalam melakukan aksinya pelaku menggunakan kunci palsu. Kunci itu untuk menghidupkan sepedamotor targetnya. Saat ini, kita masih melakukan pemeriksaan untuk dilakukan pengembangan,” ujar Roni. (pra/ dro)

Operasi Palm

3 Pencuri Diamankan SIMALUNGUN– Dalam rangka pelaksanaan opreasi Palm Toba 2013 yang dilaksanakan sejak 1 April Polres Simalungun, telah menangani 3 kasus dengan tiga pelaku atas kasus pencurian terhadap buah sawit milik PTPN III dan IV. Ketiga pelaku serta barang bukti saat ini diamankan di Polres Simalungun. “Operasi Palm ini adalah operasi khusus tindak pidana pencurian tanaman kelapa sawit serta CPO. dan hasilnya telah ditangkap 3 pelaku dengan aksi pencurian dilokasi berbeda,” terang Kasat Reskrim AKP Roni Sidabutar, Jumat (5/4). Pelaku pertama ialah Boy Sumandar (19), warga Tanah Jawa melakukan aksi pencurian di PTPN III Bah Jambi. Pelaku melakukan pencurian dengan menggunakan sepeda motornya

dan mengambil 10 Buah Sawit. Sedangkan Irpan (46), warga Nagori Sei Merbau, Kecamatan Ujung Padang turut juga tidak lepas jangkauan petugas saat melakukan aksinya di PTPN IV Tinjowan Senin (1/4). Pelaku mengambil 8 buah sawit dan membawanya dengan sebuah beko. Sedangkan Rikki Manullang (23) warga Kecamatan Bandar juga melakukan aksi pencurian di kebun hingga akhirnya diringkus petugas. Ketiga pelaku ini saat ini masih dalam pemeriksaan petugas kepolisian untuk dilakukan pengembangan. “yang pasti pihak kepolisian untuk tetap melakukan penindakan terhadap aksi pencurian di kebun pemerintah termasuk kebun rakyat,” ujar AKP Roni Sidabutar. (pra)


DIAMANKAN- 4 tersangka pencurian sepedamotor berikut dengan 5 unit kreta curian diamankan di Mapolres Simalungun, Jumat (5/4).

SISWA SMK CURI HP TNI SIANTAR- Seorang siswa SMK berinisial BG(19), salahsatu sekolah di Kota Pematangsiantar, nekat mencuri handphone (Hp) milik TNI. Keterangan dihimpun, saat beraksi ada seorang tersangka baru yakni berinisial HM (16) di Jalan Renville, Lorong 22, BDB. Benet menyempat diri mencuri Hp milik anggota TNI Serka L Sinaga (46) yang berada di samping rumah kost yang bakal mereka tuju. Ceritanya, Jumat (5/4), sepulang sekolah, Benat yang selama ini kost di Jalan Bali mengajak Holmes mencari tempat kost baru. Ajakan pelaku diiyakan HM karena kebetulan si HM juga mau pindah dari tempat kost lamanya di Lorong I, BDB dengan alasan kurang bebas. Sementara di luar jam belajar, dia banyak kegiatan ekstra kulikuler seperti latihan bela diri. Karena sudah cocok, mereka pergi ke lorong 22. Sampai di sana, warga mengaku samping rumah nomor 167 tempat kediaman L Sinaga TNI yang bertugas di Kodim 0207/Simalungun menerima anak kost. Selanjutnya mereka langsung menuju rumah tersebut sekaligus ingin melobi harga sewa kost. Di sana, L Sinaga tetangga samping rumah kost sedang asik menyusun beberapa pot bunga. Sore itu sekira pukul 14.30 WIB, korban menaruh Hp merek cina bersama satu gelas air putih di atas kursi teras. Tiba-tiba selesai menyusun pot bunga, korban merasa lapar kemudian pergi ke dapur guna mengambil makanan ringan berupa roti. Keluar dari dapur, korban sontak kaget melihat Hp yang awalnya ditaruh di atas kursi sudah tidak ada. Korban sempat tidak percaya kalau Hp-nya hilang. Tak berapa lama, si korban menanyakan kepada istri. Si istri mengaku tidak tahu dan tidak

„ BG, tersangka pencuri Hp milik TNI melihat ada orang yang mengambil atau mencuri Hp. Merasa tak habis akal, korban kemudian menghubungi nomor kontak Hp yang hilang memakai Hp istri. Begitu dihubungi, suara nada panggil terdengar jelas dari samping rumah. Setelah didekati, ternyata Hp itu sudah berada dalam tas milik Benet. Walau sudah ketahuan mencuri, Benet sempat berdalih dan mengatakan bukan mencuri melainkan dapat. Setelah dipaksa mengaku, pelaku bersih keras mengatakan bukan mencuri melainkan mendapat. Takut pelaku di amuk massa. Korban menghubungi petugas kepolisian Polsek Siantar Timur. Tak berapa lama, personil polsek terjun ke TKP untuk mengamankan pelaku. Kepada Metro Benet mengaku, nekad mencuri karena sudah tidak punya uang untuk bayar rumah kost di Jalan Bali. Sementara uang kiriman yang diberi orangtua setiap bulan habis di judikan. “Aku mencuri untuk

bayar uang kost Bang, karena sudah banyak hutang ku di rumah kost di Jalan Bali. Makanya aku niat pindah kost baru Bang,” kata pelaku di Polsek. Tak berapa lama Guru jurusan otomotif SMK GKPS Jalan Ahmad Yani marga Marpaung datang ke Polsek. Ketika diwawancara Metro, dia mengatakan pelaku pencuri Hp itu sudah enam bulan tidak membayar uang sekolah. Jika di totalkan sekitar Rp900 ribu. Selainkan itu pelaku juga dikenal sering bolos dari sekolah. “Pernah sewaktu saya menyuruh Benet pulang ke kampung untuk mengambil uang sekolah. Saya malah ditelepon seorang pemuda yang mengaku abangnya. Waktu itu Saya sempat curiga, karena sewaktu Saya meminta bicara langsung dengan orangtua Hp-nya langsung di matikan,” kata guru pelaku sewaktu ditanya soal latar belakang Benet. Masih di Mapolsek. Korban belum sempat membuat laporan pengaduan, Kapolsek Siantar Timur AKP Altur Pasaribu datang. Kepada Kapolsek korban mengaku tidak keberatan dengan kejadian tersebut. Karena setelah mengetahui latar belakang keluarga pelaku yang baru saja berduka atas meninggalnya orangtua laki-laki. Korban merasa iba dan kasihan, lagi pula pelaku juga masih butuh sekolah. “Mendengar pengakuan Benet kalau orangtuanya baru saja meninggal dunia, Saya turut berduka. Atas kejadian ini Saya tidak keberatan,” aku korban kepada Kapolsek. Konfirmasi Metro dengan AKP Altur Pasaribu mengatakan korban tidak jadi membuat laporan pengaduan. Sekarang ini pelaku sudah dibawa pulang olah guru tempat dimana pelaku bersekolah. (eko)

Kreta Gadai Digelapkan SIANTAR- Naas dialami A Siringoringo (30), warga Jalan DI Panjaitan, Kecamatan Siantar Selatan. Dia terpaksa mendatangi Polres Siantar guna membuat laporan penggelapan. Sebab kabarnya, sepedamotor Honda Revo (lupa plat BK) digelapkan oleh tukang gadai, Jumat (5/4) sekira pukul 11.00 WIB. Ceritanya, selama ini, Revo itu sering dipakai kakaknya I br Siringoringo. Beberapa waktu juga Revo pernah digadai dengan uang sebesar Rp3 juta. Setelah lunas, si kakak kembali menggadaikan kepada orang lain dengan nilai Rp1,5 juta. Begitu korban ingin menebus, ternyata penggadai sudah kabur. Setelah di tunggu beberapa hari, pelaku tak kunjung timbul di kampung. “Aku tidak kenal sama siapa kreta itu digadaikan kakak Ku Bang. Tapi yang pasti, kreta sudah tidak kelihatan lagi. Dugaan Ku sudah dibawa kabur sama tukang gadai,” kata korban sewaktu di Polres Siantar. Tak berapa lama masuk ke ruang SPKT, korban kembali keluar. Karena kasus yang dilaporkan si korban butuh saksi. Terutama orang yang menggadaikan kreta. Kebetulan memang siang itu, korban datang seorang diri tanpa ditemani kakaknya. “Kata polisinya. Kalau mau melapor harus ikut kakak Ku Bang. Karena kakak Ku yang menggadaikan,” kata korban berlalu pergi. Informasi dari pihak SPKT membenarkan kedatangan calon pelapor ke Polres Siantar. Karena tak cukup bukti, calon pelapor terpaksa di minta menghadirkan kakaknya untuk menjelaskan kronologis soal gadai tersebut. (eko)

Diduga Stres, Warga Sipahutar Mengamuk di RS Pirngadi MEDAN- Paulus Edi Susanto (25), warga Desa Siabalabal II, Sipahutar, Kabupaten Tapanuli Utara, mengamuk di ruang terpadu E RSUD dr Pirngadi, Medan, Jumat (5/4). Aksi Paulus itu membuat pasien lain ketakutan dan berhamburan lari keluar ruangan. Paulus memecahkan kaca jendela ruangan yang bersebelahan dengan tempat pasien rawat inap. Informasi di rumah sakit plat merah ini, Paulus sedang dalam masa perawatan di ruang 18 karena mengidap penyakit paru sejak enam hari lalu. Diduga stres, tibatiba dia berlari ke ruang E terpadu dan membolak-balikkan meja serta tempat tidur yang ada di situ. Tak hanya itu, seperti kesurupan, Paulus juga memecahkan sejumlah kaca nako. Pasien lain yang dalam perawatan pun panik dan berlari keluar ruangan walaupun sedang diinfus. “Tak tahu kenapa, tiba-tiba dia mengamuk dan memecahkan kaca ruangan,” kata Davidson, salah seorang sekuriti rumah sakit. Khawatir tindakan Paulus mengancam keselamatan pasien lain, petugas keamanan rumah sakit mengamankan Paulus dan membawanya ke ruang Instalasi Gawat Darurat (IGD) dengan diikat di kursi roda. “Terpaksa diikat, soalnya dia ngamuk terus, bahkan ibunya sendiri pun pergi entah kemana karena mau dipukulnya,” kata David. Kabag Hukum dan Humas RSUD dr Pirngadi Medan, Edison Perangin-angin ketika di konfirmasi mengatakan akan menyelidiki kasus pasien tersebut. “Masalah ini akan kita selidiki terlebih dahulu, kabarnya pasien itu mengalami stres, walaupun dia telah merusak barangbarang milik negara,” pungkasnya.(int)

Tak Enak di Entong, Tapi Penuh di Kantong Maryati (bukan nama sebenarnya), memang tidak cantik, tapi duitnya beratusratus juta. Maka Wariyun (nama samaran), sebagai tetangga doyan saja meniduri wanita kesepian ditinggal suami jadi TKI tersebut. Prinsip pria pengangguran itu mungkin: yang penting penuh di kantong, meski tak enak di entong. Banyak lelaki penganut paham kebendaan. Mereka ini mencari pasangan hidup bukan berdasarkan cinta, tapi berdasarkan materi. Dianya yang ganteng kayak bintang film, mau saja kawin dengan perempuan model “mercon bantingan”,

TOYOTA P. SIANTAR Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar = Harga Medan


karena mengharapkan kekayaannya. Biar saja orang mengatakan sebagai “kawin harta”, toh kalau benar-benar miskin apa mereka mau menyantuni? Salahsatu lelaki model demikian adalah Wariyun (35), warga Desa Banyubang, Kecamatan Solokuro, Kabupaten Lamongan (Jatim). Sebagai lelaki pengangguran tapi punya keluarga, memang membutuhkan anggaran banyak untuk menafkahi anak istri. Cari kerja yang pasti tak laku, padahal keluarga dan dirinya juga tak bisa makan opak angin (hawa) sepanjang hari. Maka selagi ada “terobosan” menjanjikan, harus diambil tak peduli apa resikonya. Di dekat rumahnya selang



SIANTURI, 0812 6489 8086

DIJUAL: Innova B.8367.GD maven BK.1088.XV tahun 2006'warna biru metalik' Harga 150juta' bisa nego. Mitshubishi maven tahun 2007' warna Hitam Harga 120juta bisa nego. Hub. 0852 6150 9688; 0813 7685 9855 D A I H AT S U B A R U : R e a d y s t o c k semua type dgn Dp. 20Jtan (Xenia) Dp. 22Jtan (Terios) Dp. 13Jtan (Pick Up/Minibus) Pesan sekarang juga, data dijemput dan proses leasing dibantu. Sariaman Marpaung, HP. 0852 7023 1310, Pin BB 297B2A40

beberapa rumah, ada wanita “nganggur” karena lama ditinggal suami jadi TKI di Malaysia. Namanya Maryati (37). Meski namanya cukup bagus, jangan bayangkan wajahnya macam Sri Maryati penyiar TVRI tahun 1980

MITSUBISHI BARU! Dealer Resmi di Medan; Tersedia : • L300 PU / Minibus • Colt Diesel, 110 HD, 125 HD • Colt Diesel, 136 HD, HDL • Fuso, T120SS • Pajero Sport/Dakar • Outlander Sport dan Mirage Ready stock! Hub: SIMARMATA, 0812 6484 8168 SUZUKI MOBIL PROMO 2013 Dp. Angsuran • Carry Pick Up Rp. 12Jtan 2,5Jtan • APV Pick Up Rp. 18Jtan 2,6Jtan • APV Arena Rp. 31Jtan 3,3Jtan • Ertiga Rp. 42Jtan 3,2Jtan • Swift Rp. 48Jtan 3,8Jtan Proses cepat + dapat hadiah, data dijemput. PT. Trans Sumatera Agung, Main Dealer Resmi Suzuki. CP: Prancis Sitohang, ST. HP 0812 6035 4787; BBM 29ED0041

dari Utan Kayu itu. Orangnya hitam, rambut agak keriting – merah lagi– dan tubuhnya relatif pendek. Jika ada nilai plus, bodinya memang lumayan sekel nan cemekel. Tapi biar jelek, duitnya banyak

LOWONGAN KERJA: Di butuhkan tenaga muda yang: • Komunikatif; • Energik; • bertanggung jawab; • pekerja keras dan; • siap bekerja di perusahaan yang bergerak di kota sibolga; • Memiliki kemauan untuk bekerja dalam team. Kami membutuhkan orang-orang yang mau bekerja, dengan Gaji yang memuaskan sesuai dengan kerja anda. Kami mengundang anda untuk wawancara langsung. Silakan Hubungi kami di: HP. 0852 6147 6803 ( ARIS )MENJUAL LANGSUNG & DICARI PENYALUR Kami Agen daging Ayam, kualitas dan merk terjamin. Tersedia ayam potong (ada tanpa tulang/kulit), Ikan Patin Fillet, Nugget Ayam/Ikan & Bakso. Produk "SEGAR&BEKU". Proses Halal,Sehat & Bersih. Cocok utk: Pesta, R.Makan, Restoran, Hotel, Rumah Sakit, Katering,Kantin dll. Hub : 082164061353, 082161149777

dia. Tiap bulan Hardo (nama samaran), suaminya yang jadi operator alat-alat berat di Negeri Jiran, kirim duit puluhan juta. Maka tak mengherankan rumah Maryati paling bagus dari tetangga yang lain. Selain gede, berkeliling pakai kaca, sehingga di dalam rumah istri Hardo ini macam kembang gulo dalam lodong (stoples). Meski bergelimang harta, sebagai wanita yang masih muda dan enerjik, sangat kesepian Maryati ini. Habis tiap malam hanya tidur sendirian. Maka diam-diam dia memberi perhatian khusus pada Wariyun tetangganya ini. Eh, siapa tahu dia bisa memberikan “solusi” sementara. Ternyata harapannya tak sia-sia, karena lelaki

tetangga ini memberi respon juga. Padahal motif Wariyun bukan sekadar pemenuhan rasa sepi. Ajakan mesum selalu diladeni, meski ibarat kata Wariyun harus menutup muka Maryati dengan kalender bergambar Ashanti atau Syahrini. Sebab pertimbangan politiknya, dengan pelayanan entong dia bisa membobol isi kantong. Dan ternyata benar. Karena dapat pelayanan istimewa, kiriman uang dari Malaysia yang selalu datang mengucur, Wariyunlah yang mengurusnya, sampai jumlahnya Rp650 juta. Ngakunya disimpan di bank, padahal resminya sebagian besar dikantongi sendiri. “Masak KPK akan ngurus korupsi beginian,” kata Wariyun.

SEMINAR BISNIS SEHAT DAN KAYA dengan NUTRISI USA; Tips dapat income (uang masuk) 3juta – 40 juta/ bulan. Sms Nama,Usia,Latar Belakang dan alamat rumah. Hubungi : 085714075855

DIJUAL: 1 Persil Tanah Ukuran 12x30 M persegi, di Jalan Hamonangan Pasaribu Pandan - Tapanuli Tengah. Lokasi dekat Kantor Bupati; Uk. 12x30 M2. Segera Hubungi: 0813 9616 6662

Gunakan FACEBOOK kamu untuk menghasilkan uang. Join OriflamedBCN. Info : Atau add FB saya : Lowongan Kerja PT. Columbia Cash & Credit. Butuh cepat!!!!! Posisi : REMEDIAL CONSUMER CREDIT ( kode : TF ). Persyaratan: - Pendidikan min SLTA/sederajat; - Memiliki sepeda motor dan Sim C; - Usia Max 40 tahun; Menyukai pekerjaan colektor.; Surat lamaran kerja ditujukan kepada: Personalia PT.Columbia Sibolga Jln. Patuan Anggi ( samping bank Danamon ) Terminal Sibolga ,atau hubungi langsung bapak J.Purba (085270165661)

I N V E S TA S I : P e r h a r i d a p a t 5 % selama 88 hari (Tanpa Rekrut). KLIK? w w w. a u t o m o n e x . c o m . / I D . 8 8 8 0 0 4 4 / SMS "BERMINAT" HP. 0878 01710 444; HP. 0813 7928 5333; Tel.021-41013414

DI KONTRAKAN RUKO Tiga Lantai Cocok untuk Usaha Rumahh Makan dan Lengkap peralatan Usaha, 2 kamar tidur ,nyaman, 3 kamar mandi. Alamat: Jl. Mojopahit Depan tangkahan Togu ,No. 263. Hub : 0823 6525 2060 (Parman); Usaha Rumah Makan masih tetap berjalan

Skandal Maryati baru terungkap saat suami pulang. Uang yang dikirimkan selama ini ternyata nyaris tak bersisa. Kata para tetangga buat foya-foya bersama tetangganya Wariyun. Tapi celakanya, jangankan lelaki itu mengakui perselingkuhannya, sedangkan uang yang Rp650 juta itu mengaku sudah habis. Untuk menguji kebenaran dan kejujuran “perampok” berdarah dingin ini, Hardo (40) sampai menantang Wariyun sumpah pocong. Ngakunya sih siap, tapi ketika sudah disiapkan properti, justru Wariyun tak menampakkan batang hidungnya. Terpaksa dia dilaporkan ke polisi. Enak Wariyun, sudah berhasil cuci uang, dapat cuci mata pula. (int)

DIKONTRAKKAN : 1 ( s a t u ) Rumah lebih cocok jadi Kantor atau Cabang Bank di Jl. M.T. Haryono No. 2 A. Hubungi Hp: 0852 6250 8868 atau 0853 7094 9988



6 April 2013

Pengganti Ketua KPU Harus Berpengalaman MEDAN - Komisi Pemilihan Umum Sumatera Utara (KPU Sumut) berharap agar segera menentukan pengganti Irham Buana Nasution yang telah mengundurkan diri sebagai Ketua KPU. Sebab, selama kekosongan tersebut, KPU kesulitan untuk mengambil keputusan karena hanya memiliki tiga anggota komisioner. Salah seorang komisioner KPU Sumut Rajin Sitepu, Jumat (5/4) mengatakan, pengganti Irham haruslah orang berpengalaman yang berasal dari KPU Sumut atau dari kabupaten/ kota, “Sebaiknya penggantinya berasal dari tubuh KPU itu sendiri. Sehingga dalam pelaksanaan tugas selanjutnya, tidak ada lagi kesulitan dan memang sudah memahami tugas tersebut,” ujarnya. Dia mengungkapakan, pengalaman sangatlah perlu. Sebab jika penggantinya datang dari lembaga luar, pasti membutuhkan proses lagi untuk mempelajari tugas-tugas pokok KPU. “Bayangkan jika orang luar yang ditunjuk sebagai pengganti Irham, itu bakal menjadi masalah. Sementara KPU Sumut saat ini sedang dihadapkan dengan Pemilihan Legislatif (Pileg) yang sudah ada di depan mata,” tegasnya. Dia mengatakan, dengan surat pengunduran Irham dan Turunan Gulo, kini KPU hanya memiliki tiga anggota komisioner. Itu sangat sulit dalam mengambil sebuah keputusan. “Kendala yang kami hadapi dengan pengunduran diri ini, kami akan sulit dalam mengambil keputusan. Dengan tiga anggota, rapat pleno yang kami lakukan tidak memenuhi kuorum. Minimal itu empat orang, baru bisa mengambil keputusan,” sebutnya. Menurut Rajin, seyogiyanya pengganti Irham nantinya adalah anggota yang berada dibawahnya. Yang menentukannya pengganti Irham, bukan dari wewenang KPU Pusat, melainkan KPU Sumut. Nantinya akan dilakukan rapat pleno untuk memilih ketua KPU yang baru. “Nanti jika ada dua komisioner yang baru untuk mengisi kekosongan Irham dan Gulo, baru dilakukan rapat pleno. Suara terbesar dari lima anggota komisioner yang menentukan siapa yang akan duduk sebagai ketua, menggantikan Irham Buana,” ujarnya.(ial/smg)

Pungli di Jembatan Timbang

Rentan Libatkan Banyak Pihak MEDAN- Ketua Komisi A DPRD Sumut Oloan Simbolon memberi apresiasi positif dan sangat setuju pengusutan dugaan pungli yang terjadi di jembatan timbang oleh oknum petugas di Dinas Perhubungan Sumut. Pasalnya, Oloan berkeyakinan, tidak tertutup kemungkinan kasus pelanggaran hukum tersebut melibatkan banyak pihak, baik dari internal Dishub Sumut maupun di luar instansi tersebut. “Pungli di jembatan timbang jangan justru menjadi alat kongkalikong berbagai pihak, karena praktik itu merupakan kejahatan yang sangat merugikankeuangandaerahdanmasyarakat,”kata Oloan, Jumat (5/4) Menurutdia,disinyalirpraktikpunglidijembatan timbang ini diperkirakan sudah lama berlangsung. Bahkan, ada juga pihak-pihak yang menginginkan perbuatan yang merugikan masyarakat dan keuangan negara ini berlangsung terus. Padahal, tindak kejahatan tersebut, kata politisi Partai Persatuan Daerah (PPD), sering dikeluhkan masyarakattanpaadaupayadantindakantegasdari penegak hukum. Karena itu, Komisi A yang salah satunya membidangi persoalan hukum, sangat mendukunglangkahtegasKejaksaanTinggiSumut, untuk mengungkap kasus pungli tersebut hingga tuntas. “Baru-baru ini, tim penyidik Kejatisu telah memanggildanmemeriksabeberapastafdanpejabat Dishub Sumut terkait dugaan pungli di jembatan timbang. Salah seorang pejabat yang telah memenuhi panggilan Kejatisu yakni Plt Sekretaris DishubSumutAliAmas,”ujarnya.(adz/smg)


GELAP- Seorang anak memasang lilin untuk menerangi ruangan. Di Sumut masih banyak kepala keluarga yang masih belum menikmati aliran listrik.

421.660 KK Sumut Belum Nikmati Listrik

MEDAN- Hingga Maret 2013, sebanyak 421.660 Kepala Keluarga (KK) di Sumatera Utara (Sumut) masih belum menikmati aliran listrik. Umumnya, mereka berasal dari desa ataupun dusun yang daerahnya masih tergolong sulit dijangkau. Sekretaris Dinas Pertambangan dan Energi Sumut Indra Ginting, Jumat (5/4) mengatakan, pemenuhan kebutuhan engeri listrik untuk KK di Sumut belum mencapat 100 persen. “Saat ini ada 2.611.977 pelanggan KK PLN di Sumut. Namun, rumahnya yang belum dialiri listrik sebanyak 421.660 pelanggan,” sebutnya. Kata dia, rasio elektrifikasi di Sumut hingga Maret 2013 masih sebesar 86,45%. Sementara jumlah KK yang belum

menikmati listrik itu, semuanya tersebar di 1.154 desa dari 5.779 desa yang ada. 165 desa atau dusun berasal dari Kabupaten Tapanuli Utara. “Itulah jumlah KK di Sumut yang belum dialiri listrik baik oleh PLN maupun non PLN,” ujarnya dihadapan peserta Musrenbang 2013 Pemprovsu di Santika Hotel Medan. Ia memprediksi, jumlah KK yang belum dialiri listrik itu akan terus bertambah di masa depan. Sebab, prediksi itu mengacu

kepada rasio pertumbuhan kebutuhan listrik di Sumut yang rata-rata mencapai 7 persen per tahun. Sementara menurut data Bank Indonesia pada triwulan II-2012, Sumut mencatat pertumbuhan ekonomi sebesar 6,29 persen. “Kalau mengacu pada data tersebut, maka kebutuhan listrik pada tahun 2013 mengalami kenaikan 101,08 MW (mega watt) atau menjadi 1.545,08 MW dari 1.444 MW pada Waktu Beban Puncak (WBP) di tahun 2012, dengan daya mampu system sebesar 1.539 MW,” lanjutnya. Indra menjelaskan, berdasarkan daya mampu sistem pembangkitan Sumut pada

2012, maka cadangan listrik ideal yang dimiliki harus sebesar 461,7 MW. Namun, akibat kondisi mesin pembangkitan yang sudah uzur dan adanya komponen yang tidak diproduksi lagi, menyebabkan kelebihan daya listrik dari daya mampu hanya sebesar 95 MW. “Sehingga, apabila terjadi kerusakan di salah satu pembangkit utama di PLTGU Sicanang, Belawan atau Paya Pasir, maka pasokan listrik pasti akan terganggu. Kondisi inilah yang dialami KK Kota Medan dalam beberapa pekan terakhir,” tutut Indra.(ram/smg)

Ikan Habis Dipukat , Nelayan Terjepit Jembatan Layang Simpang MEDAN- Peringatan Hari Nelayan Nasional kali ini masih mengidentikkan kawasan pesisir Indonesia sebagai kantong kemiskinan. Begitu juga dengan Sumatera Utara (Sumut), kesejahteraan nelayan tradisional jauh dari harapan. Salah satu penyebabnya karena ikan semakin habis, lingkungan rusak, illegal fishing semakin merajalela dan banyak persoalan lain. “Nasib nelayan tradisional dari dulu sampai sekarang tak berubah, begini-gini saja,” kata Jamaludin, Ketua Pelaut Rakyat Penunggu Indonesia di Desa Paluh Sibaji, Kecamatan Pantai Labu, Kabupaten Deli Serdang, Jumat (5/4). Menurut Jamal, 20 tahun lalu, nelayan dengan mudah mendapatkan ikan dengan memancing di pinggiran pantai. Ibu-ibu sebagai nelayan perempuan bisa mencari kepah dan kerang di pinggiran pantai dan berpenghasilan lebih dari Rp 75 ribu per hari. Penghasilan ini membantu ekonomi keluarga. Selain pendapatan suami yang saat itu lebih besar, karena tangkapan banyak dan harga bagus. Hanya dengan

peralatan sederhana, hasil tangkapan nelayan terbilang besar, meski lokasi tak sampai 10 mil dari garis pantai. ”Dulu mudah sekali menangkap ikan, istilahnya, dengan memancing sambil menghanyut, bisa dapat ikan karena jumlah melimpah,” kata Jamal lagi. Menurut dia, seiring pergeseran waktu terjadi perubahan drastis. Ikan semakin sulit didapat karena lingkungan rusak. Terumbu karang yang menjadi tempat pemijahan ikan hancur dengan beroperasinya pukat trawl di wilayah tangkap nelayan tradisional. Padahal, menurut Jamal, tidak ada satu pun regulasi yang membenarkan operasional pukat dengan jenis apapun di perairan Sumut. “Mau pukat teri, pukat grandong sampai pukat harimau, tidak boleh beroperasi,” kata Jamal. Kenyataannya, nelayan tradisional kerap kesulitan lantaran jaring yang di pasang habis di angkut pukat trawl yang beroperasi di lokasi sama. Pukat menyapu habis semuanya. “Kalau pukat

sudah main, ikan kecil, ikan besar, sampai terumbu karang dan apa pun yang ada di dalam laut bisa habis di sapu,” ujarnya. Akibatnya, nelayan terpaksa mencari ikan di wilayah yang semakin jauh ke laut lepas bahkan sering ke perbatasan perairan Indonesia dan Malaysia. Di sini, para nelayan berhadapan dengan kapal-kapal besar pencari ikan dengan kapasitas ribuan ton. Mereka pun terpaksa mengambil risiko ditangkap patroli Malaysia. Jika tertangkap, seluruh hasil tangkapan berikut peralatan tangkap dirampas dan disuruh kembali ke darat dengan minyak yang tersisa. ”Itu masih untung, kalau tidak dipukuli, atau di penjara di Malaysia,” ucapnya sedih. Jamal menilai, seharusnya ada perlindungan terhadap nelayan tradisional. Misalnya dengan jaminan 12 mil dari garis pantai bebas dari operasional kapal penangkap ikan yang peralatannya modern. “Jangan sampai bercampur di lokasi yang sama dan saling berhadapan, n e l a y a n t r a d i s i o n a l p a sti kalah,” kata Jamal.(kps/int)

Pos Selesai Akhir 2014

MEDAN- Pembangunan jembatan layang atau (fly over) di Simpang Pos, Kota Medan, diperkirakan selesai pada akhir 2014, karena saat ini pembangunannya telah berjalan. “Jika tidak ada arah melintang, pembangunan fly over Simpang PosiniakanselesaipadaDesember 2014. Untuk itu, kita akan terus bekerja keras merealisasikannya,” kata Kepala Satuan Kerja Pelaksanaan Jalan Nasional Metropolitan Medan Mula Tua Sinaga di Medan, Kamiskemarin. Menurut dia, saat ini pihaknya fokus pada penyelesaian pembangunanflyoverSimpangPos.Setelah itu akan fokus dua fly over lagi yakni flyoverPinangBarisdanflyoverJalan Gatot Subroto. Kemudian underpassTitiKuningdiJalanBrigjenKatamso. “Untuk pembangunan underpass Titi Kuning, kini dalam tahap studi.PembangunanflyoverPinang Baris sudah dalam tahap desain. Sedangkan satu lagi, kita sekarang sedang berjuang untuk membangunflyoverJalanGatotSubroto.Sehinggadapatmenjadibagianflyover yang ada di Kota Medan,” katanya.

Wali Kota Medan Rahudman Harahapjugamenyempatkanmeninjau pembangunan jalan fly over Simpang Pos tersebut. Kedatangannya untuk mengetahui sejauh mana proses pembangunan yang sudah dilakukan. “Wali Kota juga ingin mengetahui apa yang menjadi kendala, sehingga mengganggu kelancaran pembangunan jembatan layang kedua di ibukota provinsi Sumut ini setelah fly over Pulo Brayan tersebut,” paparnya. MenurutMulaTua,darihasilpeninjauan yang dilakukan, ia menilai prosespengerjaanjembatanflyover SimpangPosyangdilakukansaatini termasukcepat.Rencananya,bulan ini,kirikananjalansudahbisadipergunakan supaya full pembuatan tiangtengah.Sebab,titikfokuspembangunan fly over adalah tiang tengah ini. “Karena itu saya berharap jangan ada lagi kendala-kendala sehingga mengganggu kelancaran pembangunan fly over,” ujarnya. Berdasarkan informasi yang diperoleh, kata dia, salah satu kendalayangmengganggukelancaran pembangunan fly over terkait terjadinya kemacetan arus lalu lintas. (ant/int)


6 April 2013

Ayo, Dukung Polisi Berantas Premanisme SIDIMPUAN- Pemerhati kepolisian Malik Assalih Harahap, menegaskan hukum adalah tiang utama dalam aturan penegakan masalah di Indonesia. Untuk itu, negara tidaklah boleh kalah dengan bentuk premanisme dan penyakit masyarakat. “Premanisme harus diberantas. Judi dalam bentuk apapun bentuknya harus diberantas. Sebab, judi sumber dari kejahatan selain narkoba. Untuk itu, ayo kita dukung polisi memberantas premanisme dan judi,” kata Malik, kemarin. Dia mengatakan, Polri sebagai yang bertugas memelihara keamanan dan ketertiban masyarakat harus berani menindak premanisme dan memang benar-benar menegakkannya. “Agar tindak kejahatan tidak terjadi, negara tidak boleh kalah dengan bentuk premanisme,” tambah Malik yang dikenal dekat dengan para petinggi Polri ini. Ia juga mendukung sepenuhnya komitmen Kapolres Psp

Lapas Sibolga Over Kapasitas

AKBP Budi Hariyanto untuk menyikat habis segala bentuk perjudian, pekat dan juga premanisme di Kota Psp. Menurutnya, pemberantasan judi, pekat dan premanisme merupakan atensi dari Kapolri Jenderal Pol Timur Pradopo dan Kapoldasu Irjen Pol Wisjnu Amat Sastro. “Jadi apa yang dilakukan Kapolres Psp sudah merupakan tindakan yang tepat. Kita apresiasi langkah dan tindakan Kapolres yang tidak kenal kompromi dengan tindakan perjudian, pekat dan premanisme di Psp,” ujarnya. Kemudian, sambung Malik, untuk masalah razia pekat yang dilakukan Polres Psp sudah merupakan langkah yang tepat dan patut didukung semua pihak di Kota Psp. “Karena Kota Psp selama ini dikenal sebagai kota religius dan masyarakatnya taat beribadah. Walaupun ini sebenarnya sudah menjadi tugas Polri, tapi apresiasi yang setinggi-tinginya patut kita acungkan terhadap Kapolres Psp,” jelasnya. (phn)

AKP Binsar Siahaan Jabat Kasat Intelkam Sambungan Halaman 8 “Semoga pejabat yang baru juga bisa cepat menyesuaikan diri. Tugas Intelkam sangat berat,” kata Joas. Sertijab ditandai dengan pelepasan pin jabatan pejabat

lama dan penyematan pin jabatan kepada pejabat baru. Dilanjutkan dengan penandatanganan surat peralihan tugas antara kedua pejabat. Malam harinya, dilaksanakan acara pisah sambut di Hotel Wisata Indah Sibolga. (mora)

PNS Tapteng Belajar Bahasa Inggris Sambungan Halaman 8 bahasa komunikasi internasional. Dalam tugas sebagai abdi negara, PNS juga berhubungan dengan dunia internasional. Karena itu, PNS dituntut mengusai bahasa Inggris, baik tulisan maupun lisan. “Di zaman sekarang, penguasaan bahasa Inggris dituntut pada hampir semua bidang. Kami sendiri mulai private April nanti. Gurunya sudah oke, sudah ada dan jadwalnya dua kali dalam seminggu pada jam kerja. Targetnya sampai mahir. Seluruh pegawai harus ikut,” ujar Darmi. Evi Marini Simanjuntak, guru English private yang akan mengajar PNS di Dinas Kehutanan dan Perkebunan Tapteng mengatakan, ada empat keahlian kunci dalam mempelajari sebuah bahasa, termasuk bahasa Inggris. Di antaranya listening (menden-

garkan), speaking (berbicara), reading (membaca) dan writing (menulis). Tapi yang memiliki tantangan dan keunikan tersendiri tentu speaking. Speaking, kata Evi berbeda dari listening , reading dan writing (menulis). Ketiganya mungkin bisa dilakukan sorang diri, sesuai keinginan. Tanpa memerlukan bantuan orang lain. Misalnya, bisa mendengar radio, baca buku, menulis surat sendiri. “Tapi kita tidak bisa berbicara sendiri. Coba saja bicara sendiri, nanti malah kita yang dianggap gila. Nah, program belajar English yang dicanangkan Pemkab Tapteng bagi para PNS setidaknya agar mampu untuk speaking. Dalam era globalisasi, apalagi Tapteng sebagai daerah wisata, tentu menuntut aparatur pemerintahnya bisa berbahasa Inggris. Itu sebuah pemikiran yang maju,” ucapnya. (mora)

Sambungan Halaman 8 siang, malam dan waktu istirahat. Seharusnya untuk regu pengamanan idealnya 15 orang setiap shift-nya. Selain kekurangan pegawai, kita juga sangat kekurangan alat pengamanan,” ungkapnya. Mantan Kalapas Narkotika Jogja ini menuturkan, untuk ruang kunjung, Lapas Sibolga juga sangat membutuhkan renovasi. Sebab tak jarang pihak lapas mempergunakan teras kantor sebagai tempat penerimaan tamu tahanan. “Saat ini ruang kunjung kita hanya berukuran 4x6 meter

untuk jumlah tahanan 500 orang. Kadang kita ambil alternatif dengan memanfaatkan teras kantor untuk bertamu. Karena kalau tidak kita lakukan seperti itu, maka antrean di luar lapas akan sangat panjang,” terangnya. Pria yang baru satu tahun menjabat Kalapas Sibolga ini juga menceritakan, saat ini lapas sudah membina beberapa orang tahanan dengan berbagai keterampilan seperti bagian pertukangan dan menjahit pakaian. “Kalau dilihat hasil yang mereka buat itu tak kalah dengan yang ada di luar sana. Bahkan, sekarang pakaian saya di-

jahit oleh tahanan. Saya bangga dengan kemajuan yang mereka alami. Saat ini hanya itu keterampilan yang kita bina, karena kekurangan tenaga pekerja. Saat melakukan pelatihan kita membutuhkan perhatian dan pengawasan yang ketat, jadi harus membutuhkan pengawas yang sesuai jumlah yang diawasi,” katanya. Oleh sebab itu Marasidin sangat mengharapkan bantuan dari pemerintah untuk penyesuaian pegawai dengan jumlah tahanan yang ada, serta perluasan daerah agar dapat menampung semua penghuni lapas dengan jumlah

yang ideal untuk per ruangan tahanan. Karena di Sibolga belum mempunyai lapas khusus narkotika, sehingga harus digabung dengan tahanan pelaku kejahatan lain. “Sebenarnya kita sudah sering ajukan permohonan ke pemerintah pusat untuk penambahan anggota dan perluasan wilayah. Agar jumlah pegawai dengan jumlah tahanan sesuai untuk mengoptimalisasi pekerjaan kita. Juga untuk jumlah ruang tahanan yang tak lagi memadai, kita sudah ajukan agar dilakukan penambahan ruangan sehingga per ruangan dapat diisi lima or-

ang, tidak seperti sekarang sampai sembilan orang per ruangan,” tandasnya. “Kami selalu menunggu realisasi dari pemerintah untuk permohonan yang telah kita ajukan. Mudah-mudahan pemerintah memenuhi permohonan kami agar kegiatan di lapas ini bisa lebih dioptimalkan lagi,” pungkasnya. Pantauan METRO, akibat jumlah tahanan yang membludak serta ruang tamu tahanan yang tidak memadai, membuat antrean panjang para pengunjung lapas yang hendak menjenguk tahanan sering terjadi. (samuel)

RESES DI ANDAM DEWI Sambungan Halaman 8 Menanggapi aspirasi warga tersebut, Jhonny mengatakan bahwa hal tersebut sudah menjadi perhatian pemerintah untuk tahun mendatang. Kemudian, M Simamora (65), salah seorang warga menanyakan perihal kartu sehat dan fungsinya kepada masyarakat.

Jhonny lalu menjelaskan bahwa kartu sehat diberikan kepada warga yang tidak mampu dalam berobat, dan itu menjadi tanggungan pemerintah. “Dengan adanya kartu jaminan kesehatan masyarakat (jamkesmas) diharapkan warga mendapat jaminan kesehatan, karena pemerintah sudah mengalokasikan anggaran

untuk memberikan pelayanan kesehatan yang lebih baik. Jadi, bapak ibu tidak usah takut berobat kalu tidak ada biaya,” ujarnya. Dia mengutarakan, saat ini mengurus KTP, kartu keluarga, jamkesmas, gratis. “Hal ini sangat dibutuhkan kalau bapak ibu berobat ke rumah sakit. Saya berjanji akan membantu kalau ada kendala dalam pelayan

kesehatan. Saya siap membantu, silahkan telepon saya atau datang ke rumah saya,” ujarnya. Jhonny menambahkan, dirinya tidak berarti apa-apa tanpa dukungan dan doa restu dari warga daerah pemilihannya. “Saya tidak ada artinya tanpa bapak dan ibu. Saya ada karena bapak dan ibu sekalian yang mendukung saya untuk

duduk menjadi wakil rakyat. Saya berharap agar warga kembali mendukung saya untuk maju di pileg berikutnya,” pungkasnya. Tumbur Simatupang dan sejumlah warga lainnya mengatakan, dia bersama warga lainnya siap memberi dukungan penuh kepada Jhonny Lumbantobing untuk tetap maju di pileg 2014 mendatang. (gideon)

Pawai 1.000 Obor Meriahkan Perayaan Paskah Sambungan Halaman 8 da peserta pawai merupakan agenda tahunan di Barus Utara. Pawai seribu obor ini merupakan simbol bahwa manusia sudah terbebas dari kekuatan jahat, seperti peristiwa kebangkitan Yesus yang

telah membebaskan manusia dari belenggu dosa. Sepanjang perjalanan pawai, ribuan orang membawa obor api berjalan dengan tertib sambil menyanyikan lagu-lagu rohani sebagai penyemangat pawai. Berbagai jemaat gereja yang

turut dalam pawai, di antaranya Gereja HKBP Sihorbo, Gereja Advent, Gerja Katolik,Gereja Bethel. Pendeta HKBP Sihorbo Wesly Sianturi dalam khotbahnya mengatakan, kebangkitan Yesus telah mengalahkan kuasa maut. Pengorbanan

Yesus telah memberi kepastian bagi orang yang percaya kepadaNya agar tidak binasa, tetapi memperoleh hidup yang kekal. I a jug a m e nut u r ka n , pawai seribu obor merupakan kegiatan religius keimanan bagi umat Kristiani

karena untuk mengenang kebangkitan Yesus Kristus dari kematian. Ia menambahkan, setiap umat Kristiani yang teguh dan menjalankan ajaran Yesus Kristus, percaya dengan kebangkitan Yesus Kristus dari kematian. (gideon)

BI Beri Bantuan Usaha Gula Merah Sirandorung Sambungan Halaman 8 perternakan ayam ras di 10 lokasi dan tanaman holtikultura lainnya,” sebutnya. Di kesempatan itu, Yiyok juga berharap agar packing (kemasan) produk gula merah Sirandorung ini lebih terkemas rapi dan efisien. Bahkan, Yiyok mengajak para pelaku usaha mikro maupun petani produk gula merah untuk melakukan studi banding ke daerah penghasil gula merah yang sudah memiliki hasil gemilang. “Untuk itu, BI Sibolga akan membentuk desa binaan home industry gula merah ini guna meningkatkan kualitas dan manajemen usaha kerakyatan ini,” ungkapnya. Ketua Koperasi Saiyo

Sakato, Dameria Munthe mewakili para pelaku usaha dan petani gula merah mengucapkan terima kasih atas bantuan dan perhatian BI Sibolga. Dia mengatakan, petani yang tergabung di koperasi yang dipimpinnya saat ini berjumlah 350 orang. Dameria menceritakan, koperasi usaha home industry gula merah asal Sirandorung sudah digeluti sejak tahun 2000. Semula, kata dia, petani hanya mampu menghasilkan gula merah empat ton per minggu dengan harga jual Rp1.100 per kilogram. “Awalnya kami sangat kesulitan dalam masalah pemasaran gula merah ini. Namun berkat kerja keras bersama sehingga pemasaran semakin menggairahkan

hingga Kota Tebing Tinggi, Perbaungan dan daerah lainnya,” bebernya. Saat ini, lanjut dia, Koperasi Saiyo Sakato sudah menghasilkan gula merah sedikitnya 10 ton per minggu dengan harga pasar Rp4.000Rp4.500 per kg. “Namun, untuk memajukan usaha gula merah ini, kami mengharapkan agar Pemkab Tapteng memberi bantuan bibit kelapa Hibrida. Mengingat, kondisi pohon kelapa petani gula merah sudah tidak produktif akibat usia. Sekaligus, bantuan dana dalam pengembangan usaha,” tukas Dameria didampingi Manajer produksi, Syarifuddin Simatupang ditemui disela kegiatan sambil menyampaikan, agar produk

gula merah Sirandorong direkomendasikan hak patennya. Sementara, Bupati Tapteng Raja Bonaran Situmeang juga menyampaikan, ucapan terima kasih atas perhatian BI Sibolga kepada masyarakat Sirandorung dalam memacu ekonomi kerakyatan. Bupati berpesan, agar antara anggota koperasi tidak saling kecil hati akibat belum mendapat kesempatan menerima bantuan. “Bantuan itu diharap dapat dimanfaatkan dengan baik. Pengembangan packing (kemasan) gula merah juga lebih ditingkatkan agar sejalan dengan program Negeri Wisata Sejuta Pesona sebagai produk suovenir. Pemkab Tapteng nanti akan membentuk tim Litbang khusus produk gula merah ini,

agar pada gilirannya produk gula merah Sirandorung bisa tembus ke pasar nasional,” imbuh Bupati. DESA BINAAN Bonaran juga sangat mendukung program BI Sibolga berniat membentuk desa binaan produk home industri. Sehingga, kata dia, manajemen dan marketing produk gula merah ini lebih tertata dan unggul ke depan. Hadir dalam acara itu, segenap pimpinan perbankan Sibolga, unsur Muspika Sirandorung dan Manduamas, Kadis Dakopin Tapteng Surya Darma dan tokoh masyarakat setempat. Kegiatan juga dirangkai penyerahan tali asih BI perwakilan Sibolga kepada 14 anak yatim dan 12 Lansia di daerah setempat. (mas)

Senin, Film Mursala di Plaza Senayan

Jalan Kaki Tembus Hutan, Honor hanya Rp150 Ribu Sebulan

Sambungan Halaman 1

Aktivitas mengajar tetap dipertahankannya sekalipun telah menikah dengan Ritonga (27). Sekitar empat tahun terakhir, ia harus menempuh jarak yang cukup jauh ke sekolah. Karena ia ikut suami dan tinggal di Desa Baringin, Kecamatan Dolok, Kabupaten Padang Lawas Utara (Paluta). “Saya ingin terus mengabdikan diri berbagi ilmu dengan anak-anak kampung kelahiran saya. Apalagi di sana, tenaga saya masih dibutuhkan,” ujarnya sambil

Tapteng akan semakin dikenal luas hingga ke dunia internasional. Dia mengakui, film tersebut salah satu media promosi Tapteng sebagai daerah berjuluk Negeri Wisata Sejuta Pesona. Sekaligus mendorong aliran pembangunan di salah satu daerah termiskin di Sumut itu. “Syutingnya bahkan dilakukan sampai ke bawah laut perairan Tapteng yang mempesona. Terumbu karangnya luar biasa. Harapannya Tapteng tidak lagi menjadi daerah tertinggal. Jika industri pariwisata di Tapteng bertumbuh, maka masyarakat Tapteng juga turut merasakan dampak positifnya,” kata Sukran. Senada diungkapkan Anna Leiden Sinaga, produser sekaligus pemeran film itu. Dia mengatakan, film Mursala mengusung cerita budaya dan adat Batak yang dikemas secara modern. Bahkan, Menteri BUMN Dahlan Iskan mengaku terkesan dan sangat menikmati menonton film garapan Raj’s Production itu. “Film besutan sutradara Viva Westi ini bercerita tentang budaya Batak Toba. Sepasang anak manusia dihadapkan dengan kisah cinta terlarang karena adat Batak tidak mengizinkan perkawinan satu rumpun marga. Kebetulan dalam film ini mengangkat rumpun marga Parna,” beber Anna. Sebagian besar syuting film itu diambi di situs bersejarah di Tapteng. Menonjolkan pesona pantai dan laut Tapteng. Sedangkan judul Mursala sendiri diambil dari nama sebuah pulau di perairan Tapteng yang memiliki keunikan tersendiri, ada air terjun tawar yang airnya langsung jatuh ke laut. Penyanyi legendaris Iwan Fals, secara khusus menciptakan lagu berjudul ‘Mursala’ untuk mengisi soundtrack film tersebut. Mursala dibintangi sejumlah aktor dan aktris papan atas Indonesia, seperti Rio Dewanto, Titi Sjuman, Tio Pakusodewo, Rudi Salam, Mongol, Roy Ricardo, serta pengacara Elsa Syarief. “Film Mursala diproduksi sepenuhnya oleh kekuatan modal sendiri bersama sejumlah sponsor. Setelah gala premiere, film ini akan premiere di Medan pada 17 April 2013. Selanjutnya pada tanggal 18 April kami roadshow di Jakarta, Surabaya dan Medan,” beber Anna seraya menambahkan film Mursala sudah terdaftar di Festival Film Indonesia (FFI). (mora)

Sambungan Halaman 1

menjelaskan dalam seminggu dirinya hanya masuk tiga kali saja. Lebih lanjut, Alumni D2 kependidikan Universitas Muhammadiyah Tapanuli Selatan (UMTS) tersebut mengungkapkan, pada hakikatnya upah yang diterimanya dalam mengambdikan diri di bangku sekolah tidaklah memenuhi kebutuhan hidup. Namun karena dorongan ingin tetap mengajar, berbagi ilmu dan juga berharap adanya perhatian pengangkatan status honor menjadi Pegawai Negeri Sipil (PNS), dirinya terus bertahan dengan penuh kesabaran. Sekalipun untuk memenuhi

kebutuhan hidup harus dibarengi membantu suami dengan kerja keras di sawah, ladang dan kebun milik mereka. “Selain mengajar, saya membantu suami bertani, kadang ke sawah, ke kebun untuk menderes agar kebutuhan ekonomi keluarga bisa terpenuhi,” sebutnya. Ia mengaku hanya menerima honor sekali dalam tiga bulan (per triwulan) dengan jumlah Rp450 ribu. Ketika mengarungi hutan lebat menuju tempat mengajar, Siti Mariani mengaku, sama sekali tidak merasa takut lagi, walau harus berjalan sendiri.

“Saya sudah biasa mungkin dengan lingkungan hutan ini, hanya takut hujan saja. Dan terkadang akibat hujan saya jadi sering terlambat,” ucapnya sambil menjelaskan untuk menempuh sekolah dibutuhkan waktu satu hingga 1,5 jam. Di hadapan Sekda Tapsel Aswin Siregar yang kebetulan berada di lokasi ketika perbincangan awak koran ini dengannya, Siti Mariani juga berseloroh dengan harapan agar ada perhatian pemerintah terhadap guru seperti dirinya. “Kalau bisa ada kejelasanlah Pak,” ucapnya. (***)

Panitia UN Antisipasi Serangan Fajar Sambungan Halaman 1 Kepala Badan Standarisasi Nasional Pendidikan (BSNP) M Aman Wirakartakusumah menuturkan, indikasi praktik serangan fajar hampir selalu terjadi setiap kali pelaksanaan UN. “Pelaku utamanya diduga para guru yang direkrut menjadi tim sukses UN,” katanya di Jakarta, kemarin (5/4). Tim sukses ini direkrut secara berjenjang. Mulai dari dinas pendidikan kabupaten/kota hingga di jenjang satuan pendidikan. Guru yang masuk dalam tim sukses inilah yang bertugas mengerjakan lembar jawaban. Kemudian hasilnya disebar ke siswa melalui pesan singkat (SMS). Cara itu dilakukan

menyiasati lemahnya pengawasan. Aman mengatakan, potensi serangan fajar itu cukup besar. Hal itu karena jumlah variasi soal yang hanya lima jenis untuk setiap ruang ujian. “Jadi, kalau naskah itu diambil pukul 05.00 waktu setempat, masih ada jarak waktu yang panjang hingga UN berjalan (pukul 08.00),” katanya. Rata-rata perjalanan mengambil naskah ujian dari rayon ke sekolah adalah 15 menit hingga 30 menit. Nah, tahun ini potensi para guru personel tim sukses untuk mengerjakan soal UN kecil. Sebab, jumlah variasi soal saat ini dipatok 20 jenis per ruang ujian. Selain itu, UN 2013 berlangsung lebih pagi, yakni pukul 07.30

waktu setempat. Kepala Pusat Penilaian Pendidikan (Kapuspendik) Kementerian Pendidikan dan Kebudayaan (Kemendikbud) Hari Setiadi mengatakan, kalaupun guru personel tim sukses mampu menyelesaikan soal, mereka akan kesulitan menandai kunci jawaban itu untuk kode soal nomor berapa. Tahun lalu setiap variasi lembar ujian memiliki kode tertentu, yakni kombinasi angka dan huruf. Untuk UN 2013, kode naskah ujian tidak lagi dimunculkan dalam bentuk huruf dan angka. “Kode hanya muncul dalam gambar barcode (kode batang, Red),” tandasnya. Untuk menekan potensi serangan fajar, guru

mata pelajaran yang di-UN-kan diliburkan dan tidak boleh ada di lingkungan sekolah. Sementara itu, Inspektur Jenderal (Irjen) Kemendikbud Haryono Umar mengatakan, pengawasan distribusi naskah ujian dari rayon hingga ke sekolah akan diperketat. Personel pengawas dari perguruan tinggi akan diperkuat. “Tim Itjen Kemendikbud tidak berwenang penyelidikan. Jadi tidak bisa melakukan spy (mata-mata, red) dan lain-lainnya. Itu nanti polisi, kita hanya mengaudit,” kata mantan pimpinan Komisi Pemberantasan Korupsi (KPK) itu. (wan/ca/jpnn)

Sibolga Rawan Gangguan Kamtibmas Sambungan Halaman 1 atau nelayan. Jika hasil laut menurun, atau hasiltidakmencukupikebutuhanekonominya, maka rentan gangguan kamtibmas,” tukas Joas dalam amanatnya saat memimpin upacara SertijabKasatIntelkamPolresSibolga,Jumat(5/

4). Joas mengakui, angka kasus narkoba, perjudiandancuranmorcukupmenonjol.Selain itu,suhupolitikjugatinggidalamprosesPilgubsu yang masih berjalan. Di mana saat ini masih menunggu keputusan Mahkamah Konstitusi (MK). “Sangatpentingmendeteksidanpencegahan

dini gangguan kamtibmas yang terkait dengan dinamikapolitik.Polrijugaharusmengamankan hasil keputusan sengketa Pilgubsu oleh MK nanti. Seperti antisipasi gejolak oleh para pendukung calon. Begitu juga menghadapi Pemilu 2014 mendatang,” ungkapnya. Di kesempatan itu, Kapolres menyampaikan

apresiasi atas kinerja Satuan Intelkam. Di mana situasi kamtibmas tetap kondusif. “Saya mengapresisi Sat Intelkam karena mampu mendeteksi dan memberi masukan untuk penanganan dini terhadap tiap gejolak yang timbul di masyarakat,” pungkasnya. (mora)


6 April 2013

AKP Binsar Siahaan Jabat Kasat Intelkam Polres Sibolga SIBOLGA- Kapolres Sibolga AKBP Joas Feriko Panjaitan memimpin upacara serah terima jabatan (sertijab) Kasat Intelkam, di halaman Mapolres setempat, Jumat (5/4). AKP Binsar Siahaan menggantikan AKP Tri Suroso. “Mutasi jabatan adalah hal biasa dan wajar di institusi Polri. Itu merupakan bagian dari promosi jabatan dan penyegaran struktur,” ucap AKBP Joas dalam amanatnya. AKP Tri Suroso menjadi Kasat Intelkam Polres Langkat. Sedangkan AKP Binsar Siahaan sebelumnya menjabat Panit IV Subdit I Dit Intelkam Poldasu. AKBP Joas mengapresiasi kinerja AKP Tri Suroso selama bertugas di Polres Sibolga, tepatnya selama 2 tahun 8 bulan. Itu terbukti dengan terjaganya kundusifitas kamtibmas di Kota Berbilang Kaum itu. “Terimakasih, saya mengapresiasi kinerja AKP Suroso selama bertugas di sini. Semoga juga sukses di tempat tugas yang baru,” tukasnya. Sebaliknya, Kapolres berharap pejabat baru juga mampu menjalankan tugas dengan baik.

‹ ‹ Baca AKP Binsar..Hal 7

Lapas Sibolga Over Kapasitas SIBOLGA- Lembaga pemasyarakatan Sibolga over kapasitas. Lapas yang mestinya dihuni 332 orang, saat ini dihuni 500 tahanan. Peningkatan jumlah tahanan di Lapas Sibolga diakibatkan maraknya peredaran narkoba di Sibolga dan Tapteng. Saat ini lapas mayoritas dihuni oleh tahanan kasus narkoba atau sebesar 45 persen. “Sejak peredaran narkoba meningkat, penghuni lapas mengalami over kapasitas. Seharusnya kapasitas lapas hanya 332 orang atau lima orang untuk satu ruang tahanan. Tapi saat ini kita menampung 480-500 orang tahanan atau sembilan orang per ruangan,” ujar Kepala Lapas Sibolga

Marasidin Siregar kepada METRO, saat ditemui di ruang kerjanya, Jumat (5/4). Marasidin mengakui optimalisasi kerja mereka menjadi kurang karena tidak sesuai lagi jumlah pegawai dengan

„ Pawai seribu obor.

Dia mengatakan, pawai seribu obor dimulai pukul 18.00 WIB yang melibatkan berbagai jemaat. Masing-masing peserta membawa obor yang menggambarkan kegembiraan masyarakat dalam menyambut perayaan Paskah. Camat Barus Utara Todo Sipahutar mengatakan, perayaan Paskah yang dimeriahkan oleh pawai seribu obor dan pemberian hadiah kepa-

‹ ‹ Baca Pawai ..Hal 7

‹ ‹ Baca Lapas ...Hal 7

Reses di Andam Dewi TAPTENG- Anggota Komisi B DPRD Tapteng Jhonny Lumbantobing melaksanakan reses di Desa Bondar Sihudon I, Kecamatan Andam Dewi, Sabtu (30/3) lalu. Jhonny menuturkan, reses yang dilaksanakannya tersebut untuk mendengar aspirasi masyarakat atau permintaan warga. Dalam resesnya terungkap persoalan seperti rusaknya beberapa irigasi di Desa Uratan, Kecamatan Andam Dewi.

Pawai 1.000 Obor Meriahkan Perayaan Paskah BARUS UTARA- Ribuan umat Kristen dari enam desa di Kecamatan Barus Utara, Tapteng, merayakan Paskah dengan menggelar pawai seribu obor mengelilingi Desa Huta Ginjang dan Sihorbo, Minggu (31/3) lalu. “Pawai seribu obor ini dalam rangka perayaan Paskah mengenang kebangkitan Yesus Kristus dari kematian,” ujar ketua panitia perayaan Paskah Anwar Pasaribu, kemarin.

jumlah tahanan yang ada. “Saat ini kita hanya punya 42 pegawai, terdiri dari 25 orang regu pengamanan yang dibagi dalam empat shift , pagi,

Anggota DPRD Tapteng

(foto: marihot simamora)

„ Kapolres Sibolga AKBP Joas F Panjaitan menyematkan tanda jabatan kepada Kasat Intelkam yang baru AKP Binsar Siahaan, yang menggantikan pejabat lama AKP Tri Suroso, Jumat (5/4).

(foto: samuel)

„ Kalapas Sibolga Marasidin Siregar saat diwawancarai di ruang kerjanya, Jumat (5/4).

‹ ‹ Baca Reses ...Hal 7 „ Reses anggota DPRD Tapteng di Kecamatan Andam Dewi.

BI Beri Bantuan Usaha PNS Tapteng Belajar Bahasa Inggris Gula Merah Sirandorung TAPTENG- Bank Indonesia perwakilan Sibolga memberi bantuan peralatan usaha mikro petani gula merah di Kelurahan Bajamas, Kecamatan Sirandorung, Tapteng, Senin (1/4). Bantuan berupa kuali sebanyak 100 unit untuk memasak gula merah dari sari kelapa hibrida yang menjadi produk unggulan daerah itu yang dikelola Koperasi Saiyo Sakato.

Deputi Direktur BI perwakilan Sibolga Yiyok T Herlambang menyatakan, BI tetap konsisten melakukan pengembangan komoditi unggulan daerah khususnya wilayah kerja BI Sibolga. “Termasuk home industry produk gula merah ini. Sebelumnya, BI juga memberikan bantuan bagi

‹ ‹ Baca BI ..Hal 7


„ Deputi Direktur BI Sibolga Yiyok T Herlambang (dua kanan) bersama Bupati Bonaran Situmeang menyerahkan kuali bagi petani gula merah tergabung dalam Koperasi Saiyo Sakato di Kelurahan Bajamas, Sirandorung.

PANDAN- Semangat Pemkab Tapteng dalam mewujudkan program Negeri Wisata Sejuta Pesona diwujudkan dengan meningkatkan kualitas para PNSnya. Salah satu strateginya, PNS di kabupaten tersebut diwajibkan belajar Inggris. “Ya, program belajar bahasa Inggris ide Bupati Tapteng tersebut mulai tahun ini. Itu merupakan salah satu cara meningkatkan kualitas SDM PNS di Tapteng dalam mewujudkan program Negeri Wisata Sejuta Pesona. Sebagai

daerah wisata, maka PNS di Tapteng juga dituntut mampu berkomunikasi dalam bahasa internasional,” ungkap Kabag Humasy Pemkab Tapteng Iwan RM Sinaga, Jumat (5/4). Bahkan, sambung Iwan, belajar bahasa Inggir tersebut dicanangkan langsung oleh Bupati Tapteng Raja Bonaran Situmeang. “Bapak Bupati juga ikut private atau kursus bahasa Inggris. Beliau juga instruksikan ke seluruh jajaran dinas/

instansi pemerintah. Bahkan, wajib,” ungkap Iwan. Sementara itu, Kadis Kehutanan dan Perkebunan Tapteng Darmi Siahaan mengatakan, pegawai di dinasnya mulai private awal April ini. Menurutnya, bahasa Inggris merupakan

‹ ‹ Baca PNS ...Hal 7

„ Iwan RM Sinaga


Edisi 255 „ Tahun IX

6 April 2013

114 Polisi Amankan UN TA R U T U N G Jajaran Polres Tapanuli Utara telah menyiapkan 114 personel untuk mengawasi pelaksanaan Ujian Nasional (UN), 15 April mendatang. Pengawasan akan dilakukan mulai dari distribusi soal hingga pelaksanaan UN guna menghindari kebo„ AIPDA W Baringbing coran soal. Kesiapan ini diungkapkan Kasubag Humas Polres Taput AIPDA W Baringbing SH kepada METRO, Jumat (5/4). Dia mengatakan, tahun ini, pengamanan yang diterjunkan dari unsur kepolisian tidak banyak berubah dari tahun lalu. “Kami sudah siapkan 114 personel dengan melibatkan Polsek-polsek untuk mengamankan jalannya UN,” ujarnya. Pengamanan yang dilakukan melalui pengamanan terbuka dan tertutup. Untuk pengamanan tertutup dengan masing-masing titik dijaga oleh dua hingga empat personel tanpa seragam dari unsur Intelkam.

37 Pejabat Diganti TOBASA- Sebanyak 37 pejabat di Pemkab Tobasa Samosir diganti. Meski beberapa camat mendapat jabatan strategis, namun ada juga pejabat yang justru non job atau menjadi staf. Kepala SMK Negeri 1 Balige Lalo Hartono Simanjuntak, salah satu dari sekian pejabat struktural eselon II, III dan IV yang dimutasi melalui SK Bupati No 061 Tahun 2013. Dia diberi jabatan baru menjadi Kepala bidang Pendidikan Luar Sekolah, Pemuda, Olahraga, Seni dan Budaya di Dinas Pendidikan

Foto Hermanto Turnip

Calon Kepala Daerah Boleh Nyaleg

Judika Sihotang & Duma Riris Silalahi

Nikah di Medan dan Jakarta

Jadi Caleg Partai Lain, Legislator Harus Mundur

„) Baca Calon ..Hal 10

(foto Amran Pohan)

LONGSOR: Seorang warga menunjukkan longsor di Pasar Simangambat, Kelurahan Aek Simotung, yang dikhawatirkan bisa mengundang bahaya.

Jalan Longsor di Sipirok-Simangumbat


SIPIROK- Pemerintah melalui Dinas Pekerjaan Umum yang membidangi jalan dan jembatan, diharapkan peka terhadap keluhan masyarakat dan pengguna jalan terkait kondisi fasilitas yang bisa membahayakan. Seperti yang terjadi di jalan provinsi SipirokSimangambat-Sipagimbar, dimana ada beberapa titik kerusakan jalan. Sampai saat ini belum ada penanganan maupun perbaikan yang dilakukan, padahal jika dibiarkan, bisa

„) Baca Bahayakan ..Hal 10

„) Baca 37 Pejabat ..Hal 10

PEJABAT: Sebanyak 37 pejabat eselon diangkat sumpah janji dalam promosi jabatan Pemkab Tobasa, Jumat (5/4) di Aula SMKN 1, Balige.

„) Baca 114 Polisi ..Hal 10

JAKARTA- Komisi Pemilihan Umum (KPU) sempat mengatur pasal larangan bagi calon kepala daerah yang maju sebagai calon legislator pada pemilu mendatang. Namun, aturan itu kini direvisi. Calon kepala daerah yang tengah bersaing di pilkada diberi kesempatan untuk maju sebagai calon anggota dewan. ”Kami membatalkan Pasal 47 Peraturan KPU No 7/2013. Ini untuk memastikan hak konstitusional seseorang,” kata komisioner KPU Hadar Navis Gumay dalam sosialisasi peraturan KPU (PKPU) kepada LSM dan ormas di kantor KPU, Jakarta, kemarin (4/4). PKPU No 7/2013 direvisi dengan PKPU No 13/2013 Hadar menyatakan, meski KPU memberikan kesempatan kepada calon kepala daerah

Toba Samosir. Begitu juga untuk posisi Kepala Dinas Kesehatan dipercayakan kepada dr Rajaipan Ompa Tua Sinurat. Pejabat baru itu dilantik langsung Bupati Pandapotan Kasmin Simanjuntak. Pelantikan yang dilaksanakan di Aula SMKN 1 Balige

JUDIKA sebentar lagi akan mengakhiri masa lajangnya dengan sang kekasih, Duma Riris Silalahi. Pernikahan itu berlangsung antara bulan Agustus sampai November. Maklum, Mereka belum bisa menentukan tanggal dan bulannya, karena

„ Judika Sihotang & Duma Riris Silalahi

belum mendapatkan gedung. “Karena kami tanya semuanya full, gedung masalah utama. Full sampai Desember. Sebenarnya kami mau antara bulan delapan dan sepuluh. Spesial buat kami ya itu. Mudah-mudahan dalam waktu dekat sudah fix,” ucapnya, di kawasan Kebayoran Baru, Jakarta Selatan. Duma antusias mempersiapkan

„) Baca Nikah ..Hal 10

Marojahan Situmeang & Jansen Sitompul

Siap Paulihon Taput TAPUT- Ir Marojahan Situmeang MSc dan Jansen Sitompul SE, salah satu bakal pasangan calon Bupati Tapanuli Utara periode 2014-2019, mengaku siap untuk Paulihon (memperbaiki, red) daerah itu lima tahun mendatang. Keyakinan itu, diutarakan oleh Ir Marojahan Situmeang, kepada METRO, Jumat (5/4) di Tarutung. ”Konsep untuk membangun Kabupaten Tapanuli Utara itu sebenarnya sangat sederhana. Kita harus mulai dari dasar. Ibarat komputer, kita harus mulai dari perbaikan software-nya, yakni perbaikan SDM,” ujar Marojahan. Karena seberapa besar pun kekayaan yang dimiliki Taput, seperti hasil pertanian, tanpa didukung Sumber Daya Manuasia (SDM) yang handal, mustahil bisa berhasil. Ter-

„ Marojahan Situmeang masuk disini SDM aparatur pemerintahan yakni reformasi birokrasi. ”Dengan dana kecil pun Taput itu bisa dibangun. Asal Anggaran Penda-

patan dan Belanja Daerah (APBD) itu dikelola secara efektif, efisien dan maksimal. Bayangkan, 65 persen APBD Taput itu dikelola untuk belanja pegawai. Jadi, ini yang harus kita benahi terlebih dahulu,” sambungnya. “Kalau langsung kita membangun sektor pertanian tanpa ada SDM yang bagus, mustahil dapat hasil yang maksimal. Kita harus bangun budaya di masyarakat itu seperti budaya marsiurupan (gotong royong), kerja keras dan disiplin dulu. Maka aparatur pemerintah melalui tenaga PPL (petugas penyuluh lapangan) untuk pertanian, peternakan dan perikanan kita maksimalkan untuk memberi penyuluhan kepada petani,” tambah Marojahan.

„) Baca Siap ..Hal 10

Pemimpin Harus Miliki Sahala Raja TARUTUNG- Menjelang Pilkada Taput yang akan digelar 10 Oktober mendatang, Guru Besar Sosialogi, Universitas Airlangga Prof DR Hotman M Siahaan, mengimbau kepada seluruh masyarakat agar jeli memilih calon pemimpin di daerah itu. Alumni angkatan 1977 dari SMP Negeri 2 Tarutung ini bahkan mengatakan, seorang pemimpin harus memiliki sahala (karisma dan karakter, red) seorang raja. “Seorang pemimpin itu harus memiliki Sahala seorang raja yang mampu untuk melayani masyarakat. Bukan malah memiliki karakter serakah

(Foto Amran Pohan)

„ Kondisi jalan menuju Aek Milas Paran Dolok dari persimpangan jalan menuju SMKN 1 Sipirok yang butuh pengaspalan.

Jalan Aek Milas Paran Dolok

30 Tahun Tak Diaspal SIPIROK- Jalan menuju Pemandian Aek Milas Paran Dolok, yang berbatasan dengan Desa Padang Bujur, Kecamatan Sipirok, Tapanuli Selatan, sudah selayaknya disentuh pembangunan. Sejak dibangun pada 1980-an (lebih dari 30 tahun lalu), jalan sepanjang 100 meter itu hanya berupa

timbunan sirtu (campuran pasir, tanah dan batu). Kini, saat hujan mengguyur, lokasi akan berlumpur. Sedangkan ketika kemarau tiba, jalan ini akan berdebu. Hal itu mengganggu kenyamanan warga yang hendak mandi,

„) Baca 30 Tahun ..Hal 10

Antisipasi Serangan Babi dan Burung

Petani Mamuro Siang-Malam Foto Bernad L Gaol

SEMINAR: Sejumlah alumni 77 SMPN 2 saat menggelar seminar tentang Budaya Batak, Jumat (5/4) di Gedung Sopo Partungkoan, Tarutung. untuk memperkaya diri sendiri dan kelompoknya,” ujar Prof DR Hotman M Siahaan, saat menggelar seminar tentang Budaya Batak, Jumat (5/4) di Gedung Sopo Partungkoan, Tarutung.

“Untuk itu, pada Pilkada nanti, jadilah sebagai masyarakat yang marsahala raja. Pilih calon pemimpin yang punya sahala raja. Karena

„) Baca Pemimpin ..Hal 10

TAPSEL- Untuk mendapatkan hasil maksimal dari tanaman padi di sawah, warga Kampung Sigiringgiring, Desa Sunge Siring giring, Saipar Dolok Hole (SDH), Tapsel, melakukan mamuro (menjaga tanaman padi) siang maupun malam. Bagi warga setempat, budaya mamuro ini sudah biasa dilakukan. Siang hari, tanaman padi dijaga kaum ibu dan malam hari oleh kaum bapak. Hal itu dilakukan agar tanam-

an bisa mendatangkan hasil yang maksimal untuk kebutuhan dan terjaga dari serangan binatang seperti babi dan burung. Alhasil, jika musim mamuro telah tiba, warga akan sulit ditemukan di perkampungan. Pasalnya mereka lebih memilih berdiam di areal pertanian untuk menjaga tanaman dari gangguan binatang. Bahkan tak jarang warga yang

„) Baca Petani ..Hal 10


6 April 2013

37 Pejabat Diganti

Nikah di Medan.. Sambungan Halaman 9 pernikahannya. Meskipun ada wedding organizer (WO) yang menanganinya, runner up Putri Indonesia 2007 itu, selalu turun tangan dalam setiap rapat untuk mengambil keputusan terkait segala macam bentuk persiapan pernikahannya. “Ada WO, tapi yang turun langsung aku. Aku selalu ada di pertemuan itu,” timpal Duma. Ia merasa tidak repot karena banyak temantemannya yang membantu. Sementara Judika sibuk dengan pekerjaannya. “Enggak repot, aku punya teman-teman yang bantu urus semua, pelan-pelan ya. Judika kan sibuk. Satu bulan off air, dia enggak sempat pikirkan itu. Jadi aku yang urus,” terang wanita kelahiran Balige, 20 September 1983 itu. Ia menambahkan pernikahannya akan menggunakan dengan adat Batak. “Tempatnya di kampung aku dan di Jakarta,” lanjutnya. (tr/ int)

Pemimpin Harus Miliki Sahala Raja Sambungan Halaman 9 pilihanandaakanmenentukannasibdaerahinilima tahun ke depan,” sambung Hotman. Pemimpin, katanya, harus orang yang memiliki kualitas tertentu yang bisa memengaruhi perilaku orang banyak. “Pemimpin dalam konteks budaya Batak sebagaimana dipaparkan JC Vergouwen mengatakan, adalah mereka yang memiliki sahala yaitu sahala harajaon,” tambahnya. Menurutnya, tanda-tanda seseorang yang dilimpahi sahala raja, dapat dilihat pada ciri khusus perwatakan seorang atau kualitas yang menonjol, yaituhabolonon(kebesaran),hamoraon(kekayaan), habisukon (kebijakan) atau parpollungon (seni membahas),habeguon(keperkasaandalamperang dan ketegasan terhadap bawahan) dan hadatuon (keterampilan dalam ilmu datu). “Di masa lalu, jika memilik kualitas seperti itu, maka seseorang itu telah memenuhi syarat untuk memerintah,” sebutnya. SedangkanDRMamotoGultom,dalammakalahnya pada seminar sehari itu mengatakan, kondisi zaman sekarang yang terus bergerak telah meninggalkan aspek kehidupan dan menjerumuskan manusia ke pusaran prilaku konsumtif. “Para pujangga ekonomi kapitalis telah menjadi pemuja kekuatan materialistik. Dan untuk saat ini, telah berhasil mendeklarasikan konsumerisme menjadiideologibesarpadazamanglobalisasi,”kata Mamoto. Katanya, uang bukan lagi semata-mata untuk alat tukar. Namun juga telah diperdagangkan dan telah berubah menjadi kekuatan dahsyat untuk mensiasati,bahkanuntukmeraihkekuasaandengancara membelidemokrasi. “Karenanya,takheran,korupsi yangjikaditerjemahkanmengambildanmenguasai uang yang bukan miliknya, akan semakin merajalela,” tandasnya. Dia menjelaskan, berbagai permasalahan yang dapat diindentifikasi dan membutuhkan perhatian untukmeningkatkankualitasdemokrasidiTapanuli Utara, antara lain, minimnya pengetahuan dan kesadaran masyarakat tentang arti dan hakekat Pilkada langsung, sebagai dampak kurangnya pendidikan demokrasi. “Inilah akibatnya jika terjadi rebutan kedudukan antarakaumpolitisidariparpoldankalanganaparat birokrat,” paparnya. Sementara Prof DR Hotman M Siahaan dalam paparannya mengupas tentang ‘Pemimpin Namarsahala Raja’ memiliki kualitas tertentu yang bisa memengaruhi orang banyak. Organisasi kemasyarakatan, katanya, barisan tim suksesdanparabalonkepaladaerahtermasukunsur pemerintahan Kabupaten Taput. (cr-01/hsl)

Sambungan Halaman 9 itu, beberapa camat mendapat jabatan strategis, namun ada juga pejabat yang justru non job atau menjadi staf. Meskipun dilakukan pengangkatan jabatan, beberapa posisi jabatan pemerintahan yangsebelumnyadijabatoranglamajustrulowong. Di jajaran camat, Augus Sitorus misalnya, sebelumnya menjabat sebagai Camat Porsea kini menduduki posisi sebagai Kepala Dinas Pasar, Kebersihan dan Pertamanan. Begitu juga Sabam PardosisebelumnyamenjabatCamatHabinsaran dipromosikan menjadi Kepala Dinas Kependudukan dan Catatan Sipil. Taruli Siagian, Camat Laguboti kini menjadi Kabag Organisasi Sekdakab. Sementara untuk mengisi jabatan camat yang ditinggalkan, Robert Gono menjadi Camat Laguboti,memimpinKecamatanPorseadipercaya

kepada mantan camat Uluan, Elister Manurung. Untuk sementara jabatan camat Uluan, lowong. Bupati mengatakan, pelantikan ini adalah merupakanhasilevaluasikinerjaPNSdibeberapa SatuanKerjaPerangkatDaerah(SKPD).Pelantikan juga dimaksudkan dalam rangka peningkatan pelayanan kepada masyarakat serta kepercayaan publikataskinerjabirokrasi. “Untukitudibutuhkanaparaturyangcakapdan mampu menduduki jabatan sesuai dengan kapasitasnya,” sebut Pandapotan, Jumat (5/4) di Aula SMK Negeri 1 Balige. Bupatimengatakan,mutasijabatanmerupakan hal biasa yang memang harus dilakukan sebagai bagian dinamisasi dari proses penyegaran dan penyesuaiankebutuhanpersoneldalamorganisasi. Dia juga menganggap mutasi dan promosi hendaknyaditanggapisecarawajardansebagaihal yang biasa. “Mutasi jabatan seperti ini akan selalu

ada selama kebutuhan dan situasi organisasi menghendakinya,”tambahnya. Bupati mengakui, tidak semua personel dapat diakomodiruntukdidudukkanpadaposisijabatan. Mengingatterbatasnyajumlahposisijabatanyang ada. Diingatkan, yang baru dilantik agar meningkatkan disiplin diri dan kualitas kerja serta senantiasa menjaga dan mempertahankan integritas,loyalitas,disiplindankomitmentugasdan tanggungjawab. Seperti diketahui sekolah yang dipimpin Lalo sempat membuat gempar dunia pendidikan atas keterlibatan siswanya dalam sindikat pencurian kendaraan bermotor. Ada sembilan siswa yang ditangkap oleh jajaran kepolisian resort Toba Samosir beberapa waktu lalu. Sementara mantan Kepala Dinas Kesehatan dr Haposan Siahaan tersangkut kasus dugaan korupsi fee proyek 2011. (cr-03/des)

30 Tahun Tak Diaspal Sambungan Halaman 9 juga mengurangi kebersihan lokasi pemandian. Sebab warga setempat tampak kesulitan membersihkan pemandian yang dialiri lumpur yang mengalir dari jalan, yang berjarak 100 meter dari persimpangan menuju SMKN 1 Sipirok tersebut. Menurut warga Hj Nurlela Hutasuhut atau Ompu Desi (66), mereka sangat berharap jalan tersebut segera diaspal, agar suasana pemandian menjadi bersih dan warga yang datang dari berbagai penjuru merasa nyaman. “Panjangnya hanya 100 meter. Memang petugas dari Pemkab Tapsel sudah beberapa

kali meninjau dan mengukur. Namun pembangunannya tak kunjung ada,” ucapnya. Dikatakannya, jika hujan turun, kondisi jalan tidak saja berlumpur, tetapi terkikis air sisa hujan. Untuk mengantisipasi terkikisnya badan jalan, secara swadaya Ompu Desi yang juga memiliki kedai kopi di dekat pemandian tersebut, mengupayakan penimbunan 3 kali dalam 2 tahun. ”Sebanyak 3 kali dalam 2 tahun secara rutin harus ditimbun dengan volume 3 truk sirtu. Kalau tidak, kendaraan tak bisa masuk. Kiranya pemerintah melakukan pengaspalan jalan ini,” harapnya. Dia menuturkan, jalan tersebut terakhir kali mendapat pembangunan pada tahun

1980-an. Namun akibat kurangnya perawatan dan perhatian, kondisinya semakin rusak. “Terakhir jalan itu dibatu saja (telford). Saya yakin kalau pemerintah tak turun tangan, apapun upaya pembangunan akan sulit diwujudkan,” ujarnya seraya berharap di tahun 2013 jalan diaspal. Tentunya melalui sentuhan pemerintah dalam mengalokasikan pengaspalan jalan tersebut, ke depan warga yang berkunjung akan merasa nyaman dan membuat peluang peningkatan ekonomi warga setempat. Selain itu, lokasi diharapkan menjadi sumber PAD melalui perparkiran dan retribusi lainnya. (ran)

Petani Mamuro Siang-Malam

Sambungan Halaman 9 menetap sementara di areal pertanian siang dan malam. Mamurorata-ratadilakukansekira30hari,yakni sejak tanam mengeluarkan bunga (bulir) padi hingga waktu panen tiba. Menurut salah seorang warga Nur Aisyah (21), sejak bulir padi keluar, dirinya harus menjaga dan mengusir burung dari pagi hingga sore. Malamnya, suaminya akan berganti menjaga untuk mengusir babi yang kerap menyerang tanaman saat tengah malam hingga menjalang pagi. “Darijam6pagihinggajam6sore,harusdiawasi agar jangan sampai dihabiskanburung,” katanya. Namun malam juga harus dijaga dari gangguan

babi. Kalau tidak, habislah dirusaknya,” sebutnya. Melihat areal persawahan yang berada di tengah hutan dengan dikelilingi semak belukar, tentunyatidakbisaamandarigangguanbinatang. Gangguan terhadap tanaman padi akan mulai dirasakan ketika kondisi padi sedang bunting. Sedangkanjenisbinatangyangkerapmenganggu, adalahtikus,kera,berukdanbabi.Jikatidakdijaga, tanaman akan dirusak dan diacak-acak. Sementaraketikabulirpaditelahkeluar,penjagaanharus semakin ditingkatkan, guna menjaga tanaman yang diambang panen itu dari gangguan burung dan babi. Sekalipun perjuangan mereka begitu berat untuk mendapatkan bahan makanan pokok, namun kebutuhan mereka masih belum ter-

penuhi. “Sekalipunhasilnyanormaldanpanenduakali dalam setahun, namun itu belum mencukupi kebutuhan pangan. Tetap saja kami membutuhkannyadariluar(pasar),”katawargalainnnya, Sorta Ritonga (50) dan Pangaloan Siregar (50). Dengan ketersediaan air, warga telah menerapkanpolatanamduakalisetahun.Pemupukan juga sudah diterapkan secara teratur, sekalipun harganya cukup tinggi akibat ongkos pengangkutan. “OngkospengangkutandariSipagimbarkesini Rp2 ribu per kilogram,” kata mereka sembari menjelaskan mereka belum pernah mendapatkan bantuan penyuluhan untuk meningkatkan produktifitas pertaniannya. (ran)

Bahayakan Pengendara Sambungan Halaman 9 membahayakan pengguna jalan. PantauanMETROpadalongsordisekitar Pasar Simangambat, Kelurahan Aek Simotung, Saipar Dolok Hole (SDH), Tapsel, posisinya berada di jalan menurun dan di tikungan. Hal itu dianggap sangatmembahayakanpenggunajalan.Sekitar10 meter sisi kiri jalan terlihat mengalami longsor dengankedalaman4meter.Beberapakendaraan yang melintas tampak mengambil jalur kanan untuk menghindari bibir jurang. Kondisi ini tentunyamengundangbahayajikasecaratibatiba

datang kendaraan lain dari arah berlawanan. Sehingga pengguna jalan harus hati-hati saat melintas. Warga sekitar yang merasa peduli, membuat gundukan tanah sebagai aba-aba agar pengguna jalan lebih berhati-hati. Menurut R Ritonga (47) dan Binsar (34), keduanyawargasetempat,longsordilokasisudah terjadi sejak 2 bulan lalu. “Memang awalnya di sini dijadikan tempat pembuangan sampah. Sekira 2 bulan lalu, kampung ini diguyur hujan deras. Saat itulah tebingdipinggirjalanlintasinimengalamilongsor.

Tapi sampai sekarang belum diperbaiki. Padahal sering kenderaan yang nyaris tabrakan karena posisinya berada di tikungan dan menurun,” terangnya. SalahseorangpengendaraJanesHutabarat(22) yangsempatdiwawancaraiMETROmengatakan, ia sangat was-was jika melintas di jalan tersebut. “Sayatakutjikatiba-tibadatangkendaraandari arah bawah,” sebutnya. Untuk itu ia berharap, pemerintah melalui instansi terkait segera mengambil tindakan untuk menghindari kejadian yang tidak diinginkan dan menimpa masyarakat pengguna jalan. (ran)

Calon Kepala Daerah Boleh Nyaleg Sambungan Halaman 9

maju sebagai caleg, parpol yang mengajukan harus siap kehilangan caleg tersebut jika dinyatakan sebagai pemenang pilkada. LOWONGAN ”Jika penetapan peAkper K E RPemkab J A menang pilkada masih Tapanuli Tengah dalam tahap perbaikan, membutuhkan STAF PEGAWAI masih bisa diganti. NaPersyaratan : mun, kalau sudah DCT 1. Lulusan D-III (daftar calon tetap), tiKeperawatan dak bisa diganti dan 2. PRIA 3. Usia Minimal 24 dicoret,” ujar Hadar. Tahun Dalam sosialisasi, Lamaran diantar KPU juga membeberlangsung ke: kan aturan kader parpol Kampus tertentu yang nyaleg leAKPER wat parpol lain. MisalPEMKAB nya, ada caleg dari parTa p a n u l i Te n g a h pol A, namun yang berJl. AR Surbakti, sangkutan sebenarnya TEL AH TELAH Kel.Sibuluan anggota parpol B. Nauli, PINDAH Menurut Hadar, boleh Sihaporas saja caleg tersebut maju UntukTOK Informasi O TOKO dari parpol lain. “NaLebihNasional lanjut mun, caleg itu harus Hubungi: Tukang Gigi membuat pernyataan Arianto bahwa dia telah mengSembiring dari SKep Ns undurkan diri dari parImam 0813Jl.6171 6541 pol asalnya,” ujarnya. Bonjol Dalam kasus caleg yang maju adalah angke

gota DPR atau DPRD dari parpol lain, KPU akan memberlakukan aturan yang sama. Kata Hadar, caleg tersebut juga harus mengundurkan diri jika masih berstatus sebagai anggota DPR atau DPRD. “Kami juga harus pastikan bahwa proses itu bisa dilakukan hingga DCS saja,” ujarnya. Hadar menjelaskan, jika caleg tersebut kesulitan menyampaikan surat pengunduran diri, KPU juga telah memberikan solusi. Caleg bisa mengajukan surat pernyataan mundur sementara sebagai legalitas persyaratan verifikasi administrasi. ”Jika sulit mendapat tanda tangan pimpinan parpol, bisa dengan surat pernyataan ketua DPRD,” ujarnya mengingatkan. Dalam sosialisasi juga disinggung soal aturan kuota minimal 30 persen bagi caleg perempuan. KPU menegaskan, tidak ada perubahan aturan soal kuota caleg perempuan. Sebab, ketentuan tersebut sudah diatur secara jelas dalam UU No 8/2012 tentang Pemilu. Soal kepala desa yang ingin maju sebagai caleg, KPU mengeluarkan aturan tegas. Kepala desa itu harus terlebih dahulu mengundurkan diri dari jabatannya. Menurut Hadar, mekanisme untuk mundur itu diperlukan agar kepala desa yang maju tidak memanfaatkan fasilitas dan jabatannya terkait pencalegannya. ”Dia punya posisi kunci yang sensitif. Misal dalam penentuan PPK dan PPS. Akan

Jl. Suprapto No. 73A simpang Jl. Pari Sibolga Hub. HP: 0813 9756 5939

Dp. 40 Jtan Angs 3Jtan

tidak fair jika larangan itu tidak diatur,” jelasnya. Dalam UU Pemilu memang tidak diatur secara eksplisit soal larangan kepala daerah maju sebagai caleg. Namun, secara tegas, kepala desa dan perangkat desa dilarang menjadi pelaksana kampanye sesuai dengan Pasal 86 ayat 2g dan 2h. Nah, karena pelaksanaan kampanye Pemilu 2014 sangat panjang, akan sulit mengawasi dan memastikan kepala daerah tidak berkampanye dalam pencalegannya. Belum lagi, jumlah pengawas di lapangan yang terbatas. “Jika mau fair ya harus mundur,” ujar Husni. Sebelumnya, sejumlah kepala daerah mendesak KPU merevisi PKPU No 7/2013 yang mengharuskan PNS, anggota TNI/ Polri, dan kepala desa serta perangkat desa untuk mengundurkan diri sebelum menjadi caleg. Para kepala desa berdalih, dalam UU Pemilu, yang dilarang nyaleg hanya PNS, anggota TNI/Polri, dan kepala daerah. Kepala desa tidak termasuk kategori kepala daerah. Hadar menambahkan, perbaikan masa DCS tergantung masukan masyarakat. Dalam kaitan teknis, caleg bisa dievaluasi dalam hal-hal terkait teknis pengajuan caleg. Namun, dalam hal etik dan moral, KPU tampaknya mengalami kesulitan. “Kalau terkait ijazah, bisa diklarifikasi, kalau etik dan moral, susah dibuktikan,” tandasnya. (jpnn)

114 Polisi Amankan UN Sambungan Halaman 9 “Sedangkan personel lainnya kami turunkan untuk pengamanan terbuka mulai dari pengawalan naskah soal ujian,” ucapnya. Pengawasan penuh ini, katanya, termasuk dalam proses distribusi soal dari percetakan ke rayon, saat penyimpanan soal di rayon dan pada pelaksanaan UN nantinya. “Hal itu dilakukan untuk menghindari kemungkinan kebocoran soal sebelum ujian,” sebut Baringbing. Sebelumnya Kepala bidang Pendidikan Dasar Umum (Dikdasmenum) pada Dinas Pendidikan Nasional Taput Saut Panjaitan menyampaikan, sebanyak 5.474 siswa dari 47 Sekolah Menengah Atas (SMA), Madrasah Aliyah (MA) dan Sekolah Menengah Kejuruan (SMK) se-Tapanuli Utara (Taput), telah siap mengikuti UN. Ke-5.474 siswa yang akan mengikuti UN tersebut, terdiri dari 2.028 siswa SMA/MA IPA, 1641 siswa SMA/MA IPS dan 2.0078 siswa SMK dari 47 SMA/SMK Negeri dan Swasta. Munurutnya, persiapan ujian nasional bagi tiap-tiap sekolah sudah tergolong baik mengingat telah dilakukanya try out dan bimbingan belajar luar sekolah oleh guru selepas pulang sekolah. “Seluruh program itu adalah tentang kesiapan para sekolah dan guru dalam menghadapi UN nanti,” terangnya. (cr-10)

Siap Paulihon Taput Sambungan Halaman 9 Di samping itu, guna menopang SDM tadi, sebut Marojahan, budaya masyarakat Taput yang berkarakter kerja keras dengan tetap pada koridor adat istiadat dan kerohanian, harus kembali digalakkan. ”Sebab, kearifan lokal itu sangat mendukung untuk program pembangunan. Maka, masyarakatlah yang kita libatkan secara langsung untuk bersama dengan pemerintah melaksanakan efisiensi anggaran itu tadi,” terangnya. Selanjutnya, Marojahan mengatakan, untuk mendukung peningkatan hasil produksi pertanian masyarakat di daerah itu, maka pemerintah harus memperbaiki sarana infrastruktur jalan dari sentra pertanian menuju pasar. ”Tentu, kualitas jalan itu harus yang terbaik, harus aspal hotmix,” ujar pria asal Kecamatan Sipoholon, Taput yang kini bekerja sebagai PNS di Kementerian Pekerjaan Umum, Direktorat Sumber Daya Air, Jakarta itu. Perbaikan sarana infrastruktur itu juga nanti akan dapat memacu hadirnya investor ke daerah ini. Dengan hadirnya investor, maka Pendapatan Asli Daerah (PAD) dari sektor pajak, maupun pendapatan per kapita masyarakat akan meningkat. ”Industri rumah tangga (home industry) juga akan kita galakkan dengan memanfaatkan potensi dan sumber daya alam yang ada. Misalnya untuk kerajinan Ulos Batak. Kalau PNS di Jakarta pakai Batik setiap minggu masuk kerja, kenapa kita tidak pakai seragam yang bercorak ulos? Jadi, Taput itu harus menjadi pusat pendidikan, ekonomi dan kerohanian,” imbuhnya. Untuk sektor kesehatan, Marojahan menyebut, bahwa setiap tenaga medis, baik yang ada di tingkat Poskesdes, Puskesmas maupun rumah sakit harus memiliki etika sopan dan ramah kepada setiap pasien tnpa melihat latar elakang ekonomi. ”Sapalah pasien itu dengan ramah, tangani secepatnya penyakitnya. Dan khusus untuk Rumah Sakit Umum Swadaya Tarutung, dokter-dokter spesialis harus ditambah. Misalnya spesialis penyakit dalam, penyakit jantung dan dokter spesialis penyakit lain yang paling banyak diderita masyarakat,” imbaunya. Sementara untuk pelayanan birokrasi, Marojahan mengatakan, setiap PNS yang ada di Pemkab Taput harus mengutamakan pelayanan prima. ”Jangan masyarakat sampai terbebani dengan kutipan-kutipan uang yang tidak jelas. PNS itu juga tentunya jangan dibebani dengan target-target yang tidak jelas. Itu bisa memicu penyalahgunaan wewenang,” tandasnya. Terakhir, ketika ditanya partai mana yang akan mengusungnya maju di Pilkada Taput yang akan digelar 10 Oktober mendatang, Ir Marojahan masih enggan membeberkan. ”Kalau itu nanti dulu lah. Bulan April ini kita akan deklarasikan. Termasuk deklarasi pasangan. Yang jelas, partai pendukung sudah ada. Bahkan, partai pendukung kita itu sudah memiliki 15 persen perolehan suara sah pada Pemilu Legislatif tahun 2009 di Taput,” pungkasnya. (hsl/des)


Enam Negara Kembali Gelar Dialog Nuklir Iran KAZAKASTAN-Enam negara yakni AS, Rusia, China, Perancis, Inggris, dan Jerman menghelat kembali dialog nuklir Iran. Kali ini, Almaty, ibu kota Kazakstan, menjadi lokasi penyelenggaraan, tulis AP pada Jumat (5/4/). Selama dua hari ke depan, mitra dialog enam negara itu adalah juru runding Iran. Sebelumnya, pembicaraan terakhir mengenai dugaan pengayaan uranium oleh Iran itu diselenggarakan pada Februari. Dalam kesempatan itu, Kepala Urusan Kebijakan Luar Negeri Uni Eropa, Catherine Ashton, meminta agar pihak Iran memberikan jawaban nyata dan resmi. “Hal ini diperlukan untuk membangun kepercayaan lebih baik,” katanya. Sampai kini, Iran dan pihak Barat memang belum menemukan kata sepakat terkait dugaan pengayaan uranium tersebut. Barat khawatir upaya Iran bisa menciptakan bom nuklir yang mengancam stabilitas dunia. Iran mengatakan bahwa program nuklirnya hanya dimanfaatkan untuk energi dan perdamaian. (kcm/int)

Baku Tembak Tewaskan 13 Tentara Myanmar MYANMAR-Baku tembak dengan kelompok bersenjata tak dikenal di dekat perbatasan Thailand menewaskan 13 tentara Myanmar. Juru Bicara Angkatan Darat (AD) Thailand Kolonel Sansern Kaewkamnerd pada Jumat (5/4) mengatakan otoritas Myanmar sudah mengontak otoritas Thailand berkenaan dengan hal itu. Sementara, menurut warta AP, insiden kekerasan itu terjadi di wilayah Myanmar sekitar 6 kilometer dari perbatasan Thailand. Wilayah perbatasan Thailand yang terletak paling dekat dengan lokasi kejadian adalah Provinsi Ranong. Sementara itu, pihak Thailand sudah menggelar investigasi menyangkut masalah itu. Thailand berupaya untuk mencari tahu apakah kelompok bersenjata itu adalah warga Thailand yang masuk secara ilegal ke Myanmar. Catatan dari laman Bangkok Post menunjukkan baku tembak pernah terjadi pada Agustus setahun silam. Kala itu, kelompok bersenjata saling tembak dengan tentara Myanmar yang tengah berpatroli di perbatasan. Dalam kesempatan itu, 92 warga Thailand ditangkap lantaran tuduhan memasuki Myanmar secara tidak sah. (kcm/int)

AS Siaga Hadapi Kemungkinan Serangan Korut SEOUL-Amerika Serikat (AS) mengatakan, pihaknya tengah mengambil semua langkah pencegahan yang diperlukan setelah Korea Utara (Korut) melancarkan ancaman terbaru dalam krisis yang terus meningkat dengan memindahkan rudal jarak menengahnya ke pantai timur, Kamis (4/4). Menteri Pertahanan Korea Selatan (Korsel) Kim Kwan-Jin mengatakan, rudal itu bisa mencapai “jarak yang cukup jauh”, tetapi bukan daratan AS. Kim mengatakan hal itu saat mengemukakan kepada anggota parlemen Korsel bahwa pemindahan rudal itu “bisa saja bertujuan untuk melakukan uji tembak atau latihan militer”. Itu merupakan langkah terbaru Korut yang telah mengeluarkan serangkaian ancaman perang nuklir yang bakal menghancurkan dalam beberapa pekan terakhir. Korut marah dengan sanksi terbaru PBB dan latihan militer bersama Korsel-AS. Juru Bicara Gedung Putih, Jay Carney, mengatakanrentetanancamanitu“disesalkantapi memangakrab”denganpolaperilakuKorut.“Kami sedang mengambil semua langkah pencegahan yang diperlukan,” kata Carney. Ia mengatakan, AS mengambil “sejumlah langkah yang hati-hati” untuk menanggapi ancaman serangan rudal yang mungkin terjadi. Pentagon telah mengatakan pihaknya akan mengirim sistem pencegat rudal untukmelindungipangkalannyadiGuam,sebuah wilayahASyangterletak3.380kilometerditenggara Korutdantempattinggalbagi6.000personelmiliter Amerika. Sumber-sumber intelijen Korsel dilaporkan telah mengidentifikasi rudal Korut itu sebagai Musudan yang punya jangkauan menengah. Musudan belum pernah diuji coba, tetapi diyakini punya jangkauan sekitar 3.000 kilometer, yang secara teoretis bisa didorong untuk berjangkauan 4.000 kilometer dengan muatan ringan. Juru Bicara Kementerian Pertahanan Korsel mengatakan, dia tidak bisa mengonfirmasi jenis pasti rudal itu, tetapi mengatakan Musudan bisa menimbulkan ancaman bagi pasukan AS di Guam. Namun, banyak pakar menduga bahwa Korut belum mampu memasang perangkat nuklir pada rudal balistik yang mampu menyerang pangkalan militer atau wilayah AS. Kamis kemarin, militer Korea Utara mengatakan bahwa pihaknya telah menerima persetujuan final untuk aksi militer, yang mungkin melibatkan “beragam” senjata nuklir, melawan ancaman pesawat pengebom siluman B-52 dan B-2 AS yang berpartisipasi dalam latihan militer bersama dengan Korsel. Retorika Korut itu telah memicu kekhawatiran internasional. Sekjen PBB Ban Ki-moon menggambarkan ancaman yang rutin dari Pyongyang itu sebagai “benar-benar mengkhawatirkan dan meresahkan”. “Saya pikir mereka sudah terlalu jauh dalam retorika mereka dan saya khawatir jika ada salah pertimbangan, salah perhitungan ini akan punya implikasi yang sangat serius,” kata Ban. (kcm/int)


TOLAK RUU ORMAS : Hizbut Tahrir Indonesia, melakukan unjuk rasa di depan gedung DPR RI, Jumat (5/4) di Jakarta. Dalam aksinya mereka menolak Rancangan UndangUndang (RUU) Organisasi Masyarakat, yang dianggap jauh dari semangat reformasi.

Asas Tunggal Pancasila Dicabut RUU ORMAS AKAN DISAHKAN 12 APRIL

JAKARTA - Asas tunggal Pancasila yang ditolak oleh Fraksi PKS DPR telah dicabut. RUU Ormas dijadwalkan disahkan 12 April 2013 mendatang. “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985 tentang Ormas memang asas yang sama dengan UU Parpol,” kata Ketua Pansus Revisi UU Ormas, Abdul Malik Haramain, saat berbincang, Jumat (5/4).

Malik menuturkan, UU Parpol mengatur asas dasar Pancasila dan UUD 1945 dan diperbolehkan memasukkan asas lain yang tidak bertentangan dengan Pancasila dan UUD 1945. Jadi tidak ada lagi klausul asas tunggal Pancasila. “Kalau semua bisa segera

disepakati kita jadwalkan minggu depan tanggal 12 April masuk Paripurna DPR,” tegasnya. Asas ormas diatur di Bab II tentang asas, ciri, dan sifat ormas. Aturan tersebut diatur di pasal 2 RUU Ormas. “Asas ormas adalah Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 serta dapat mencantumkan asas lainnya yang tidak bertentangan dengan

Warga NTT di Jogya Lega Penyerang LP Cebongan Terungkap YOGYAKARTA-Empat tahanan yang tewas ditembak oleh oknum Kopassus di LP Cebongan adalah warga NTT. Warga NTT sempat resah pasca kejadian itu. Tapi setelah kasus itu terungkap, mereka lega. Salah satu sesepuh warga NTT di Yogyakarta, Jhon S Keban, mengatakan, warga mengapresiasi kerja baik Polri maupun Tim Investigasi TNI AD. Mereka kini menunggu proses hukum yang adil dan akuntabel. “Kami hormat pada prajurit yang sudah mengakui perbuatan-

nya dan siap untuk bertanggung jawab. Kami menyerahkan proses hukum sepenuhnya,” kata Jhon saat dihubungi, Jumat (5/4). Warga NTT di Yogyakarta percaya pada temuan Tim Investigasi TNI AD. Langkah cepat dalam mengungkap pelaku ini diyakini akan diikuti oleh proses hukum yang adil dan transparan. Warga NTT di Yogyakarta yang sebelumnya takut karena banyak beredar isu-isu sweeping, kini lega. Namun sebagian warga yang mayoritas mahasiswa itu, saat ini belum kembali ke Yogya pasca

peristiwa penyerangan LP Cebongan. “Masih ada 10-15 persen belum kembali ke Yogya dari total mahasiswa NTT di Yogya sekitar 13 ribu. Tapi pertengahan bulan ini, setelah mengetahui kabar pelaku terungkap, dipastikan akan kembali semuanya,” katanya. Dari kasus tersebut, warga NTT di Yogya sepakat untuk menjadi pelajaran bersama. Mereka juga sepakat untuk menghargai pluralisme di Yogya dan menjadi bagian dari keistimewaan Yogyakarta. (kcm/int)

Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945,” demikian bunyi pasal 2 RUU Ormas. Fraksi PAN Minta Tunda Pengesahan Badan Musyawarah (Bamus) DPR telah mengagendakan pengesahan revisi UU Ormas pada Sidang Paripurna DPR 12 April mendatang. Menyambut penolakan berbagai LSM dan Ormas, Fraksi Partai Amanat Nasionalo (F-PAN) dengan tegas meminta agar pengesahan RUU Ormas ditunda. “Kami secara resmi sudah mengirimkan surat ke pimpinan DPR agar pengesahan RUU Ormas ditunda,” kata Ketua FPAN, Tjatur Sapto Edy, kepada wartawan di gedung DPR, sesaat lalu (Jumat, 5/4). Menurut dia, pembahasan RUU tersebut telah menyita perhatian publik yang cukup besar. Terjadi

penolakan dari ormas dan komponen masyarakat sipil. DPR, kata Tjatur, perlu menyerap aspirasi masyarakat yang berkembang dalam merespons RUU Ormas tersebut. Selain itu, fraksi PAN memahami respons masyarakat dan meminta pimpinan DPR untuk menerima aspirasi masyarakat yang berkembang dan menjadikan itu sebagai bahan masukan yang penting terkait pembahasan RUU Ormas. Selain meminta ditundanya pengesahan RUU Ormas, F-PAN meminta agar di waktu mendatang dilakukan uji publik serta forum sosialisasi yang lebih intensif kepada seluruh pemangku kepentingan agar produk hukum yang dilahirkan DPR, terutama yang menyangkut hidup orang banyak, dapat disepakati dan dipahami bersama. (kcm/rml/ int)

Jadikan Koruptor sebagai Pelanggar HAM JAKARTA-Wakil Ketua Badan Kerja Sama Antar-Parlemen (BKSAP) DPR RI Hayono Isman menilai, korupsi tak hanya disebut kejahatan yang menjadi musuh bersama tapi layak untuk dijadikan sebagai perbuatan melanggar hak asasi manusia (HAM). Karena menjadi kejahatan HAM, Hayono meminta negara-negara maju yang menjadi anggota G-20 untuk bekerjasama menyita atau mengembalikan harta hasil korupsi ke Indonesia. Demikian siaran pers di Jakarta, Jumat (5/4) petang. “Kita minta komitmen bersama negara-negara maju yang sering menerima masuknya aset atau dana hasil korupsi untuk mengembalikan semua hasil korupsi tersebut ke tanah air. Ini penting agar kebersamaan dalam memerangi korupsi memang benar-benar seirama,” ujar Hayono ketika berbicara pada sesi pertama Forum Pertemuan Pimpinan Parlemen G-20 bertajuk Financial System Reform dan Fight Against Corruption di gedung lama parlemen

Meksiko City, Kamis siang (4/4) atau Jumat (5/4) dinihari waktu Indonesia. Isu pemberantasan korupsi menjadi perbincangan menarik di antara pimpinan parlemen negara G-20. Salah satunya, keinginan Parlemen Meksiko untuk segera mengeluarkan peraturan pembentukan lembaga anti korupsi seperti yang telah dilakukan Indonesia saat membentuk KPK 10 tahun silam. Langkah ini dilakukan sebagai upaya sistematis memerangi korupsi di negeri tersebut. Ketua Senat Meksiko, Senator Ernesto Cordero Arroyo menyampaikan hal itu saat memimpin sidang sesi pertama Forum Pertemuan Pimpinan Parlemen G20 tersebut. Menurut Cordero, persoalan korupsi di negerinya sudah demikian berat dan tidak mungkin hanya menyerahkan penanganannya kepada aparat kepolisian atau kejaksaan saja. “Kami melihat keberhasilan Indonesia dalam menangani korupsi dengan keberadaan lembaga anti korupsi. Oleh karenanya, kami ingin lembaga seperti di Indonesia tersebut

juga ada di Meksiko,” ujarnya saat memberi kesimpulan atas berbagai pandangan dan pengalaman negaranegara peserta di sesi pertama sidang yang berlangsung di gedung lama parlemen Meksiko. Sohibul Iman yang juga menjadi Ketua Delegasi Indonesia menyambut baik rencana Meksiko tersebut. “Nanti akan kita bicarakan lebih lanjut dalam pertemuan bilateral dengan delegasi parlemen Meksiko,” ujarnya seraya menyebut jadwal pertemuan direncanakan Jumat siang waktu Meksiko atau Jumat tengah malam waktu Indonesia. Sohibul dalam pertemuan tersebut bakal menyarankan Meksiko untuk menggali pengalaman-pengalaman KPK (Komisi Pemberantasan Korupsi) dalam menangani kasus-kasus korupsi di Indonesia. Diharapkan, berbagai pengalaman tersebut makin membuat Meksiko yakin dan mengalokasikan anggaran secara memadai serta memberi dukungan penuh bagi lembaga anti korupsi tersebut bertindak tanpa pandang bulu. (kcm/int)

Selasa, KPK Periksa Andi Mallarangeng JAKARTA-Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemanggilan mantan Menteri Pemuda dan Olahraga, Andi Mallarangeng untuk diperiksa sebagai tersangka kasus dugaan korupsi pengadaan sarana dan prasarana olahraga di Hambalang pada Selasa (9/4) mendatang. “KPK menjadwalkan pemanggilan AAM (Andi Alfian Mallarangeng) sebagai tersangka,” kata Juru Bicara KPK Johan Budi di Jakarta, Jumat (5/ 4). Belum diketahui apakah Andi akan ditahan seusai diperiksa KPK atau tidak.

Selama ini, lembaga antikorupsi itu kerap menahan seseorang seusai pemeriksaan yang bersangkutan sebagai tersangka. Sebut saja, anggota Dewan Perwakilan Rakyat Angelina Sondakh, mantan Deputi Gubernur Senior Bank Indonesia Miranda S Goeltom, dan mantan anggota Dewan Pembina Partai Demokrat, Hartati Murdaya Poo yang ditahan seusai diperiksa sebagai tersangka. Secara terpisah, salah satu pengacara Andi, Harry Pontoh mengaku sudah mendapatkan surat panggilan pemeriksaan KPK untuk Selasa pekan depan. KPK menetapkan Andi sebagai

tersangka atas dugaan bersamasama melakukan perbuatan melawan hukum dan penyalahgunaan wewenang yang menguntungkan diri sendiri atau pihak lain sehingga merugikan keuangan negara. Ancaman hukumannya, paling lama 20 tahun penjara dan denda maksimal Rp 1 miliar. Perbuatan pidana itu diduga dilakukan Andi bersama-sama dengan anak buahnya, Kepala Biro Keuangan dan Rumah Tangga Kemenpora Deddy Kusdinar, serta petinggi PT Adhi Karya Teuku Bagus Muhammad Noer. Kedua orang ini pun ditetapkan sebagai tersangka. (kcm/int)


„ Komite Etik KPK saat menyampaikan keputusan penyelidikan terkait bocornya sprindik Anas Urbaningrum.

Polri Belum Temukan Unsur Pidana Kasus Sprindik Anas JAKARTA-Penyidik Badan Reserse Kriminal Polri belum menemukan dugaan pelanggaran pidana dari kasus bocornya draf surat perintah penyidikan (sprindik) atas nama Anas Urbaningrum. Untuk itu, kepolisian belum dapat mengusut kasus yang sempat dilaporkan mantan Ketua DPC Cilacap Partai Demokrat Tri Dianto. “Jadi kita belum melihat apakah ini berkaitan dengan adanya pelanggaran hukum pidana yang menjadi ranah dari kepolisian,” kata Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar di Mabes Polri, Jakarta Selatan, Jumat (5/4). Sebelumnya, Tri Dianto berulang kali mendatangi Gedung Bareskrim Polri untuk melaporkan kasus tersebut, baik sebelum maupun sesudah Komite Etik KPK mengumumkan hasil penyelidikan. Menurut Tri, Komite Etik belum mengungkap dalang pembocor draf sprindik yang beredar sebelum Anas resmi ditetapkan menjadi tersangka oleh KPK. Tri meminta kasus itu ditangani oleh kepolisian. Komite Etik KPK sebelumnya juga memutuskan bahwa pelaku utama pembocoran dokumen sprindik Anas adalah Sekretaris

Ketua KPK Abraham Samad, Wiwin Suwandi. Wiwin yang tinggal satu rumah dengan Abraham itu menghubungi media untuk memberikan fotokopi draf sprindik Anas. Hal ini merupakan keputusan Komite Etik dalam jumpa pers di Gedung KPK, Rabu (3/4). Wiwin akhirnya dipecat sebagai sekretaris Abraham. Adapun Abraham dianggap lalai dalam mengawasi sekretarisnya sehingga terjadi pembocoran dokumen sprindik tersebut. Menurut Komite Etik, Abraham tidak terlibat secara langsung dalam proses pembocoran sprindik. Atas pelanggaran ini, Komite Etik menjatuhkan sanksi berupa peringatan tertulis kepada Abraham. Komite Etik juga meminta Abraham memperbaiki sikap dan perilakunya serta memegang teguh kode etik pimpinan KPK. Komite Etik dipimpin Anis Baswedan dan beranggotakan Wakil Ketua KPK Bambang Widjojanto, penasihat KPK Abdullah Hehamahua, mantan pimpinan KPK Tumpak Hatongaran Panggabean, serta mantan hakim Mahkamah Konstitusi Abdul Mukti Fadjar. (kcm/int)


6 April 2013

Kilang Kayu di Rawagenjer Resahkan Warga

Rakyat Inginkan Caleg Pejuang! TAPTENG- Pemilu Legislatif 2014 sudah di depan mata. Seperti di Tapteng, pendaftaran para calon legislatif (caleg) ke KPUD ditenggat 9-22 April nanti. Lantas bagaimana harapan rakyat kepada para caleg yang akan diusung partai politik itu?

Bapak Kapolda Sumut yang terhormat, tolong selamatkan hutan kami yang selalu dibabat oleh oknum tak bertanggungjawab. Dengan adanya kilang kayu di Desa Rawagenjer, Kecamatan Sibabangun, Tapteng sangat meresahkan masyarakat sekitar. Pengirim: 081269022xxx

“Caleg itu maunya yang benar-benar pejuang kepentingan rakyat. Jangan pada saat kampanye saja mengumbar janji, sumbang sana-sini, tapi setelah duduk jadi lupa kepada rakyat. Bahkan kerjanya hanya mengurusi proyek, atau makan gaji buta,” tukas Tumpal Purba (43), warga Pandan, Tapteng, Jumat (5/4). Harapan bercampur pesimis juga disampaikan JP Simorangkir (38), warga Tapteng. Dia bahkan bertekad tidak akan menyalurkan hak suaranya jika para figur yang diusung partai politik tidak kompeten. “Masyarakat sudah jenuh dan pesimis. Salah satu indikatornya, pemilih banyak yang golput jika ada pemilihan umum. Untuk caleg nanti, partai politik hendaknya melakukan penjaringan secara ketat. Lihat sosok atau figur yang memang serius memperjuangkan aspirasi masyarakat,” tandasnya. (mora)

Warga Keberatan PLN Padam Tiap Hari Kepala PLN Sibolga yang terhormat, kami masyarakat merasa keberatan dengan padamya listrik setiap hari. Aktifitas kami sangat terganggu. Harap mengerti Pak, terima kasih. Pengirim: 087767564xxx

Jalan Simargarap Butuh Perbaikan Bapak Bupati Tapteng yang terhormat, tolong berikan sedikit perhatian untuk memperbaiki Jalan Simargarap yang sudah rusak parah. Hal ini sudah sangat meresahkan kami selaku pengguna jalan. Terima kasih. Pengirim: 081397125xxx


DPRD- Pengunjuk rasa mendatangi ke kantor DPRD Tapteng dengan membawa batu nisan simbol matinya marwah lembaga wakil rakyat itu, tahun lalu.

Juan Ferry Pengurus LSM di Sibolga-Tapteng

“Kita tidak ingin DPRD Tapteng di periode berikutnya juga kisruh seperti yang duduk kini. Itu ditentukan oleh partai politik pengusung figur caleg yang akan dipilih rakyat. Artinya partai politik harus jeli dan bijaksana menjaring calegnya.”

Korban Salah Tangkap HIDUP 42 TAHUN DALAM PENJARA ARIZONA – Pria di Negara Bagian Arizona, Amerika Serikat (AS) akhirnya menghirup udara bebas setelah dipenjara selama 42 tahun. Louis Taylor dilepaskan setelah pengadilan menyatakan tidak ada bukti cukup yang menunjukkan dia bersalah. Taylor ditahan polisi pada tahun 1970 silam saat dia masih berusia 16 tahun. Dia dituduh menjadi dalang peristiwa kebakaran Hotel

Pioneer yang menewaskan 28 orang. Taylor diberikan dua pilihan oleh pengadilan. Menerima putusan itu dan

„ Louis Taylor

bebas secepatnya atau menjalani proses persidangan selama dua tahun lagi agar dapat membersihkan namanya. Taylor merasa masa hidupnya di dalam penjara sudah terlalu lama dan memutuskan untuk tidak meneruskan kasus tersebut. Taylor menyebut hakim

yang mengadilinya 42 tahun silam menjalankan persidangan dengan tidak adil. Saat itu sang hakim memutuskan dia bersalah walaupun tidak memiliki bukti yang cukup. “Ada dua tragedi dalam hidup saya, peristiwa kebakaran itu dan masa hukuman yang saya terima,” ujar Taylor. (oz/nik)


EKSPRESI UNIK-Foto wajah manusia dengan ekspresi unik bagian tubuh yang dipotong dari majalah fashion.

Foto Unik dari Potongan Tubuh Tampil di Majalah PARIS – Salah satu karya seni yang aneh muncul di Paris, Perancis. Karya seni ini dibuat dengan menggabungkan wajah seseorang dengan bagian tubuh manusia yang diambil dari majalah untuk membuat ekspresi wajah yang aneh. Seniman Bruno Metra dan Laurence Jeanson membuat seni ekspresi wajah dengan menggunakan foto bagian tubuh yang dipotong dari majalah fashion. Kedua seniman Perancis ini membuat proyek unik yang disebut ID, dimana mereka menunjukkan gambaran keindahan yang tidak alami, seperti seseorang yang menjalani operasi plastik.

Dalam karya seni yang dibuat oleh Metra dan Jeanson ini menggunakan cara menempelkan potongan-potongan foto bagian tubuh seperti mata, hidung, bibir dari majalah ke wajah seseorang model untuk difoto dan menampilkan ekspresi yang aneh. Metra mengatakan bahwa media seperti majalah fashion dapat mempengaruhi orang-orang dalam berdandan dan bersikap. “Majalah dan televisi terus menciptakan hal baru yang menjadi referensi sosial. Kekuatan media juga dapat mempengaruhi identitas seseorang,” kata Metra, Jumat (5/4). (oz/nik)


AKSI-Jumpy dengan aksi nekatnya di tengah jalan.

Jumpy, Si Anjing Ajaib Penantang Maut ajah Anda Wuih, Ada Tarantula Sebesar WWajah SRILANKA - Kebanyakan orang pasti akan merasa takut melihat laba-laba. Yang kecil saja bisa membuat bergidik, apalagi yang besar. Kini telah ditemukan spesies laba-laba baru berjenis tarantula sebesar wajah Anda. Wow! Tarantula tersebut

ditemukan penduduk desa di Srilanka. Sebelumnya pada 2009, warga sempat membawa laba-laba itu kepada ahlinya setelah membunuh spesies reptil berbahaya tersebut. Para ilmuwan menduga laba-laba jenis arachnid ini adalah spesies yang tidak

pernah ditemukan sebelumnya. Tetapi kini para ahli, mengonfirmasikan jika masih ada turunan laba-laba tersebut, Jumat (5/4). ”Kami mencari di setiap lubang pohon dan batang kulit pohon, ini juga untuk kepuasan pencarian kami juga,” tutur sang peneliti

Ranil Nanayakkara. Tarantula itu, menjadi bagian dari gen laba-laba harimau, mempunyai tanda khusus termasuk dafodil yang memiliki warna kuning di kakinya dan berwarna pink di bagian perutnya. Berdasarkan penelitian dari Biodiversity Education

and Research Organization Srilanka, reptil ini ditemukan hidup di sekitar rumah sakit di daerah Mankulam. Mereka dinamakan Poecilotheria, sebagai lambang kehormatan terhadap inspektur polisi Michael Rajakumar Purajah, yang memimpin penelitian tersebut. (oz/nik)

CANBERRA - Sebuah video tentang seekor anjing yang telah melakukan 20 aksi menantang dalam film menghebohkan internet. Anjing bernama Jumpy ini mendadak menjadi terkenal. Video menakjubkan itu diposting ke YouTube dengan judul ‘Bad Ass Dog’. Video ini dipercaya menggunakan banyak trik sehingga aksi menakjubkan Jumpy terlihat tidak nyata. Namun, sang pemilik Omar Von Muller membantahnya dan menyatakan, kalau semua

aksi yang dilakukan anjing peliharaannya itu adalah asli tanpa rekayasa. Dalam video yang berdurasi satu menit sembilan detik ini memperlihatkan keahlian Jumpy seperti, melompat, memanjat dinding, berenang, bahkan bermain skuter. Omar mengatakan bahwa rahasia kesuksesan melatih Jumpy adalah konsisten saat melatihnya. Video menakjubkan ini mendapat banyak komentar dari pengguna YouTube seperti yang ditulis oleh akun MissMichSan. (oz/nik)


6 April 2013



(21 Desember -19 Januari)

Karier: Kalau memungkinkan, selesaikan pekerjaan yang tertunda. Asmara: Harus lebih percaya sama dia, bukan sama temanny


(20 Januari - 18 Februari)

Karier: Tim kerja membutuhkan seseorang yang bisa menjadi perencana yang baik. Asmara: Cinta tidak bisa dipaksakan.


19 Februari - 20 Maret

Karier: Jangan terlalu membayangkan hal-hal sempurna. Asmara: Salah satu rencana bersama dia akan terlaksana.


(21 Maret - 20 April)

Karier: Jangan habiskan hari-hari hanya untuk memikirkan pekerjaan. Bisa jenuh. Asmara: Aman-aman saja.


(21 April - 20 Mei)


(21 Mei - 20 Juni)

Karier: Mainkan kartu dengan tepat, kamu pasti bisa maju. Asmara: Cinta mulai merasuki hidup Anda.

Karier: Awas stres karena sedang tak ada kesibukan atau pekerjaan. Lakukan sesuatu. Asmara: Yang namanya hubungan cinta memang tidak selalu mulus.


(21 Juni- 20 Juli)

Karier: Gunakan sejumlah pemikiran rasional. Hadapi hari esok dengan tenang dan percaya diri. Asmara: Semakin lengket.


(21 Juli-21 Agustus)

Karier: Anda tidak mempunyai rencana yang baik dalam menjalani pekerjaan. Sikap ini membuat Anda cepat merasa bosan. Segeralah susun rencana dan target.


(23 September - 22 Oktober)

ATIQAH Hasiholan belum menentukan bagaimana konsep pernikahannya bersama sang kekasih, Rio Dewanto. Namun, ia ingin pernikahannya nanti berlangsung sederhana, intim, dan indah. "Yang pasti sederhana, kan dasarnya simpel, aku mau kelihatan elegan tapi juga simpel. Simpel yang elegan," ucapnya ditemui di Hotel Ritz Carlton, Pacific Place, Jakarta. Namun, wanita kelahiran Jakarta, 3 Januari 1982 itu, masih merahasiakan jadwal pernikahannya. Ia berkilah tanggal pernikahannya memang belum ditentukan. Makanya, ia belum bisa membeberkan. "Kan saya sudah lamaran ya, terus kalau tanggalnya ada berita di bulan Agustus, tapi sebenarnya kami belum tahu tanggalnya kapan. Yang jelas, karena sudah lamaran pasti tujuannya ke sana," ucapnya. Pokoknya, lanjut dia, secepat mungkin. Tapi, pernikahan itu nampaknya tidak akan dilangsungkan Agustus 2013. Mengingat kesibukannya yang padat. Demikian pula Rio. "Yang pasti setelah Agustus, karena kan ya kesibukan masing-masing," ucapnya. Setelah Lebaran? "Insya Allah," tandasnya. (tr/int)

Karier: Bakal ketemu orang yang akan mengubah hidup kamu. Tetapi semua butuh proses. Asmara: Jangan kecewakan si dia.


(23 Agustus-22 September)

.Karier: Akan ada keberuntungan di kantor Anda Asmara: Bagaimanapun juga hati Anda masih untuk si dia.


(23 Oktober – 22 November)

Karier: Curahkan kreativitas Anda. Percaya diri sajalah. Asmara: Anda diminta si dia untuk bersabar.


( 23 November - 20 Desember)

Karier: Jangan menumpuk pekerjaan, jika memang bisa Anda selesaikan hari ini. Asmara: Makin akrab, makin asyik.


Dibantu Pacar Bikin Single Baru RINI Wulandari sepertinya tidak bisa jauh dari musisi. Selepas pisah dengan Anji yang merupakan mantan vokalis Drive, kini Rini berpacaran dengan seorang musisi lainnya bernama Pandu. "Dia suka musik dan pemusik juga. Jadi kalau ngomongin musik nyambung. Aku lagi buat single dan dia yang buat musiknya juga, kita kerja bareng," kata Rini di Studio RCTI Kebon Jeruk Jakarta Barat, Jumat (5/4). Sebenarnya, kata Rini, Pandu sudah main musik sejak umur 8 atau 9 tahun saat masih berada di luar negeri. Saat balik ke Indonesia dia main musik juga sama kakaknya. "Cuman kakaknya udah di luar. Daripada suka ngejam sendiri mending bantu aku bikin single," jelas Rini. "Dia sebagai music directornya, ngerjain musiknya doang. Aku kan tidak bisa main musik, cuma bisa nyiptain lagu," tambahnya. (ajpnn)


Nyaris jadi Istri Eyang Subur EYANG Subur diduga kerap 'membajak' istri orang lain untuk dinikahi. Setelah terungkap mantan istri Septian Dwi Cahyo diperistri Subur, kini artis Ratna Listy dikabarkan juga hampir menjadi istri sang paranormal. Benarkah? Ratna mengatakan dirinya memang pernah mengunjungi rumah Subur pada 1996 silam saat dirinya datang ke Jakarta. Namun ia mengaku hanya sekali datang karena tak ingin terjebak dalam situasi. Namun urusan pernah diminta menjadi istri Subur atau tidak, Ratna

mengaku tak pernah diminta secara langsung. Penyanyi yang menggeluti genre keroncong itu hanya mengatakan, dirinya memang terus mendapat undangan untuk bertandang ke kediaman Subur di Tanjung Duren. Ratna mengatakan dirinya jelas tak mau bila diminta menjadi istri Subur. Apalagi Ratna ke Jakarta saat itu memang untuk merintis karier di dunia hiburan. "Jelas enggak mau (kalo ditawarin istri)! Saya jauh-jauh di Jakarta itu ingin berkarier di dunia entertainment," tegasnya. (dtc/int)

PASUKAN khusus kepolisian (SWAT) Los Angeles menyerbu rumah Rihanna, Kamis (4/4) malam. Langkah tersebut dilakukan setelah seorang pria tak dikenal menghubungi hotline darurat 911. Disebutkan pemilik hit "Umbrella" itu dalam bahaya besar. Dua pria bersenjata berhasil memaksa masuk rumah serta seorang diantaranya berulangkali melepas tembakan. Kepolsiain dan pasukan SWAT dengan kendaraan lapis baja langsung diturunkan. Hasilnya, dua orang bersenjata tadi ternyata tak ada. Rihanna yang dalam laporan per telepon disebut berada dalam rumah, malah baru muncul beberapa jam setelah penyergapan berlangsung. Swated kini seperti jadi epidemi yang sulit diberantas kepolisian Ameika Serikat. Selebriti lain seperti Justin Bieber, Clint Eastwood, Miley Cyrus, dan Tom Cruise sempat jadi korban. Kasus ini sempat membuat seorang bocah berumur 12 tahun ditahan karena diduga membuat laporan palsu lewat 911. (jpnn)


AKTRIS dan bintang sinetron Risty Tagor mulai mengurangi aktivitasnya di depan layar kaca sejak memiliki anak, Arsen Raffa Balweel yang sudah menginjak dua tahun. "Semua kegiatanku bisa di-manage dan suami syuting sinetron, jadi quality time saat bangun tidur, ngurus sarapan dia dan diatur sedemikian rupa dan cari nyamannya. Karena aku nggak mau ninggalin anak kalau nggak ada suami atau keluarga," ujarnya di kawasan Kebayoran Baru, Jakarta Selatan, Jumat (5/ 4). Dengan membatasi aktivitas, bintang film Bestfriend tersebut kini

bisa lebih memaksimalkan waktu bersama anak semata wayangnya. "Kami lebih sering kumpul bareng-bareng kalau Rifky libur kami berenang. Kalau ada event ultah kami usahain ngumpul dan biasanya keluarga besar aku juga akhir minggu selalu kumpul," papar dara berusia 23 tahun tersebut. Risty pun menikmati menjadi ibu muda dengan satu anak. Namun, belum ingin tambah anak. "Kalau di mulut sih, pingin, tapi di hati Allah tahu yang terbaik dan anak aku masih butuh banyak didampingi," tuturnya. (idc/int)



6 April 2013

Bukan Hari TERBAIK Pedrosa

Jorge Lorenzo mengawali kiprahnya di MotoGP Qatar dengan baik. Pebalap andalan Yamaha itu mencatat waktu tercepat dalam sesi latihan bebas pertama, di depan Cal Crutchlow dan Valentino Rossi. LORENZO, Crutchlow, dan Rossi bersaing ketat dalam sesi di Sirkuit Losail. Namun, Lorenzo-lah yang akhirnya sukses mengukir waktu tercepat dengan catatan 1 menit 56,685 detik. Crutchlow harus puas menempati posisi kedua. Pebalap Yamaha Tech 3 itu membukukan waktu 1 menit 56,743 detik atau berselisih 0,058 detik dari catatan waktu Lorenzo. 1. Jorge Lorenzo 2. Cal Crutchlow 3. Valentino Rossi 4. Marc Marquez 5. Andrea Dovizioso 6. Alvaro Bautista Gresini 7. Stefan Bradl LCR 8. Dani Pedrosa 9. Aleix Espargaro 10. Nicky Hayden 11. Bradley Smith 12. Andrea Iannone Pramac 13. Ben Spies Pramac 14. Hector Barbera Avintia 15. Randy de Puniet 16. Karel Abraham Cardion 17. Colin Edwards Forward 18. Yonny Hernandez PBM 19. Hiroshi Aoyama Avintia 20. Claudio Corti Forward 21. Danilo Petrucci 22. Bryan Staring Gresini 23. Lukas Pesek 24. Michael Laverty

Rossi yang kembali bernaung di bawah bendera Yamaha juga terlihat sangat kompetitif. Catatan waktunya 1 menit 56,756 detik. Posisi keempat jadi milik pebalap debutan yang membela Repsol Honda, Marc Marquez. Andrea Dovizioso juga meraih hasil cukup bagus bersama Ducati dengan duduk di urutan kelima. Dani Pedrosa hanya menduduki posisi kedelapan,

di belakang Alvaro Bautista dan Stefan Bradl. Aleix Espargaro dan Nicky Hayden melengkapi posisi sepuluh besar. (int)

Hasil Free Practice I MotoGP Qatar Yamaha 1m56.685s Tech 3 Yamaha 1m56.743s + 0.058s Yamaha 1m56.756s + 0.071s Honda 1m57.276s + 0.591s Ducati 1m57.538s + 0.853s Honda 1m57.601s + 0.916s Honda 1m57.670s + 0.985s Honda 1m57.749s + 1.064s Aspar Aprilia 1m57.843s + 1.158s Ducati 1m57.926s + 1.241s Tech 3 Yamaha 1m58.369s + 1.684s Ducati 1m58.559s + 1.874s Ducati 1m58.575s + 1.890s FTR-Kawasaki 1m59.608s + 2.923s Aspar Aprilia 1m59.633s + 2.948s Aprilia 1m59.758s + 3.073s FTR-Kawasaki 2m00.341s + 3.656s Aprilia 2m00.426s + 3.741s FTR-Kawasaki 2m00.563s + 3.878s FTR-Kawasaki 2m01.227s + 4.542s Ioda-Suter-BMW 2m01.438s + 4.753s FTR-Honda 2m01.942s + 5.257s Ioda-Suter-BMW 2m02.079s + 5.394s PBM-Aprilia 2m02.135s + 5.450s

DANI PEDROSA secara mengejutkan hanya mampu finis kedelapan pada free practice atau sesi latihan bebas perdana MotoGP Qatar. Pembalap Repsol Honda itu mengaku, ”Ini bukan hari saya.” Penampilan mengecewakan diperlihatkan Pedrosa. Pebalap yang sedang dalam kondisi terbaik selama tes itu hanya mampu mencatat waktu 1 menit 57.749 detik. Pedrosa tertinggal jauh 1.064 detik dari Jorge Lorenzo yang menjadi pembalap tercepat. Motor pebalap yang tahun lalu menjadi runner up itu ternyata harus melebar sebanyak dua kali dalam tes itu. Pedrosa mengatakan motornya memiliki masalah saat hendak memasuki tikungan di Sirkuit Losail. “Hari ini bukan terbaik buat kami. Kami tidak mampu mengendarai motor dengan baik karena saya memiliki sedikit masalah saat hendak memasuki tikungan,” jelas pebalap asal Spanyol itu, diberitakan Crash. Dalam sesi pembuka itu, Pedrosa memang terlihat tidak mampu bersaing dengan motor tim Yamaha yang mendominasi pada sesi ini. Selain Lorenzo, pembalap Yamaha Tech 3, Cal Crutchlow juga mampu menempati peringkat kedua dan Valentino Rossi

ada di posisi ketiga. “Itu yang membuat kami tidak mampu mencat atkan waktu terbaik. Kami berharap semua membaik pada sesi besok dan kami bisa mencatatkan waktu lebih baik lagi,” tandasnya. (int)



SABTU 6 April 2013



Bursa METRO WBA ½ : 0 Arsenal Prediksi Skor WBA 1-2 Arsenal

DUO pemain Arsenal Theo Walcott dan Jack Wilshere tengah menepi karena bekapan cedera. Keduanya diprediksi absen saat Arsenal melawat ke kandang West Bromwich Albion (WBA), dan mungkin kembali bermain mulai pekan depan.


ilshere kembali menda patkan cedera pada 12 Maret lalu. Dia diprediksi membutuhkan waktu selama tiga pekan untuk menyembuhkan cedera pergelangan kaki yang membekapnya. Belum juga Wilshere pulih, satu

„ Walcott dan Wilshere

Chelsea 3-1 Rubin Kazan


Ketajaman El Nino DUA gol yang diciptakan Fernando Torres ke gawang Rubin Kazan membuat manajer interim Chelsea, Rafa Benitez, puas. Benitez pun berharap Torres bisa mencetak gol lagi di laga selanjutnya. Torres tampil cemerlang saat Chelsea menjamu Rubin di leg pertama perempatfinal Liga Europa, Jumat (5/4) dinihari. El Nino mencetak dua gol dan membantu The Blues menang dengan skor 3-1. Dengan tambahan dua gol itu, Torres sudah mencetak 19 gol dalam 52 laga di semua kompetisi musim ini. “Ini bagus untuk kepercayaan dirinya. Tapi, kinerjanya di lapangan juga sangat bagus. Jadi, saya sangat senang dengannya,” aku Benitez yang dikutip BBC. Saat ini Torres tak mendapatkan jaminan sebagai starter di lini depan Chelsea. Striker asal Spanyol itu harus menghadapi persaingan dengan Demba Ba. “Dia berlatih dengan sangat baik setiap hari, jadi ini cuma masalah waktu saja. Dia mencetak dua gol hari ini dan semoga akan begitu lagi di pertandingan berikutnya,” kata Benitez. Harusnya Menang Besar Skor 3-1 yang didapat The Blues tak lantas memuaskan Rafael Benitez yang merasa skuatnya layak unggul lebih besar. Di Stamford Bridge, Jumat (5/4) dinihari, dua gol kemenangan Chelsea dibuat Fernando Torres sementara satu lainnya dilesakkan oleh Victor Moses. Gol balasan tim tamu datang dari eksekusi penalti Bebars Natcho. Meski meraih kemenangan, Rafael Benitez tak sepenuhnya puas dengan hasil tersebut. Chelsea disebutnya bisa tampil lebih baik lagi dan mencetak keunggulan dengan skor lebih besar. “Itu bisa saja lebih baik lagi, tapi saya tak bisa mengubah keadaannya sekarang. Penalti itu keputusan yang keras, tapi Anda tak bisa mengubah keputusan itu, jadi Anda harus melanjutkannya dan mencetak gol ketiga. Kami berhasil melakukannya (mencetak gol ketiga) tapi saya mengharapkan gol keempat,” sahut Rafa usai pertandingan seperti diberitakan BBC. Kecolongan satu gol saat bermain di kandang bisa jadi membahayakan peluang Chelsea lolos. Di leg kedua yang dilangsungkan pekan depan, Chelsea bakal terdepak andai wakil Rusia itu bisa menang 2-0. Namun Rafa yakin dengan kemampuan timnya yang punya banyak pemain top dunia. “Akan lebih sulit (di leg kedua) karena mereka akan bermain menyerang dan menyerang, tapi kami punya kualitas di tim kami,” lanjut pelatih berkebangsaan Spanyol itu. Jalan Pertandingan Percobaan Ramires pada menit ke-11 tak terlalu membahayakan gawang Rubin. Sepakan kerasnya dari luar kotak penalti masih melambung tinggi. Lima menit kemudian, Chelsea membuka skor. Umpan panjang David Luiz dari tengah lapangan diterima Torres yang berlari di kotak penalti. Meski dikawal satu bek lawan, Torres masih bisa

kabar kurang menggembirakan didapat oleh Arsenal. Walcott mengalami cedera kunci paha usai memenuhi panggilan membela Inggris di kualifikasi Piala Dunia. Terkait kondisi Walcott dan Wilshere, asisten manajer ‘Gu-

dang Peluru’, Steve Bould, menyampaikan kabar positif. Dia mengungkapkan bahwa kedua pemain itu diprediksi bakal comeback pekan depan. “Kami mempunyai kabar bagus terkait keduanya,” ungkap Bould seperti dilansir situs resmi Arsenal. “Jack (Wilshere) dan Theo (Walcott) sudah bisa berlari di luar latihan tim dan memiliki peluang untuk bisa masuk dalam pertandingan melawan Norwich (City) pada hari Sabtu pekan depan,” tambahnya. (int)

- Arsenal berhasil menaklukkan West Bromwich Albion 2-0 pada pertemuan pertama kedua tim musim ini di Emirates Stadium, berkat dua penalti Mikel Arteta. Ini adalah kemenangan ketiga Arsenal atas West Brom secara beruntun. Arsenal juga berhasil mengalahkan West Brom 3-2 pada pertemuan terakhir kedua tim di Hawthorns musim lalu. West Brom belum pernah lagi mengalahkan Arsenal di Hawthorns sejak Oktober 2005. - West Brom belum beranjak dari peringkat-8 klasemen dengan 44 poin dari 31 pertandingan, terpaut sembilan poin dari Arsenal di zona Eropa. West Brom menyerah 1-3 dari West Ham akhir pekan lalu, dan harus rela kehilangan gelandang

Youssouf Mulumbu yang mendapat kartu merah. - Performa West Brom sedang tidak konsisten, hanya mampu meraih tiga kemenangan dari 12 laga terakhirnya di Premier League dan menelan tujuh kekalahan. - West Brom juga selalu kebobolan dari enam laga kandang terakhirnya di Premier League, dengan tiga kemenangan dan menelan dua kekalahan. Sebanyak 26 dari total 41 kebobolan West Brom tercipta di babak kedua. - Striker West Brom Romelu Lukaku adalah topskor klub dengan 13 gol. - Arsenal belum beranjak dari peringkat-5 klasemen dengan 53 poin dari 30 laga, terpaut hanya dua poin

dari zona Champions. Arsenal berhasil membantai Reading 4-1 akhir pekan lalu di Emirates Stadium. - Arsenal hanya kalah sekali dari delapan laga terakhirnya di Premier League, meraih enam kemenangan dan sekali imbang. Performa tandang Arsenal di Premier League sejauh ini adalah enam kemenangan, lima imbang, dan empat kekalahan. - Arsenal tidak pernah gagal mencetak gol pada sembilan laga terakhirnya di Premier League. Arsenal juga tidak pernah gagal mencetak gol pada delapan laga tandang terakhirnya. - Gelandang Arsenal Santi Cazorla adalah topskor klub dengan 12 gol. Sebanyak 36 dari total 59 gol Arsenal tercipta di babak kedua

PRAKIRAAN PEMAIN: West Bromwich Albion ( 4-3-3 ) : 1.Ben Foster ( Kiper ) , 3.Jonas Olsson ( Bek ) , 6.Liam Ridgewell ( Bek ), 23.Gareth McAuley ( Bek ), 12.Steven Reid ( Bek ), 5.Claudio Yacob (Gelandang ), 7.James Morrison ( Gelandang ) , 21.Youssuf Mulumbu (Gelandang ), 22.Zoltán Gera (Striker), 9.Shane Long ( Striker ),24.Peter Odemwingie (Striker) Arsenal ( 4-4-2 ) : 24.Vito Mannone, ( Kiper ) , 4.Per Mertesacker ( Bek ) , 5.Thomas Vermaelen (Bek ), 11.Andre Santos ( Bek ), 6.Laurent Koscielny ( Bek ), 2.Abou Diaby ( Gelandang ), 8.Mikel Arteta ( Gelandang ) , 19.Santiago Cazorla (Gelandang ), 16.Ramsey ( Gelandang ), 17.Olivier Giroud ( Striker ), 9.Lukas Podolski ( Striker ).

Musim Bale Terancam Habis

„ Torres menceploskan bola ke dalam gawang melewati hadangan kiper Sergei Ryzhikov. Rubin hampir saja menyamakan kedudukan pada menit ke-20. Tendangan Natcho dari luar kotak penalti melaju deras ke gawang Chelsea, tapi Petr Cech mampu mementahkannya. Tim tuan rumah menggandakan keunggulannya pada menit ke-32. Moses yang mendapatkan bola liar di kotak penalti Rubin melepaskan tendangan voli yang tak bisa diantisipasi Ryzhikov. Berselang delapan menit, Rubin mendapatkan hadiah penalti menyusul handball John Terry di area terlarang. Natcho maju sebagai eksekutor dan sukses mengelabui Cech. Chelsea 2, Rubin 1. Rubin nyaris menyamakan skor pada menit ke-45. Sial buat mereka, sepakan keras Cristian Ansaldi masih melenceng tipis. Empat menit setelah babak kedua dimulai, Juan Mata punya kesempatan untuk mencetak gol. Namun, tendangannya bisa digagalkan Ryzhikov. Peluang yang didapat Terry pada menit ke-60 juga tak mengubah keadaan. Sundulannya meneruskan sebuah sepak po-

jok masih melambung. Beberapa saat kemudian, gawang Chelsea diancam Salomon Rondon. Tapi, tembakan Rondon dari depan kotak penalti bisa diamankan Cech. Memasuki menit ke-70, Torres kembali mencatatkan namanya di papan skor. Diawali umpan silang Mata dari sisi kiri, dia mengalahkan Ansaldi dalam duel udara dan menanduk bola ke dalam gawang. Ramires menjajal peruntungannya lagi pada menit ke-90 lewat tendangan voli dari luar kotak penalti. Tapi, arah bola masih melebar. (int) SUSUNAN PEMAIN CHELSEA: Cech, Azpilicueta, Luiz, Terry, Bertrand, Ramires, Lampard, Moses (Hazard 65'), Mata (Oscar 78'), Benayoun (Marin 83'), Torres RUBIN: Ryzhikov, Navas, Kuzmin (Kasaev 82'), Kaleshin, Ansaldi, Orbaiz, Sharonov, Eremenko, Natcho, Karedeniz, Dyadyun (Rondon 46')

LONDON- Gareth Bale terkapar di atas lapangan dan mengerang kesakitan sebelum ditandu keluar lapangan. Terpelintir di bagian pergelangan kaki, Tottenham Hotspur terancam ditinggal pemainnya itu sampai akhir musim. Sempat tertinggal dua gol, Tottenham Hotspur akhirnya bermain imbang 2-2 saat menjamu FC Baseldilegpertamababakdelapan besarLigaEuropa.KubuSpursjelas tak puas dengan hasil tersebut, namunadahallainyangmembuat mereka masih merasakan kegetiran terkait kondisi Gareth Bale. Saat pertandingan memasuki periode injury time babak kedua, Bale terjatuh dalam posisi yang tidak sempurna usai berebut bola dengan pemain Basel. Tayangan ulang memperlihatkan pergelangan kaki pemain Wales itu seperti terpelintir. Kondisi tersebut membuat dia dikhawatirkan mengalami cedera parah di pergelangan kaki dan bisa menyebabkan dirinya absen hingga musim ini tuntas. Bale langsung terkapar di atas rumput usai momen tersebut. Dia terlihat mengerang kesakitan dan langsung dihampiri tim medis The Lillywhites. Pesepakbola yang telah mencetak 22 gol di sepanjang musim 2012/2013 itu kemudian ditandu keluar lapangan. “Pergelangan kakinya terputar, saat ini dia merasakan sakit yang amat, tapi semoga yang terjadi bukanlah yang terburuk,” ungkap Andre Villas Boas pada BBC usai pertandingan.

„ Gareth Bale AbsennyaBaleakanjadipukulan buat Spurs di sisa musim ini. Selain akan ditunggu laga sengit pada leg kedua di kandang Basel, mereka masih bertarung untuk meraih posisi empat besar demi meraih tiket Liga Champions musim depan. Basel tercatat tampil sedikit mendominasi dengan memenangi penguasaan bola hingga 51%. Namun, kedua tim sama-sama mendapatkan shots on target sama banyak, yakni enam. Dengan dua gol di markas Spurs, Basel punya keuntungan sebelum berlaga di kandang sendiri pada leg II pada 11 April mendatang. Newcastle Kalah Sementara itu di Stadion Da Luz, Newcastlekalah1-3melawanBenfica. Keunggulan yang diciptakan PapissCissedimenitke-12menjadi

tidakberarti.Setelamenerimaumpan dari Moussa Sissoko, Cisse dengan mudah melepaskan sontekan kaki kanan. Keunggulan ini hanya bertahan sampai menit ke25. Rodrigo membuat tim tuan rumah menyamakan kedudukan lewat sebuah tendangan dari jarak dekat.Sebelumgolitutercipta,Tim Krul sempat memblok seranngan Oscar Cardozo. Babak pertama berakhir dengan skor 1-1. Namun, Benfica yang tampil relatif lebih dominan, dan melepaskan sebanyak 20 tembakan sepanjang laga, menambah dua gol lagi di babak kedua. Kedua gol itu diciptakan oleh Lima Dos Santos pada menit ke-65 dan penalti Cardozo di menit ke-71 — setelah Steven Taylor handball di dalam kotak penalti.(int)


SABTU 6 April 2013





25 2

3 70-31


2 Man City


18 8

4 55-26


3 Tottenham


17 6

8 53-38


4 Chelsea


16 7

7 59-32


5 Arsenal


15 8

7 59-33


6 Everton



5 47-35


7 Liverpool


13 9

9 59-40


8 West Brom


13 5



9 Swansea City 31




10 Fulham


10 9



11 West Ham


10 6



12 Southampton 31

8 10



13 Stoke City


7 13



14 Norwich City 31

7 13



15 Newcastle






16 Sunderland


7 10



17 Wigan






18 Aston Villa






19 QPR


4 11



20 Reading








24 3

2 90-33


2 Real Madrid


19 5

5 72-28


3 Atlético Madrid 29

19 4

6 51-25


4 Real Sociedad 29

13 9

7 51-37


5 Málaga


13 8

8 41-28


6 Valencia


13 7

9 42-41


7 Real Betis


13 5



8 Getafe


12 7



9 Rayo Vallecano 29

13 2



10 Levante


11 7



11 Sevilla


11 5



12 Espanyol






10 5



13 Athletic Club 29



23 3

1 78-13


2 Dortmund


15 7

5 62-32


3 Leverkusen


14 6

7 50-35


4 Schalke 04


12 6

9 46-43


5 Mainz 05


10 9

8 34-30


6 Frankfurt


11 6

9 39-37


7 Freiburg


10 9

8 35-33


8 M’gladbach


9 11

7 35-37


9 Hamburger SV 27

11 5



10 Hannover 96 27

11 4



11 Nürnberg

8 10

8 29-32



12 Stuttgart






13 Bremen






14 Wolfsburg






15 Düsseldorf






16 Augsburg






17 Hoffenheim






18 Greuther









BARCELONA akan menyambut kembalinya Tito Vilanova di bench pertandingan La Liga. Akankah sang pelatih juga membawa kembali superioritas Barca yang sempat menurun?


arca akan menghadapi Real Mallorca pada Minggu (7/4) dinihari di Camp Nou. Menghadapi peringkat 19 klasemen sementara, tentu bukan perkara yang sulit untuk Los Cules. Namun Xavi Herandez dkk patut waspada, karena statistik menunjukkan mereka selalu kebobolan dalam dua partai terakhir di liga, meski melawan tim yang di atas kertas jauh di bawahnya. Dengan cederanya Lionel Messi dan baru pulangnya mereka dari lawatan ke Paris Saint Germain, peluang lawan agak membesar. Bahkan pelatih Mallorca, Gregorio Manzano, telah menyatakan ketidakhadiran Messi sebagai berkah. Tapi kembalinya Vilanova tentu akan membuat skuad Barca lebih bergairah. Barca yang mendapatkan hasil seri dan kekalahan di dua El Clasico di liga musim ini hanya perlu menghindari terjadinya krisis dan kesalahan seperti yang terjadi beberapa saat lalu agar tidak tersusul Madrid. Meski Messi cedera, namun kehadiran Vilanova di tepi lapangan tentu memberi suntikan moral pada para pemain. Patut diingat bahwa Vilanova berhasil membawa anak-anak asuhnya menembus rekor me-

Prediksi Skor Barcelona 3-1 Mallorca Bursa METRO Barcelona 0 : 1 ½ Mallorca

raih 55 poin dari 57 di paruh pertama musim ini. Tanpa Messi Bertandang ke Camp Nou membuat pelatih-pelatih di Liga Spanyol harus berpikir keras untuk meraih hasil terbaik. Tiadanya Lionel Messi setidaknya membuat pelatih Mallorca berkurang pusingnya. Mallorca akan menjadi tamu berikutnya yang berkunjung ke Camp Nou dalam lanjutan Liga Spanyol akhir pekan ini. Meski The Catalans baru bertarung habis-habisan di Liga Champions, tuan rumah tetap dijagokan bisa meraih hasil maksimal dalam laga yang akan digelar. Sadar laga akan sangat sulit, Mallorca setidaknya dapat sedikit kabar baik karena Lionel Messi dipastikan absen. Pemain terbaik dunia itu mengalami cedera hamstring saat berlaga di Paris. Dan disebut pelatih Gregorio Manzano, ketiadaan Messi mengurangi sakit kepala yang dia rasakan jelang laga tersebut. “Sakit kepala menjadi berkurang satu. Dengan Messi absen kami tak harus menghadapi mimpi buruk sepakbola atau mencoba menghentikan pemain yang mencetak gol lebih banyak dari tim yang jumlahnya

s a y a bahkan tidak tahu di Liga Spanyol ini,” seloroh Manzano di Football Espana. “Saya tidak bermaksud mengatakan kalau tanpa Messi berarti Barcelona bisa dikalahkan, karena masalahnya bukan itu. Kondisi yang sebenarnya adalah mereka kehilangan salah satu sumber golnya, pemain yang dikatakan mampu menentukan hasil pertandingan,” lanjut Manzano. Meski tipis, peluang Mallorca meraih poin dari lawatan ke Barcelona terbuka lebar. Selain karena faktor kelelahan, The Catalans fokusnya akan terbagi ke Liga Champions karena tengah pekan depan mereka akan gantian menjamu PSG. “Ya, hal itu jelas, tapi juga sangat relatif karena mereka tak ingin mengecewakan fansnya sendiri dan mencoba meraih kemenangan di akhir pekan ini,” papar dia lagi. (int)



21 5

4 59-19


2 Napoli


17 8

5 55-29


3 Milan


17 6

7 53-32


4 Fiorentina


15 6

9 54-37


15 5 10 47-39


5 Internazionale 30 6 Lazio


15 5



7 Roma


14 5


47 45

8 Catania


13 6


9 Udinese



8 38-38


10 Parma


10 8



11 Cagliari


10 8



12 Sampdoria


10 7



13 Bologna


10 6



14 Torino


8 12



15 Chievo


10 5



16 Atalanta


10 6



17 Genoa






18 Siena






19 Palermo


4 12



20 Pescara






AGENDA METRO SABTU (6/4) 15.30 WIB :Persija 21.45 WIB :Rennes 22.00 WIB :WBA 23.45 WIB :Juventus 23.45 WIB :Real Madrid

vs vs vs vs vs

Persiram (ISL) : PSG (Ligue 1 Prancis) : Arsenal (Liga Inggris) : Pescara (Serie A Italia) : Levante (Liga Spanyol) :

MINGGU (7/4) 00.45 WIB :Montpellier 03.40 WIB :Barcelona 15.30 WIB :Persib 18.30 WIB :Fiorentina 18.45 WIB :Saint-Etienne 19.00 WIB :Mitra Kukar 21.00 WIB :Sampdoria 20.30 WIB :Liverpool 21.45 WIB :Reims 22.00 WIB :Chelsea

vs vs vs vs vs vs vs vs vs vs

Valenciennes (Ligue 1 Prancis) : B Channel (Live) Mallorca (Liga Spanyol): (Trans TV) Persiba Balikpapan (ISL) : ANTV (Live) AC Milan (Serie A Italia) : TVRI (Live) Evian TG (Ligue 1 Prancis) : B Channel (Live) Barito Putera (ISL) : ANTV (Live) Palermo (Serie A Italia) : TVRI (Live) West Ham United (Liga Inggris) :Global Tv (Live) Lyon (Ligue 1 Prancis) : B Channel (Live) Sunderland (Liga Inggris) : Global Tv (Live)

ANTV (Live) B Channel (Live) Global TV (Live) TVRI (Live) Trans TV (Live)



Manfaatkan Euforia Champion WALAU peluang untuk mengejar Barcelona dalam perebutan gelar juara La Liga 2012/2013 sulit, Real Madrid tetap mematok poin penuh saat menjamu Levante akhir pekan nanti. Euforia kemenangan atas Galatasaray di leg pertama perempatfinal Liga Champion 2012/2013, akan menjadi penyemangat bagi skuad lapis kedua Los Blancos saat laga melawan Levante. Poin penuh wajib diusung skuad asuhan Jose Mourinho ini guna menghindari kejaran Atletico Madridyanghanyaberselisih1poindariRealMadrid. Jose Mourinho diprediksi akan menurunkan pemain pelapisnya pada laga melawan Levante nanti, guna memberi kesempatan untuk beristiraht bagi para pemain inti, karena tengah pekan depan Real Madrid kembali akan bertarung melawan Galatasaray di leg kedua babak perempat final Liga Champion 2012/2013. El Real yang tertinggal 13 poin dari Barcelona akan berusaha mengamankan posisi dua sekaligus menjaga peluang menjuarai Copa Del Rey dan meraih Liga Champions ke sepuluh. Mereka harus fokus bersaing dengan Atletico di liga dan final Copa. Meskipun pertengahan pekan ini Real Madrid harus melakukan pertandingan krusial di saat berhadapan dengan Galatasaray, namun El Real memiliki skuat hebat yang berlapis-lapis. Jika pun mereka menurunkan pemain lapis kedua pada pertandingan melawan Levante, hal itu tetap membuat Real Madrid lebih diunggulkan. Levante yang menempati posisi sepuluh klasemen sementara La Liga dengan koleksi poin sebanyak 40 angka, sejauh ini masih aman dari ancaman zona degradasi. Untuk itu, mereka akan

bermain bertahan dengan mengincar hasil minimal imbang dalam pertandingan ini. Hal itu sangat logis untuk dilakukan, mengingat skuad yang dimiliki oleh Levante masih kalah jauh secara kelas dari para pemain Real Madrid. Pada pertandingan pertama kedua tim di musim ini,RealMadridsuksesmengalahkanLevantedalam laga tandang di markas Levante. Saat itu, skuat besutan Jose Mourinho menang dengan skor tipis 2-1. (int)






Edisi 93 „ TTahun ahun VI

SABTU, 6 April 2013

8 WNA Myanmar Tewas Dibantai 18 Orang jadi Tersangka

MEDAN-Suasana hening di Rumah Detensi Imigrasi (Redenim) di Kelurahan Belawan Kecamatan Medan Belawan, berubah dengan suara kegaduhan, Jumat (5/4) sekitar pukul 01.30 WIB. Dinihari itu, terjadi pembantain terhadap 8 warga Myanmar dilakukan puluhan warga etnis Rohingya. Data dihimpun Posmetro Medan (Group Metro Asahan), peristiwa berdarah itu terjadi dipicu dendam lama, di mana sejak dua bulan terakhir pengungsi etnis Rohingya tak

‹ ‹ Baca 8 WNA ...Hal 2


„ Korban tewas warga Myanmar yang terlibat bentrok di Rudinem Medan, saat berada di kamar mayat RSU Pirngadi.

KEPOLISIAN menetapkan 18 orang etnis Rohingya, penghuni Rudenim Medan, sebagai tersangka dalam bentrokan yang menewaskan 8 orang Myanmar. Mereka dituduh melakukan penganiayaan yang menyebabkan hilangnya nyawa orang lain. Kabid Humas Poldasu Kombes Raden Heru Prakoso menyatakan, penetapan 18 tersangka itu dilakukan setelah dilakukan pemeriksaan awal terhadap sejumlah saksi.

‹ ‹ Baca 18 Orang ...Hal 2

2 Jurtul Togel Ditangkap


„ Dua tersangka jurtul togel Indra Syahputra Guci dan Riki Rizki Hasibuan berikut barang bukti yang berhasil diamankan saat berada di Mapolsek Pulo Raja.

Kreta Ditinggal Rp1,4 Juta Lewong KISARAN-Nasib sial dialami Sumedi Syahputra (38), warga Jalan Wira Karya Kelurahan Teladan Kecamatan Kota Kisaran Timur, uang yang ditinggalnya di jok sepedamotor Rp1,4 juta hilang, saat dia buang air kecil di depan kantor Bulog Kisaran, Kamis (4/4) sekitar pukul 23.00 WIB. Informasi dihimpun METRO, malam itu korban mengendarai sepadamotor se-

orang diri, tiba – tiba di tengah perjalanan menujuh rumahnya korban sesak buang air kecil dan berhenti di pinggir jalinsum persis di depan kantor Bulog Kisaran. Setelah selesai buang air kecil, korban kembali menghampiri sepedamotornya untuk melanjutkan perjalanan. Namun, dia sudah mendapati jok sepedamo-

‹ ‹ Baca Kreta ...Hal 2

PULORAJA-Indra Syafutra Guci (39) dan Riki Rizki Hasibuan (28), warga Dusun III Desa Ledong Timur, Kecamatan Aek Ledong ditangkap personil Polsek Pulo Raja saat transaksi angka togel melalui handpone, Sabtu (30/3) lalu pukul 22.00 WIB. Dari tangan kedua tersangka, personil mengamankan barang bukti berupa 5 handpone, 1 lembar kertas rekap, 3 buah pulpen serta uang tunai Rp4,5 juta. Kapolsek Pulo Raja AKP SM Sitanggang saat dikonfirmasi melalui Kanit Reskrim Ipda H Tampubolon, Jumat (5/4) mengatakan, penangkapan terhadap kedua tersangka berawal dari informasi disampaikan masyarakat menyebutkan, di Dusun

ilalahi Duma Riris S

Dihadiahi Lagu Romantis

Kerap menyanyikan lagu-lagu sedih, Judika secara khusus menciptakan lagu romantis untuk sang kekasih, Duma Riris yang akan segera menjadi istrinya. Lagu romantis itu diciptakan Judika sekaligus menyambut pernikahannya yang sudah semakin dekat. “Lagunya galau melulu, nanti malah kebawa sedih. (Makanya) aku minta ciptain lagu romantis untuk pertama kalinya,” ujar Duma Riris saat ditemui bersama Judika, di restoran KFC, di kawasan Gunawarman, Jakarta Selatan. “Ini lagu melewati masa galau, buat mereka

‹ ‹ Baca Dihadiahi ...Hal 2

III Desa Ledong Timur judi Togel dan KIM marak. Berdasarkan informasi itu, pihaknya langsung melakukan penyelidikan dan melakukan penggere-

‹ ‹ Baca 2 Jurtul ...Hal 2


„ Jasad Gito korban kecelakaan lalulintas di Tapian Dolok saat divisum di Ruang Jenazah ,Jumat (5/4)


2 Penumpang


SIMALUNGUN-Peristiwa kecelakan terjadi di Jalan Medan KM 8,5 Kelurahan Sinaksak, Kecamatan Tapian Dolok Kabupaten Simalungun, antara L-300 dengan Karya Agung, dua orang penumpang tewas dalam kejadian itu, Jumat (5/4)

sekitar pukul 03.30 WIB. Informasi dihimpun METRO, sebelum kejadian mobil L 300 BK 1523 GY dikemudikan Johan Hutapea (34) melaju dari arah Medan menuju Siantar.

‹ ‹ Baca 2 Penumpang ...Hal 7

Dendam Ayah Tewas Diguna-guna

Petani Tewas Disembelih Petani PAKPAK BHARAT- Ukuk Tinambunan (40) tewas dibacok dan digorok M Manik (28). Pembunuhan sadis tersebut terjadi Jumat (5/4). Informasi dihimpun dari kepolisian menyebutkan, pembunuhan tersebut terjadi di Desa Pagin-

dar, Kecamatan Pagindar, Kabupaten Pakpak Bharat, tepatnya tak jauh dari ladangnya. Pembunuhan ini diketahui setelah tersangka Manik mendatangi Polmas Polsek Suro Aceh Singkil

‹ ‹ Baca Petani ...Hal 7

Kisah Guru di Desa Terpencil di Tapsel

Jalan Kaki Tembus Hutan, Honor hanya Rp150 Ribu Sebulan Tugasnya sungguh mulia untuk mencerdaskan anak bangsa. Namun perlakuan yang layak belum dirasakan pahlawan tanpa tanda jasa yang bertugas di wilayah terpencil di Kabupaten Tapsel ini. Apalagi imbalan yang diterimanya hanya Rp150 ribu per bulan. Padahal untuk menemui anak didiknya, ia harus berjalan kaki di tengah hutan lebat, mendaki dan menurun di jalan yang terjal. Sungguh penuh dengan resiko. Siapa dan bagaimana kisahnya? AMRAN POHAN-Tapsel


„ Siti Mariani sedang melintasi hutan menjumpai anak didiknya di SDN Turunan.

Ia adalah Siti Mariani Pasaribu (27), guru honor komite di SDN Turunan, Desa Sunge Sigiringgiring, Kecamatan Saipar Dolok Hole (SDH), Kabupaten Tapsel. Pada awak koran ini, ia menceritakan telah menjadi guru honor komite di SDN Turunan sejak 2007 lalu. Ketika itu dirinya masih gadis dan tercatat sebagai warga Kampung Turunan, Kecamatan SDH. “Saya sejak 2007 sudah mengajar di Turunan,” ucap ibu satu anak itu memulai perbincangan singkat bersama awak koran ini ketika melintasi

‹ ‹ Baca Jalan ...Hal 7


6 April 2013

Panitia UN Antisipasi Serangan Fajar JAKARTA- Serangan fajar tidak hanya terjadi di hari pencoblosan pemilu. Panitia ujian nasional (UN) 2013 juga mencium potensi praktik serangan fajar. Bedanya, serangan fajar UN tidak membagikan sembako atau uang, melainkan kunci jawaban kepada peserta ujian. Kepala Badan Standarisasi Nasional Pendidikan (BSNP) M Aman Wirakartakusumah menuturkan, indikasi praktik serangan fajar hampir selalu terjadi setiap kali pelaksanaan UN. “Pelaku utamanya diduga para guru yang direkrut menjadi tim sukses UN,” katanya di Jakarta, kemarin (5/4). Tim sukses ini direkrut secara berjenjang. Mulai dari dinas pendidikan kabupaten/kota hingga di jenjang satuan pendidikan. Guru yang masuk dalam tim sukses inilah yang bertugas mengerjakan lembar jawaban. Kemudian hasilnya disebar ke siswa melalui pesan singkat (SMS). Cara itu dilakukan menyiasati lemahnya pengawasan. Aman mengatakan, potensi

serangan fajar itu cukup besar. Hal itu karena jumlah variasi soal yang hanya lima jenis untuk setiap ruang ujian. “Jadi, kalau naskah itu diambil pukul 05.00 waktu setempat, masih ada jarak waktu yang panjang hingga UN berjalan (pukul 08.00),” katanya. Rata-rata perjalanan mengambil naskah ujian dari rayon ke sekolah adalah 15 menit hingga 30 menit. Nah, tahun ini potensi para guru personel tim sukses untuk mengerjakan soal UN kecil. Sebab, jumlah variasi soal saat ini dipatok 20 jenis per ruang ujian. Selain itu, UN 2013 berlangsung lebih pagi, yakni pukul 07.30 waktu setempat. Kepala Pusat Penilaian Pendidikan (Kapuspendik) Kementerian Pendidikan dan Kebudayaan (Kemendikbud) Hari Setiadi mengatakan, kalaupun guru personel tim sukses mampu menyelesaikan soal, mereka akan kesulitan menandai kunci jawaban itu untuk kode soal nomor berapa. (wan/ca/jpnn)

2 Jurtul Togel Ditangkap Sambungan Halaman 1 bekan di salah satu rumah di Dusun III Desa Ledong Timur, dan berhasil menangkap kedua tersangka sedang beraktivitas merekap an menerima angka tebakan. Terpisah, Khairul salah seorang tokoh pemuda di Kisar-

an menuturkan, bahwa praktik perjudian togel masih terjadi, namun peredarannya sudah tersembunyi. “Judi togel masih ada, namun peredarannya tidak seperti dulu lagi yang semi terang–terangan, saat ini peredaran judi togel serta KIM dilakukan melalui handpone,“ ungkap Khairul. (sus)

Dihadiahi Lagu Romantis Sambungan Halaman 1 yang saling mencintai satu sama lain,” imbuh Judika yang sempat mendapat penolakan dari orangtua Duma. Berbagai persiapan lainnya pun telah dilakukan oleh pasangan ini jelang hari bahagia. Judika pun mengaku makin rajin kejar setoran jelang pernikahannya. Pernikahan mereka kabarkan akan dihelat November 2013 mendatang. “Semakin sering kerja, cari duit untuk biaya. Beli rumah

buat tempat kita nanti. Buat aku dan dia satu hal prioritas bersama ya kerja dulu yang rajin,” ungkapnya. Meski yakin akan menikah pada November ini, Judika masih sedikit harap-harap cemas karena belum menemukan lokasi pernikahan. “Karena kita tanya semua full, gedung masalah utama, full sampai Desember. Kita mau bulan 8-10. Spesial buat kita ya itu. Mudah-mudahan dalam waktu dekat sudah fix,” harapnya. (int)

Kreta Ditinggal Rp1,4 Juta Lewong Sambungan Halaman 1 tornya terbuka, dan uang yang diletakkannya di jok hilang. Malam itu, korban langsung membuat laporan ke Polres Asahan. Kapolres Asahan AKBP Yustan Alpiani dikonfirmasi

melalui Kasubag Humas, Jumat (5/5) membenarkan kejadian itu. “Sekitar 30 menit setelah uangnya dicuri dari dalam jok sepedamotor, korban langsung membuat laporan dan kita sedang melakukan penyelidikan,” kata Berutu. (sus)

METRO ASAHAN Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wakil Pimpinan Perusahaan: Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Maranatha Tobing

Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Darwin Purba Daniel Simanjuntak Vincent Wijaya


„ Keenam korban menandatangani surat penahanan dan penangkapan setibanya dari RSUD Kota Psp di Polres Tapsel, Kamis (4/4) lalu.

13 Tersangka Bentrokan Dipindahkan ke Lapas SIDIMPUAN- Enam korban penembakan saat bentrok antara warga dengan polisi, yang sebelumnya dirawat di RSUD Kota Padangsidimpuan, kini harus mendekam di Lembaga Permasyarakatan (Lapas) Salambue. Selain keenam korban, tujuh warga yang telah ditetapkan sebagai tersangka dan terlebih dahulu masuk tahanan polres, juga turut dipindahkan ke lapas. Mereka masuk Lapas Salambue, Jumat (5/4) sekira pukul 15.00 WIB. Salah seorang tersangka yang belum dipindahkan ke lapas, Akhmad Jazudi Harahap (26), dari balik jeruji besi tahanan Polres Tapsel, menyebutkan, hanya dua orang yang masih tinggal di tahanan polres, yakni ia dan Banua Nasution(50). Kedua warga Aek Buaton ini ditahan sejak Sabtu (23/3) lalu. Sedangkan tujuh rekannya plus enam korban penembakan yang baru dipindahkan dari RSUD Kota Psp, pada Kamis (4/4) lalu, juga sudah dibawa dengan menggunakan mobil tahanan

Polres Tapsel untuk dititipkan ke lapas Salambue. “ Jam tiga tadi (kemarin) mereka dibawa. Mungkin besok (hari ini) aku dan Pak Banua Nasution juga dipindahkan,” ujarnya. Saat METRO hendak bertanya lebih lanjut, seorang polisi yang sedang berjaga langsung menyuruh Jazudi kembali. “Sudah sana masuk kau!” ujarnya ketus kepada Jazudi. Dan, 13 tersangka yang sudah ditahan dan dibawa ke LP Salambue adalah; Murni Siregar (57), Huala Pulungan (18), Rustam Nasution (35), Masdawiyah Daulay (50), Rayan Pulungan (62) kelimanya warga Aek Buaton, dan Amir Pulungan (52) warga Hutabargot. Sementara itu, tujuh tersangka yang telah ditahan sebelumnya; Maradoli Nasution (45), Zulmanan Nasution (30), Pembina Daulay (36), Ridwan Nasution (60), Saunan Harahap (35), Tongku Nasution (22), dan Rakhmad Pulungan (20). Kepala Pengamanan LP

Salambue, Maratoguan Harahap, membenarkan kepada METRO, Jumat (5/4) sekitar pukul 15.30 WIB ada 13 tahanan titipan dari Polres Tapsel. “Iya, ada 13 tahanan titipan yang terdiri dari dua wanita, dua remaja, dan selebihnya pria dewasa. Dan mereka sudah kita tempatkan di sel berbeda,” jelasnya. Ka Bo Reskrim Polres Tapsel Iptu Kusnadi membenarkan telah membawa 13 tahanan tersebut ke Lapas Salambue. Mereka adalah enam korban yang baru saja dibawa dari RSUD Kota Psp dan 7 orang yang telah ditahan sebelumnya. Dia juga menjelaskan tentang Huala Pulungan yang sempat diberitakan diberikan penangguhan penahanan, yang bersangkutan tidak diberikan penangguhan penahanan. Yang bersangkutan tetap ditahan dan dikirim ke Lapas bersama tahanan yang lain. “Informasi semalam salah, kita bawa juga dia (Huala) ke lapas,” kata Kusnadi. Sementara itu, Anggota

Kompolnas Edi Hasibuan, menyayangkan penahanan keseluruhan korban penembakan, apalagi di antaranya ada perempuan. Dan, penahanan mereka dinilainya sangat tidak manusiawi. “Mereka sudah ditembak, tapi mengapa malah ditahan?” tanya Edi. Namun, sambung Edi, pihaknya memaklumi bahwa penahanan para tersangka merupakan kewenangan penyidik. “Kapolres dan Kapolda sebaiknya mempertimbangkan penangguhan penahanan untuk para tersangka yang ditembak,” ujar Edi. “Dalam waktu dekat, kami akan menyampaikan hal ini ke Kapolri. Saat ini, masih dalam tahap mempersiapkan dokumen-dokumen tentang kasus tersebut,” lanjut Edi. Sebelumnya, sekitar 200-an warga dari tiga desa; Aek Buaton, Sidondong, dan Hutabargot bentrok dengan aparat Polsek Barumun Tengah, Palas, Sabtu (23/3) sekira pukul 07.00 WIB. Sembilan warga ditembak, satu di antaranya kritis dan

lima polisi luka-luka. Bentrokan ini dipicu kedatangan 200 warga ke Polsek Barumun Tengah yang meminta polisi membebaskan tiga pemuda Desa Aek Buaton; Banua Nasution (50), Tongku Nasution (24), dan Julmanan (30), yang ditangkap pada Sabtu (23/3) sekira pukul 05.00. Informasi dihimpun METRO, tiga pemuda itu, ditangkap aparat polisi Polsek Barumun Tengah (Barteng) saat berjaga di lahan sengketa antara warga Aek Buaton, Sidondong, dan Hutabargot, dengan salah seorang warga Desa Sayur Matua, Harapan Harahap. Mendengar kabar tiga temannya ditangkap, sekira pukul 07.00 WIB, secara spontan sekitar 200 warga dari tiga desa yang memang berdekatan ini berkumpul di Desa Aek Buaton. Tidak lama kemudian, sebagian besar warga yang menaiki sepedamotor dan sebagian kecil angkutan umum ini, bersama-sama menuju Polsek Barteng, yang berjarak sekitar 10 kilometer dari Aek Buaton. (mag-01)

8 WNA Myanmar Tewas Dibantai Sambungan Halaman 1 terima dengan prilaku 8 orang warga Myanmar yang kerap menganggu, bahkan melakukan pelecehan seksual terhadap keluarga mereka. Persoalan yang sudah berulang kali, dilakukan warga Myanmar yang sama-sama ditahan di Rudemin. Dalam beberapa hari, warga etnis Rohingya telah menyimpan rasa dendam dan saling mempengaruhi satu sama lain dengan menunjukkan tragedi pembantaian keluarga mereka yang tewas menge-

naskan di Myanmar. Dari itu, mereka menyusun rencana untuk melakukan pembantaian secara massal. Tengah malam itu, para pengungsi Rohingya yang umumnya berada di lantai satu, menuju lantai dua membantai 8 warga Myanmar. Dengan luapan dendam dicampur emosi, puluhan etnis Rohingya membawa kursi terbuat dari kayu menuju ke lantai dua, membuat sejumlah penghuni Rudenim lainnya terkejut. Amukan etnis Rohingya mematikan lampu langsung membantai para korban sedang tidur di lantai. Suara keributan pembantaian, dengan jeritan histeris yang dihajar dengan benda tumpul yang ada di lantai dua. Pembantaian sadis, juga menjadi tontonan para penghuni asing dari negara lain yang hanya mampu diam menyaksikan Kejadian itu. Pegawai yang mendengar suara keributan, langsung menuju kamar dan mencoba masuk untuk melakukan pengamanan, namun, karena pintu kamar dikunci dari dalam, para petugas kesulitan masuk. “Waktu kejadian itu saya mendengar suara ribut, suara teriakan tapi tak ada minta tolong. Saya menduga ada yang mau kabur. Tapi pintu dikunci dari dalam, dan saya diancam jangan masuk karena ada yang mau kabur. Kalau saya masuk nanti dibunuh mereka. Ternyata, tak lama berselang saya dengar ada

Departemen Redaksi METRO ASAHAN Dewan Redaksi Group : Marganas Nainggolan (Ketua), Maranatha Tobing, Pandapotan MT Siallagan, Muhiddin Hasibuan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Nasa Putramaylanda, Hermanto Sipayung, Nurjannah. Redaktur Pelaksana: Hermanto Sipayung, Redaktur: Syafrudin Yusuf, Pholmer Saragih, Jhon Damanik, Plidewatna, Hezbi Rangkuty, Edi Saragih Kordinator Liputan: Edwin Garingging, Reporter:, Irvan Nasution (Kisaran), Susilowady (Kisaran), Jekson Siahaan (Batubara), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke) METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba Kordinator Liputan: Pala MD Silaban, Reporter: Tonggo Sibarani, Imelda Purba, Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Raymound Sitanggang, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat) Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi : Ita Butar-butar METRO TAPANULI Pjs Redaktur Pelaksana: Nasa Putra Maylanda, Kordinator Liputan: -, Ass.Korlip : Horden Silalahi (Taput) Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Hermanto Turnip (Tobasa)

keributan ada yang mati. Saya langsung melapor ke polres,” pegawai Rudenim Riko Thomas. Setelah pembantai berlangsung, suasana mencekam menyelimuti lokasi. Para penghuni lainnya berdiam diri di kamar pasca tragedi berdarah itu. Petugas Polres Pelabuhan Belawan yang menerima informasi, langsung turun ke lokasi kejadian dan melakukan evakuasi terhadap jenazah para korban ke RS Pirngadi Medan. Para korban agama Budha Myanmar di antaranya, Aye Min (23), Myo Co(20), Aung Thu Win (24), Aung Than (44), Min-Min (24), Win Tun (32), Nawe (23) dan Sam Lwin (45). Kabid Humas Poldasu Kombes Pol R.Heru Prakoso didampingi Kepala Imigrasi Belawan Sunardi SH dan Kapolres Pelabuhan Belawan AKBP Endro Kiswanto SH saat pemaparan di aula Mako Polres Pelabuhan Belawan, menerangkan motif sementara kejadian berdarah itu, berawal dari pelecehan seksual yang dilakukan warga negara Myanmar terhadap pengungsi Rohingya dari 164 seluruhnya, sebanyak 15 orang adalah wanita dengan ruang bilik terpisah. Sedangkan kejadian, berada di lantai dua ada sekitar 90 pengungsi Rohingnya yang menempati di bilik itu. “Tak benar motif bentrok karena SARA atau agama, melainkan motifnya karena pelecehan yang

sebelumnya telah dicoba diselesaikan pihak Imigrasi namun kemungkinan belum tuntas menyebabkan persoalan berlanjut,” tegasnya. Disebutkan Kombes Heru, Pada Kamis (4/4) sekitar pukul 10.00 WIB, tiga perempuan dari etnis Rohingya yang ada di Rudenim melapor kepada Ustad Ali. Ali merupakan sosok yang dituakan oleh 153 orang pengungsi etnis Rohingya yang ada di Rudenim. Ketiga wanita itu mengaku mengalami pelecehan seksual secara fisik dari kelompok Myanmar lainnya, kelompok Anak Buah Kapal (ABK) Myanmar yang tertangkap karena melakukan penangkapan ikan ilegal di Indonesia. Mereka sama-sama ditempatkan di Rudenim. Atas laporan ini, Ali kemudian menyampaikan persoalan kepada pihak petugas imigrasi yang ada di Rudenim. Pertemuan pun digagas pada Kamis malam sekitar pukul 22.00 WIB. Pada saat itu kedua belah pihak sepakat damai.”Pada saat itu clear, selesai,” tukas Heru. Usai pertemuan itu, kelompok Rohingya melakukan diskusi. Mereka terkesan tidak puas dengan kesepakatan yang diambil dalam pertemuan yang difasilitasi Rudenim. Ketika sedang berdiskusi itu, ada kelompok ABK yang menyeletuk, memancing suasana. Tak lama kemudian, si ABK yang nyeletuk tadi masuk ke dalam dan kemudian keluar

METRO TABAGSEL Redaktur Pelaksana: Nurjannah, Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Parningotan Aritonang. Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo SH Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Mounting: Samuel Sihotang (Koordinator), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi, Maintenance & IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan : Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan: Tio Maria, Annisa (Medan) Staf Desain:Reliston Purba, Togap Sinaga. Perwakilan Metro Tapanuli

lagi membawa senjata tajam. Dia lalu menusuk Ali. Pergumulan terjadi, senjata itu dapat direbut Ali dan tindakan tersebut dibalas. ”Di situlah spontan pengungsi Rohingya yang berada di lantai dua melakukan pengeroyokan terhadap delapan ABK WN Myanmar. Sehingga seluruhnya meninggal di Tempat Kejadian Perkara,” kata Heru. Para korban menderita luka memar dan luka akibat tusukan benda tajam, yang diduga berasal dari pecahan meubeler berupa meja dan kursi yang ada di barak. (ril/ pmg/int)

18 Orang jadi Tersangka Sambungan Halaman 1 “Semula yang diamankan 21 orang, setelah diperiksa, kita tetapkan 18 orang yang jadi tersangka. Tiga yang lainnya, akan kita pulangkan,” kata Heru. Disebutkan Heru Prakoso, para tersangka dikenakan dua pasal dalam Kitab Undang Undang Hukum Pidana (KUHP). Masing-masing pasal 170 dan pasal 351, yakni secara bersama-sama melakukan tindak kekerasan secara bersama-sama sehingga mengakibatkan orang meninggal dunia. “Proses hukumnya nanti akan ditangani Polres Pelabuhan Belawan,” sebutnya. (int)

Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koord. Pengembangan: Zulfiandi, Staf Pengembangan : Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH TARIF IKLAN : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733




TOLAK RUU ORMAS : Hizbut Tahrir Indonesia, melakukan unjuk rasa di depan gedung DPR RI, Jumat (5/4) di Jakarta. Dalam aksinya mereka menolak Rancangan UndangUndang (RUU) Organisasi Masyarakat, yang dianggap jauh dari semangat reformasi.

Baku Tembak Tewaskan 13 Tentara Myanmar MYANMAR-Baku tembak dengan kelompok bersenjata tak dikenal di dekat perbatasan Thailand menewaskan 13 tentara Myanmar. Juru Bicara Angkatan Darat (AD) Thailand Kolonel Sansern Kaewkamnerd pada Jumat (5/4) mengatakan otoritas Myanmar sudah mengontak otoritas Thailand berkenaan dengan hal itu. Sementara, menurut warta AP, insiden kekerasan itu terjadi di wilayah Myanmar sekitar 6 kilometer dari perbatasan Thailand. Wilayah perbatasan Thailand yang terletak paling dekat dengan lokasi kejadian adalah Provinsi Ranong. Sementara itu, pihak Thailand sudah menggelar investigasi menyangkut masalah itu. Thailand berupaya untuk mencari tahu apakah kelompok bersenjata itu adalah warga Thailand yang masuk secara ilegal ke Myanmar. Catatan dari laman Bangkok Post menunjukkan baku tembak pernah terjadi pada Agustus setahun silam. Kala itu, kelompok bersenjata saling tembak dengan tentara Myanmar yang tengah berpatroli di perbatasan. Dalam kesempatan itu, 92 warga Thailand ditangkap lantaran tuduhan memasuki Myanmar secara tidak sah. (kcm/int)

Dua Lagi Pasien H7N9 Terkonfirmasi CINA- Sampai dengan Jumat (5/4), ada tambahan dua pasien penderita flu burung H7N9 di China yang terkonfirmasi. Menurut Xinhua, tambahan tersebut membuat total penderita menjadi 16 orang di seantero China. Kedua pasien terbaru itu berasal dari Provinsi Jiangsu di Timur China. Satu pasien bermarga Yin berjenis kelamin perempuan. Pasien berusia 61 tahun itu dilarikan ke rumah sakit lantaran kondisinya memburuk pada Selasa (2/4). Pasien berikutnya adalah seorang pria berusia 79 tahun. Pasien itu bermarga Lu. Ia dirawat di rumah sakit sejak Kamis (21/3). Pihak otoritas kesehatan setempat mengatakan ada 65 orang yang berkontak langsung dengan kedua pasien tersebut. Namun, tak ada tanda-tanda mereka tertular. Otoritas China memerinci 16 pasien H7N9 yakni 6 di Shanghai, 6 di Jiangsu, 3 di Zhejiang, dan 1 di Anhui. Sejauh ini, H7N9 sudah menewaskan enam orang di Shanghai dan Zhejiang. (kcm/int)

Asas Tunggal Pancasila Dicabut RUU ORMAS AKAN DISAHKAN 12 APRIL

JAKARTA - Asas tunggal Pancasila yang ditolak oleh Fraksi PKS DPR telah dicabut. RUU Ormas dijadwalkan disahkan 12 April 2013 mendatang. “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985

tentang Ormas memang asas yang sama dengan UU Parpol,” kata Ketua Pansus Revisi UU Ormas,


„ Komite Etik KPK saat menyampaikan keputusan penyelidikan terkait bocornya sprindik Anas Urbaningrum.

Polri Belum Temukan Unsur Pidana Kasus Sprindik Anas JAKARTA-Penyidik Badan Reserse Kriminal Polri belum menemukan dugaan pelanggaran pidana dari kasus bocornya draf surat perintah penyidikan (sprindik) atas nama Anas Urbaningrum. Untuk itu, kepolisian belum dapat mengusut kasus yang sempat dilaporkan mantan Ketua DPC Cilacap Partai Demokrat Tri Dianto. “Jadi kita belum melihat apakah ini berkaitan dengan adanya pelanggaran hukum pidana yang menjadi ranah dari kepolisian,” kata Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal

(Pol) Boy Rafli Amar di Mabes Polri, Jakarta Selatan, Jumat (5/4). Sebelumnya, Tri Dianto berulang kali mendatangi Gedung Bareskrim Polri untuk melaporkan kasus tersebut, baik sebelum maupun sesudah Komite Etik KPK mengumumkan hasil penyelidikan. Menurut Tri, Komite Etik belum mengungkap dalang pembocor draf sprindik yang beredar sebelum Anas resmi ditetapkan menjadi tersangka oleh KPK. Tri meminta kasus itu ditangani oleh kepolisian. Komite Etik KPK sebelumnya juga memutuskan bahwa pelaku utama pembocoran dokumen sprindik KADAR GULA DARAH TURUN, BADAN TERASA LEBIH SEGAR Anas adalah SekreIndonesia Selain itu, indeks glisemik pengaturan gula normal. taris Ketua KPK kaya akan dalam Gentong Mas yang sangat Tapi sekarang, kakek 5 orang Abraham Samad, sumber daya aman bagi kesehatan yaitu hanya cucu dapat bernafas dengan lega Wiwin Suwandi. hayati dan 35 (aman jika indeks glisemik karena telah menemukan solusi Wiwin yang tinggal merupakan dibawah 50), mampu menjaga dan yang tepat untuk mengatasi satu rumah dengan salah satu merawat pankreas agar tetap keluhannya, "Setelah minum Abraham itu n e g a r a berfungsi dengan baik. Gentong Mas secara teratur menghubungi memegabiodiversity Meski demikian, untuk selama 2 bulan, kadar gula darah terbesar di mendapatkan hasil maksimal, saya sekarang sudah turun, badan dia untuk memdunia. Selain disarankan untuk mengatur pola pun terasa lebih segar." Ungkap berikan fotokopi

itu, Indonesia juga dikenal sebagai gudangnya tumbuhan obat (herbal) sehingga mendapat julukan live laboratory. Salah salah hasil alam Indonesia yang terbukti bermanfaat bagi kesehatan adalah Gula Aren. Kini, hadir Gentong Mas yang salah satu bahan dasarnya adalah Gula Aren. Saat ini, telah banyak orang yang telah membuktikan manfaatnya, salah satunya adalah Suwarno (60 thn), "Mungkin karena pola makan dan faktor usia, sudah 6 bulan saya menderita penyakit berbahaya ini. Kadar gula darah saya mencapai 600 mg/ dL." Ujar pria yang berprofesi sebagai Wiraswasta tersebut. Ia menambahkan, ketika kadar gula darahnya tinggi, badannya sering terasa lemas, dan kepalanya sering pusing. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme

Abdul Malik Haramain, saat berbincang, Jumat (5/4). Malik menuturkan, UU Parpol mengatur asas dasar Pancasila dan UUD 1945 dan diperbolehkan memasukkan asas lain yang tidak bertentangan dengan Pancasila

ayah 4 orang anak itu. Setelah merasakan manfaat mengkonsumsi Gentong Mas, ia pun merasa terpanggil untuk membagi pengalamannya itu dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain." Harap warga Bandar Klippa, Kec. Percut Sei Tuan, Deli Serdang, Medan tersebut. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas.

makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787 Dolok Sanggul : 082129284752 T. Tinggi/Siantar : 081322099495 Binjai/pakam : 081398666166 Langkat/karo : 082167538828 Kisaran : 06237014362 Tanjung Balai : 081263495563 Labura : 081370590972 Labuhan batu : 082365222011 Sibolga :081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114

draf sprindik Anas. Hal ini merupakan keputusan Komite Etik dalam jumpa pers di Gedung KPK, Rabu (3/4). Wiwin akhirnya dipecat sebagai sekretaris Abraham. Adapun Abraham dianggap lalai dalam mengawasi sekretarisnya sehingga terjadi pembocoran dokumen sprindik tersebut. Menurut Komite Etik, Abraham tidak terlibat secara langsung dalam proses pembocoran sprindik. Atas pelanggaran ini, Komite Etik menjatuhkan sanksi berupa peringatan tertulis kepada Abraham. Komite Etik juga meminta Abraham memperbaiki sikap dan perilakunya serta memegang teguh kode etik pimpinan KPK. Komite Etik dipimpin Anis Baswedan dan beranggotakan Wakil Ketua KPK Bambang Widjojanto, penasihat KPK Abdullah Hehamahua, mantan pimpinan KPK Tumpak Hatongaran Panggabean, serta mantan hakim Mahkamah Konstitusi Abdul Mukti Fadjar. (kcm/int)

dan UUD 1945. Jadi tidak ada lagi klausul asas tunggal Pancasila. “Kalau semua bisa segera disepakati kita jadwalkan minggu depan tanggal 12 April masuk Paripurna DPR,” tegasnya. Asas ormas diatur di Bab II tentang asas, ciri, dan sifat ormas. Aturan tersebut diatur di pasal 2 RUU Ormas. “Asas ormas adalah Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 serta dapat mencantumkan asas lainnya yang tidak bertentangan dengan Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945,” demikian bunyi pasal 2 RUU Ormas. Fraksi PAN Minta Tunda Pengesahan Badan Musyawarah (Bamus) DPR telah mengagendakan pengesahan revisi UU Ormas pada Sidang Paripurna DPR 12 April mendatang. Menyambut penolakan berbagai LSM dan Ormas, Fraksi Partai Amanat Nasionalo (F-PAN) dengan tegas meminta agar pengesahan RUU Ormas ditunda. “Kami secara resmi sudah mengirimkan surat ke pimpinan

DPR agar pengesahan RUU Ormas ditunda,” kata Ketua FPAN, Tjatur Sapto Edy, kepada wartawan di gedung DPR, sesaat lalu (Jumat, 5/4). Menurut dia, pembahasan RUU tersebut telah menyita perhatian publik yang cukup besar. Terjadi penolakan dari ormas dan komponen masyarakat sipil. DPR, kata Tjatur, perlu menyerap aspirasi masyarakat yang berkembang dalam merespons RUU Ormas tersebut. Selain itu, fraksi PAN memahami respons masyarakat dan meminta pimpinan DPR untuk menerima aspirasi masyarakat yang berkembang dan menjadikan itu sebagai bahan masukan yang penting terkait pembahasan RUU Ormas. Selain meminta ditundanya pengesahan RUU Ormas, F-PAN meminta agar di waktu mendatang dilakukan uji publik serta forum sosialisasi yang lebih intensif kepada seluruh pemangku kepentingan agar produk hukum yang dilahirkan DPR, terutama yang menyangkut hidup orang banyak, dapat disepakati dan dipahami bersama. (kcm/rml/int)

Warga NTT di Jogya Lega Penyerang LP Cebongan Terungkap YOGYAKARTA-Empat tahanan yang tewas ditembak oleh oknum Kopassus di LP Cebongan adalah warga NTT. Warga NTT sempat resah pasca kejadian itu. Tapi setelah kasus itu terungkap, mereka lega. Salah satu sesepuh warga NTT di Yogyakarta, Jhon S Keban, mengatakan, warga mengapresiasi kerja baik Polri maupun Tim Investigasi TNI AD. Mereka kini menunggu proses hukum yang adil dan akuntabel. “Kami hormat pada prajurit yang sudah mengakui perbuatannya dan siap untuk bertanggung jawab. Kami menyerahkan proses hukum sepenuhnya,” kata Jhon saat dihubungi, Jumat (5/4). Warga NTT di Yogyakarta percaya pada temuan Tim Investigasi TNI AD. Langkah cepat dalam mengungkap pelaku ini

diyakini akan diikuti oleh proses hukum yang adil dan transparan. Warga NTT di Yogyakarta yang sebelumnya takut karena banyak beredar isu-isu sweeping, kini lega. Namun sebagian warga yang mayoritas mahasiswa itu, saat ini belum kembali ke Yogya pasca peristiwa penyerangan LP Cebongan. “Masih ada 10-15 persen belum kembali ke Yogya dari total mahasiswa NTT di Yogya sekitar 13 ribu. Tapi pertengahan bulan ini, setelah mengetahui kabar pelaku terungkap, dipastikan akan kembali semuanya,” katanya. Dari kasus tersebut, warga NTT di Yogya sepakat untuk menjadi pelajaran bersama. Mereka juga sepakat untuk menghargai pluralisme di Yogya dan menjadi bagian dari keistimewaan Yogyakarta. (kcm/int)


OBAT PATEN NO. 1 • Cukup diminum 10 menit sebelum hubungan intim • Terbukti ampuh mengatasi Ejakulasi dini dan lemah syahwat • Kuatkan, kencangkan, keraskan ereksi dan tahan lama • Rasakan nikmatnya klimaks berulangSpontan menguatkan kejantanan ulang • Nikmati kepuasan puncak dalam pria, berdiri tegar dan tahan lama semalam suntuk. Antar hubungan intim atis



Dp. 40 Jtan Angs 3Jtan


• Pelangsing Herbal • Peninggi Badan • Penggemuk Badan • Pemutih Wajah/badan

• Pemutih Ketiak/selangkangan • Pemerah Bibir • Perontok Bulu • Penghilang Selulit

• Penghilang Jerawat • Penghilang Bekas Luka • Krim+vakum Payudara • Perapat Vagina,dll

A-SEN HP 0821 1811 1020 PIN BB: 28A13AEB |


Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung No. 63 depan Simp. Jl. Perdamean Rantauprapat


6 April 2013

Apa Kata Mereka

Sikap Kami Wakil Ketua DPR RI Priyo Budi Santoso Panja akan melaporkan RUU Ormas untuk disahkan pada paripurna. Tapi kalau masih ada yang krusial yang menjadi perdebatan, saya kira Panja harus lapang dada untuk mendengarkan dari semua elemen. Kalau itu tidak dimungkinkan, saya anjurkan kita tunda sampai persidangan berikut,”

Anggota Komisi I DPR Tjahjo Kumolo “Pada awalnya pendapat saya membela korps elite Kopassus, sangat tidaklah mungkin, sebagai pasukan elite TNI yang tugas utamanya membela bangsa negara. Ternyata, ada oknum Kopassus yang belum mampu menahan emosi,”

Kasus Cebongan, Pintu Masuk Revisi Peradilan Militer

Mendengar Koreksi RUU Ormas POLEMIK mengenai rancangan undang-undang organisasi kemasyarakatan (RUU ormas) terus menggelinding. Hal itu tampak dari pernyataan sikap sejumlah ormas dalam keputusan resmi organisasi, diskusi publik, dan demonstrasi. Desakan agar pasalpasal kontroversial segera direvisi begitu kuat. Bila tidak, begitu disahkan jadi UU ormas, ormas-ormas itu telah berancang- ancang mengajukan judicial review ke Mahkamah Konstitusi (MK). Pemerintah dan legislatif selayaknya mendengar suara kritis in Oleh : Biyanto

Ketua Badan Standar Nasional Pendidikan (BSNP) Muhammad Aman Wirakartakusumah “Sekarang setiap kursi akan mendapat setting soal berbeda, sehingga di satu ruang ada 20 setting (soal),”

Ketua Pansus Revisi UU Ormas Abdul Malik Haramain “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985 tentang Ormas memang asas yang sama dengan UU Parpol,”


uhammadiyah ter masuk yang telah bersikap tegas me nolak RUU ormas. Sikap itu diambil karena menurut hasil telaah Muhammadiyah, RUU ormas yang dibahas di DPR dapat membatasi kebebasan berserikat dan berkumpul serta berpotensi menimbulkan kegaduhan dan instabilitas politik (Jawa Pos, 29 Maret). Dalam pertemuan di Kantor Pimpinan Pusat Muhammadiyah, setidaknya ada 96 ormas lain yang juga menolak. Sementara, PB NU mengusulkan pembahasan RUU ditunda terlebih dulu hingga ada titik temu, terutama terkait pasal-pasal yang masih diperdebatkan. Sikap beberapa ormas tersebut dapat dipahami karena mereka ingin memastikan bahwa RUU ormas tidak menjadi pemasung. Apalagi, ormas sekelas Muhammadiyah dan NU yang telah banyak berkiprah dan, berusia jauh lebih tua dari negeri ini. Ormas ingin RUU itu menjamin kebebasan berserikat, sementara pemerintah berkepentingan mengendalikan ormas. Dalam perspektif pemerintah,

UU No 8/1985 tentang Ormas dianggap tidak lagi mampu mengikuti perkembangan. Itu karena perkembangan ormas, terutama pada masa reformasi, terasa sangat dinamis dan meriah. Alasan lain yang dimajukan pemerintah adalah keberadaan ormas anarkistis yang sering mengganggu masyarakat dan merongrong kewibawaan pemerintah. Dalam aksinya ormas anarkistis telah memanfaatkan simbol-simbol agama atau simbol negara. Padahal, Jalaluddin al-Suyuthi, ulama besar dan mujadid Islam, menyatakan bahwa tidak semua orang dapat melaksanakan tugas tersebut. Menurut al-Suyuthi, hanya ulama dan penguasa yang dapat bertugas amar ma’ruf nahi munkar. Ulama mengembang tugas itu karena memiliki ilmu, sedangkan penguasa memiliki kekuasaan. RUU ormas juga dirancang untuk mengatur keberadaan lembaga swadaya masyarakat (LSM), baik yang didirikan WNI maupun warga asing. Dalam penilaian pemerintah, keberadaan LSM harus diatur agar kiprahnya dapat diselaraskan dengan tujuan pemban-

gunan nasional. LSM yang dikelola orang asing pun harus menunjukkan komitmen untuk kepentingan nasional dan turut menjaga keutuhan NKRI. Regulasi ini dinilai penting, karena diduga kuat banyak LSM yang bekerja tidak untuk kepentingan nasional, melainkan untuk funding agency asing. Jika dicermati secara mendalam dari RUU ormas, paling tidak ada tiga poin yang penting diperhatikan. Pertama, RUU ormas berpotensi menggeneralisasi semua lembaga sosial kemasyarakatan. Itu berarti posisi ormas yang telah berkontribusi luar biasa bagi perjuangan kemerdekaan dan berpartisipasi dalam pembangunan nasional, seperti Muhammadiyah dan NU, tak berbeda dengan LSM baru. Berkaitan dengan persoalan ini, RUU ormas harus membedakan secara tegas peraturan untuk ormas dan LSM, apalagi ormas asing. Poin ini penting diperhatikan karena Muhammadiyah dan NU dengan ribuan amal usaha di bidang pendidikan, kesehatan, ekonomi, dan pelayanan sosial lainnya memiliki jaringan yang luas mulai pusat, provinsi, kabupaten/kota, kecamatan, dan kelurahan/desa. Itu berbeda dengan LSM yang hanya menekankan pekerjaan di satu bidang dan bersifat elitis. Karena itu, penyamaan ormas dan LSM jelas sebuah kesalahan yang mendasar. Kedua, RUU ormas membuka peluang munculnya otoritarianisme baru. Apalagi, dalam RUU itu ada ketentuan bahwa Direktorat Jenderal Kesatuan Bangsa

dan Politik (Ditjen Kesbangpol) dapat mencabut izin ormas. Jika itu yang terjadi, akan muncul budaya represif atas nama undangundang. Padahal, kebebasan berserikat dan berkumpul jelas diatur dalam konstitusi. Apalagi, konteks pembuatan UU No 8/1985 dan RUU Ormas jauh berbeda. UU No 8/1985 dibuat suasana rezim otoritarian Orde Baru. Sementara RUU ormas kini disusun dalam suasana demokratis. Karena itu, RUU ormas seharusnya menjamin ormas untuk menampilkan kekhasan asal tidak bertabrakan dengan nilainilai Pancasila dan kepentingan nasional NKRI. Ketiga, RUU ormas mewajiban pencantuman Pancasila sebagai asas bagi setiap ormas. Eloknya, RUU ormas memberikan kelonggaran bagi ormas yang ingin menggunakan asas lain, dengan syarat tidak bertentangan dengan Pancasila. Jika itu yang dilakukan, ormas berbasis agama tidak harus mengganti asasnya dengan Pancasila. Jangan korek lagi trauma sosial dan politik asas tunggal eraOrdebaruyangjustrumenyempitkan keterbukaan ideologi Pancasila. Tak perlu ada tafsir tunggal atas Pancasila dengan mena-fikan indahnya pelangi keragaman yang membentuk Indonesia tercinta. Jika beberapa hal yang berpotensi memicu pertentangan itu kembali didialogkan, rasanya masing pihak, yakni pemerintah, legislatif, dan ormas yang menjadi sasaran RUU, pasti menemukan jalan keluar. Aamin. (*) Penulis adalah Dosen IAIN Sunan Ampel

TERUNGKAPNYA penyerangan yang menewaskan empat tahanan di Lembaga Pemasyarakatan (Lapas) IIB Cebongan, Sleman, Yogyakarta, 23 Maret 2013 lalu, oleh 11 oknum Grup 2 Kopassus Kandang Menjangan, Kartasura, Solo, Jawa Tengah, membuka celah bagi DPR untuk merevisi Undang-Undang Nomor 31 Tahun 1997 tentang Peradilan Militer. Upaya ini sebagai bentuk reformasi di sektor keamanan. Sehingga kejadian demi kejadian yang melibatkan anggota TNI terhadap sipil sebagai korbannya, tidak terus terjadi. TNI mencatat, selama 2012, kasus demi kasus kriminal yang dilakukan oleh anggotanya cukup mencolok. Penganiayaan yang melibatkan prajurit TNI mencapai 355 kasus, terlibat narkoba sebanyak 161 kasus, serta penyalahgunaan senjata api sebanyak 49 kasus. TNI juga mencatat sebanyak 3.634 prajurit terlibat pelanggaran hukum dan sedang diproses. Dari jumlah tersebut, TNI telah menyelesaikan perkara sebanyak 3.298 kasus. Narapidana dan tahanan militer, sisa tahanan tahun 2012 sebanyak 414 orang. Tahanan masuk 1.812 orang, tahanan bebas 1.795 orang. Jumlah tersebut tentu bukan angka kecil, dan akan terus bertambah setiap tahunnya bila penegakan hukum dikalangan militer tidak segera ditertibkan. Karena itu, perlunya DPR merevisi RUU Peradilan Militer, apakah perlu prajurit TNI yang terbukti melakukan tindak kejahatan dapat disidangkan di pengadilan umum. Dengan begitu, masyarakat perlu tahu, dan bagi mereka keterbukaan, transparansi dan juga keseriusan dari aparatur negara, khusus militer tidak lagi jadi barang yang tabu. Selama ini, tindakan para tersangka masuk kategori pidana umum, mereka akan ditangani oleh pengadilan militer. UU Peradilan Militer memang secara tegas menyebutkan, setiap anggota TNI yang melakukan tindak pidana, termasuk pidana umum, diadili di pengadilan militer. Apabila para tersangka tersebut dibawa ke pengadilan militer, dikhawatirkan proses di pengadilan militer tersebut tidak bisa berlangsung secara transparan, terbuka, dan akuntabel. Para pelaku tidak mendapat hukuman yang setimpal. Sehingga, akan muncul impunitasimpunitas baru yang kemudian jadi pijakan bagi mereka untuk membuka kemungkinan terjadinya hal yang sama di masa mendatang. Padahal, seharusnya adalah dapat memberikan efek jera terhadap pelakunya. Dalam kasus Cebongan ini, diharapkan proses hukum ini tuntas dalam waktu singkat dan juga transparan. Terlebih, korban dari aksi brutal pasukan baret merah ini menyangkut korban sipil. Bila sudah demikian, akan semakin jelas bahwa reformasi TNI yang sudah berjalan maju, betul-betul berjalan, tidak jalan ditempat atau tidak tuntas sama sekali, seperti yang sering di gaung-gaungkan oleh para petinggi TNI pascareformasi. Lalu, akankan kasus Cebongan ini, dengan 11 tersangka oknum anggota Kopassus dapat diadili dan disidangkan secara terbuka dan transparan, pelaku yang bersalah harus dilakukan pemecatan atau hanya sekedar hukum disiplin saja? Kita tunggu saja. (*)



6 April 2013



4 TSK & 5 Kreta Diamankan SIMALUNGUN– Polisi berhasil membongkar sindikat pencurian sepedamotor (curanmor) di wilayah Simalungun. Sebanyak empat tersangka dan lima kreta diamankan. Keempat tersangka yakni Yusuf Sinaga (41), warga Jalan Baja Purba, Kecamatan Siantar, Sandu Syaputra Lubis (22), warga Jalan Naga Huta, Nagori Bosar, Kecamatan Panomban Pane. Kemudian Isban (19), warga Kecamatan Sei Suka, Kabupaten Batu Bara, selaku penadah dan yang terakhir Rijal Lubis (26), warga Jalan Diponegoro, Pematangsiantar. “Tiga pelaku ini diringkus pada Pebruari dan Maret lalu. Kecuali Rijal Lubis, ditangkap tiga hari lalu dari rumahnya,” ungkap Kasat Reskrim AKP Roni Sidabutar, kepada METRO, Jumat (5/4). Roni mengatakan, butuh waktu relatif lama untuk membongkar sindikat para pelaku. Dia mencontohkan kasus pencurian sepedamotor yang dialami Sahala Lingga (41), warga Kecamatan Raya. Sahala kehilangan sepedamotor Yamaha Scorpio dari halaman rumahnya pada 16 Oktober 2012. Setelah dilakukan penyelidikan terus menerus, akhirnya pelaku Yusuf Sinaga berhasil ditangkap pada Maret. Dari tangan tersangka, polisi berhasil mengamankan sepedamotor korban. Demikian halnya dialami Septi Suryando (22), warga Nagori Bosar, Kecamatan Pane, pada 25 Okotober 2012, kemarin, sepedamotor Yamaha Xeon miliknya juga diembat maling. Dari hasil penyelidikan kepolisian akhirnya pelakunya berhasil

diringkus pada Rabu (3/4), yakni Rijal Lubis (26), warga Jalan Diponegoro. Kemudian aksi pencurian sepedamotor kembali terulang pada 25 Maret kemarin, yakni yang dialami korban Romy Siregar (24), warga Tanah Jawa. Ketika itu sepedamotor Yamaha Vixion, miliknya diparkirkan di Huta Timuran, Nagori Mariah Jambi, Kecamatan Jawa Maraja Bah Jambi, dicuri maling. Setelah dilaporkan kepada petugas kepolisian, Polres Simalungun kembali membentuk tim hingga akhirnya menciduk Sandy Syaputra Lubis (22), warga Panombean Pane pada akhir Maret kemarin. Setelah dilakukan pemeriksaan, Sandy mengakui menjual sepedamotor tersebut kepada salahseorang rekannya bernama Isban (19) di Kabupaten Batubara. Ketika itu, petugas pun kemudian menjemput Isban, serta barang buktinya ke Kabupaten Batubara. Roni menyebutkan, untuk Isban dikenakan pasal 480 KUHPidana yang berperan sebagai penadah. Sementara ketiga tersangka lainnya dijerat pasal 363 KUHPidana tentang pencurian. “Dari hasil pemeriksaan, dalam melakukan aksinya pelaku menggunakan kunci palsu. Kunci itu untuk menghidupkan sepedamotor targetnya. Saat ini, kita masih melakukan pemeriksaan untuk dilakukan pengembangan,” ujar Roni. (pra/ dro)

Operasi Palm

3 Pencuri Diamankan SIMALUNGUN– Dalam rangka pelaksanaan operasi Palm Toba 2013 yang dilaksanakan sejak 1 April Polres Simalungun, telah menangani 3 kasus dengan tiga pelaku atas kasus pencurian terhadap buah sawit milik PTPN III dan IV. Ketiga pelaku serta barang bukti saat ini diamankan di Polres Simalungun. “Operasi Palm ini adalah operasi khusus tindak pidana pencurian tanaman kelapa sawit serta CPO. dan hasilnya telah ditangkap 3 pelaku dengan aksi pencurian dilokasi berbeda,” terang Kasat Reskrim AKP Roni Sidabutar, Jumat (5/4). Pelaku pertama ialah Boy Sumandar (19), warga Tanah Jawa melakukan aksi pencurian di PTPN III Bah Jambi. Pelaku melakukan pencurian dengan menggunakan sepeda motornya

dan mengambil 10 Buah Sawit. Sedangkan Irpan (46), warga Nagori Sei Merbau, Kecamatan Ujung Padang turut juga tidak lepas jangkauan petugas saat melakukan aksinya di PTPN IV Tinjowan Senin (1/4). Pelaku mengambil 8 buah sawit dan membawanya dengan sebuah beko. Sedangkan Rikki Manullang (23) warga Kecamatan Bandar juga melakukan aksi pencurian di kebun hingga akhirnya diringkus petugas. Ketiga pelaku ini saat ini masih dalam pemeriksaan petugas kepolisian untuk dilakukan pengembangan. “yang pasti pihak kepolisian untuk tetap melakukan penindakan terhadap aksi pencurian di kebun pemerintah termasuk kebun rakyat,” ujar AKP Roni Sidabutar. (pra)


DIAMANKAN- 4 tersangka pencurian sepedamotor berikut dengan 5 unit kreta curian diamankan di Mapolres Simalungun, Jumat (5/4).

SISWA SMK CURI HP TNI SIANTAR- Siswa SMK berinisial BG(19), salahsatu sekolah di Kota Pematangsiantar, nekat mencuri handphone (Hp) milik TNI. Keterangan dihimpun, saat beraksi ada seorang tersangka baru yakni berinisial HM (16) di Jalan Renville, Lorong 22, BDB. Benet menyempat diri mencuri Hp milik anggota TNI Serka L Sinaga (46) yang berada di samping rumah kost yang bakal mereka tuju. Ceritanya, Jumat (5/4), sepulang sekolah, Benat yang selama ini kost di Jalan Bali mengajak Holmes mencari tempat kost baru. Ajakan pelaku diiyakan HM karena kebetulan si HM juga mau pindah dari tempat kost lamanya di Lorong I, BDB dengan alasan kurang bebas. Sementara di luar jam belajar, dia banyak kegiatan ekstra kulikuler seperti latihan bela diri. Karena sudah cocok, mereka pergi ke lorong 22. Sampai di sana, warga mengaku samping rumah nomor 167 tempat kediaman L Sinaga TNI yang bertugas di Kodim 0207/Simalungun menerima anak kost. Selanjutnya mereka langsung menuju rumah tersebut sekaligus ingin melobi harga sewa kost. Di sana, L Sinaga tetangga samping rumah kost sedang asik menyusun beberapa pot bunga. Sore itu sekira pukul 14.30 WIB, korban menaruh Hp merek cina bersama satu gelas air putih di atas kursi teras. Tiba-tiba selesai menyusun pot bunga, korban merasa lapar kemudian pergi ke dapur guna mengambil makanan ringan berupa roti. Keluar dari dapur, korban sontak kaget melihat Hp yang awalnya ditaruh di atas kursi sudah tidak ada. Korban sempat tidak percaya kalau handphone-nya hilang. Tak berapa lama, si korban menanyakan kepada istri. Si istri mengaku tidak tahu dan tidak melihat ada orang yang

„ BG, tersangka pencuri Hp milik TNI mengambil atau mencuri Hp. Merasa tak habis akal, korban kemudian menghubungi nomor kontak Hp yang hilang memakai Hp istri. Begitu dihubungi, suara nada panggil terdengar jelas dari samping rumah. Setelah didekati, ternyata Hp itu sudah berada dalam tas milik Benet. Walau sudah ketahuan mencuri, Benet sempat berdalih dan mengatakan bukan mencuri melainkan dapat. Setelah dipaksa mengaku, pelaku bersih keras mengatakan bukan mencuri melainkan mendapat. Takut pelaku di amuk massa. Korban menghubungi petugas kepolisian Polsek Siantar Timur. Tak berapa lama, personil polsek terjun ke TKP untuk mengamankan pelaku. Kepada Metro Benet mengaku, nekad mencuri karena sudah tidak punya uang untuk bayar rumah kost di Jalan Bali. Sementara uang kiriman yang diberi orangtua setiap bulan

habis di judikan. “Aku mencuri untuk bayar uang kost Bang, karena sudah banyak hutang ku di rumah kost di Jalan Bali. Makanya aku niat pindah kost baru Bang,” kata pelaku di Polsek. Tak berapa lama Guru jurusan otomotif SMK GKPS Jalan Ahmad Yani marga Marpaung datang ke Polsek. Ketika diwawancara Metro, dia mengatakan pelaku pencuri Hp itu sudah enam bulan tidak membayar uang sekolah. Jika di totalkan sekitar Rp900 ribu. Selainkan itu pelaku juga dikenal sering bolos dari sekolah. “Pernah sewaktu saya menyuruh Benet pulang ke kampung untuk mengambil uang sekolah. Saya malah ditelepon seorang pemuda yang mengaku abangnya. Waktu itu Saya sempat curiga, karena sewaktu Saya meminta bicara langsung dengan orangtua Hp-nya langsung di matikan,” kata guru pelaku sewaktu ditanya soal latar belakang Benet. Masih di Mapolsek. Korban belum sempat membuat laporan pengaduan, Kapolsek Siantar Timur AKP Altur Pasaribu datang. Kepada Kapolsek korban mengaku tidak keberatan dengan kejadian tersebut. Karena setelah mengetahui latar belakang keluarga pelaku yang baru saja berduka atas meninggalnya orangtua laki-laki. Korban merasa iba dan kasihan, lagi pula pelaku juga masih butuh sekolah. “Mendengar pengakuan Benet kalau orangtuanya baru saja meninggal dunia, Saya turut berduka. Atas kejadian ini Saya tidak keberatan,” aku korban kepada Kapolsek. Konfirmasi Metro dengan AKP Altur Pasaribu mengatakan korban tidak jadi membuat laporan pengaduan. Sekarang ini pelaku sudah dibawa pulang olah guru tempat dimana pelaku bersekolah. (eko)

5 Kreta Gadai Digelapkan SIANTAR- Naas dialami A Siringoringo (30), warga Jalan DI Panjaitan, Kecamatan Siantar Selatan. Dia terpaksa mendatangi Polres Siantar guna membuat laporan penggelapan. Sebab kabarnya, sepedamotor Honda Revo (lupa plat BK) digelapkan oleh tukang gadai, Jumat (5/4) sekira pukul 11.00 WIB. Ceritanya, selama ini, Revo itu sering dipakai kakaknya I br Siringoringo. Beberapa waktu juga Revo pernah digadai dengan uang sebesar Rp3 juta. Setelah lunas, si kakak kembali menggadaikan kepada orang lain dengan nilai Rp1,5 juta. Begitu korban ingin menebus, ternyata penggadai sudah kabur. Setelah di tunggu beberapa hari, pelaku tak kunjung timbul di kampung. “Aku tidak kenal sama siapa kreta itu digadaikan kakak Ku Bang. Tapi yang pasti, kreta sudah tidak kelihatan lagi. Dugaan Ku sudah dibawa kabur sama tukang gadai,” kata korban sewaktu di Polres Siantar. Tak berapa lama masuk ke ruang SPKT, korban kembali keluar. Karena kasus yang dilaporkan si korban butuh saksi. Terutama orang yang menggadaikan kreta. Kebetulan memang siang itu, korban datang seorang diri tanpa ditemani kakaknya. “Kata polisinya. Kalau mau melapor harus ikut kakak Ku Bang. Karena kakak Ku yang menggadaikan,” kata korban berlalu pergi. Informasi dari pihak SPKT membenarkan kedatangan calon pelapor ke Polres Siantar. Karena tak cukup bukti, calon pelapor terpaksa di minta menghadirkan kakaknya untuk menjelaskan kronologis soal gadai tersebut. (eko)

Diduga Stres, Warga Sipahutar Mengamuk di RS Pirngadi MEDAN- Paulus Edi Susanto (25), warga Desa Siabalabal II, Sipahutar, Kabupaten Tapanuli Utara, mengamuk di ruang terpadu E RSUD dr Pirngadi, Medan, Jumat (5/4). Aksi Paulus itu membuat pasien lain ketakutan dan berhamburan lari keluar ruangan. Paulus memecahkan kaca jendela ruangan yang bersebelahan dengan tempat pasien rawat inap. Informasi di rumah sakit plat merah ini, Paulus sedang dalam masa perawatan di ruang 18 karena mengidap penyakit paru sejak enam hari lalu. Diduga stres, tibatiba dia berlari ke ruang E terpadu dan membolak-balikkan meja serta tempat tidur yang ada di situ. Tak hanya itu, seperti kesurupan, Paulus juga memecahkan sejumlah kaca nako. Pasien lain yang dalam perawatan pun panik dan berlari keluar ruangan walaupun sedang diinfus. “Tak tahu kenapa, tiba-tiba dia mengamuk dan memecahkan kaca ruangan,” kata Davidson, salah seorang sekuriti rumah sakit. Khawatir tindakan Paulus mengancam keselamatan pasien lain, petugas keamanan rumah sakit mengamankan Paulus dan membawanya ke ruang Instalasi Gawat Darurat (IGD) dengan diikat di kursi roda. “Terpaksa diikat, soalnya dia ngamuk terus, bahkan ibunya sendiri pun pergi entah kemana karena mau dipukulnya,” kata David. Kabag Hukum dan Humas RSUD dr Pirngadi Medan, Edison Perangin-angin ketika di konfirmasi mengatakan akan menyelidiki kasus pasien tersebut. “Masalah ini akan kita selidiki terlebih dahulu, kabarnya pasien itu mengalami stres, walaupun dia telah merusak barangbarang milik negara,” pungkasnya.(int)



6 April 2013

Pengganti Ketua KPU Harus Berpengalaman MEDAN - Komisi Pemilihan Umum Sumatera Utara (KPU Sumut) berharap agar segera menentukan pengganti Irham Buana Nasution yang telah mengundurkan diri sebagai Ketua KPU. Sebab, selama kekosongan tersebut, KPU kesulitan untuk mengambil keputusan karena hanya memiliki tiga anggota komisioner. Salah seorang komisioner KPU Sumut Rajin Sitepu, Jumat (5/4) mengatakan, pengganti Irham haruslah orang berpengalaman yang berasal dari KPU Sumut atau dari kabupaten/ kota, “Sebaiknya penggantinya berasal dari tubuh KPU itu sendiri. Sehingga dalam pelaksanaan tugas selanjutnya, tidak ada lagi kesulitan dan memang sudah memahami tugas tersebut,” ujarnya. Dia mengungkapakan, pengalaman sangatlah perlu. Sebab jika penggantinya datang dari lembaga luar, pasti membutuhkan proses lagi untuk mempelajari tugas-tugas pokok KPU. “Bayangkan jika orang luar yang ditunjuk sebagai pengganti Irham, itu bakal menjadi masalah. Sementara KPU Sumut saat ini sedang dihadapkan dengan Pemilihan Legislatif (Pileg) yang sudah ada di depan mata,” tegasnya. Dia mengatakan, dengan surat pengunduran Irham dan Turunan Gulo, kini KPU hanya memiliki tiga anggota komisioner. Itu sangat sulit dalam mengambil sebuah keputusan. “Kendala yang kami hadapi dengan pengunduran diri ini, kami akan sulit dalam mengambil keputusan. Dengan tiga anggota, rapat pleno yang kami lakukan tidak memenuhi kuorum. Minimal itu empat orang, baru bisa mengambil keputusan,” sebutnya. Menurut Rajin, seyogiyanya pengganti Irham nantinya adalah anggota yang berada dibawahnya. Yang menentukannya pengganti Irham, bukan dari wewenang KPU Pusat, melainkan KPU Sumut. Nantinya akan dilakukan rapat pleno untuk memilih ketua KPU yang baru. “Nanti jika ada dua komisioner yang baru untuk mengisi kekosongan Irham dan Gulo, baru dilakukan rapat pleno. Suara terbesar dari lima anggota komisioner yang menentukan siapa yang akan duduk sebagai ketua, menggantikan Irham Buana,” ujarnya.(ial/smg)

Pungli di Jembatan Timbang

Rentan Libatkan Banyak Pihak MEDAN- Ketua Komisi A DPRD Sumut Oloan Simbolon memberi apresiasi positif dan sangat setuju pengusutan dugaan pungli yang terjadi di jembatan timbang oleh oknum petugas di Dinas Perhubungan Sumut. Pasalnya, Oloan berkeyakinan, tidak tertutup kemungkinan kasus pelanggaran hukum tersebut melibatkan banyak pihak, baik dari internal Dishub Sumut maupun di luar instansi tersebut. “Pungli di jembatan timbang jangan justru menjadi alat kongkalikong berbagai pihak, karena praktik itu merupakan kejahatan yang sangat merugikan keuangan daerah dan masyarakat,” kata Oloan, Jumat (5/4) Menurut dia, disinyalir praktik pungli di jembatan timbang ini diperkirakan sudah lama berlangsung. Bahkan, ada juga pihak-pihak yang menginginkan perbuatan yang merugikan masyarakat dan keuangan negara ini berlangsung terus. Padahal, tindak kejahatan tersebut, kata politisi Partai Persatuan Daerah (PPD), sering dikeluhkan masyarakat tanpa ada upaya dan tindakan tegas dari penegak hukum. Karena itu, Komisi A yang salah satunya membidangi persoalan hukum, sangat mendukung langkah tegas Kejaksaan Tinggi Sumut, untuk mengungkap kasus pungli tersebut hingga tuntas. “Baru-baru ini, tim penyidik Kejatisu telah memanggil dan memeriksa beberapa staf dan pejabat Dishub Sumut terkait dugaan pungli di jembatan timbang. Salah seorang pejabat yang telah memenuhi panggilan Kejatisu yakni Plt Sekretaris Dishub Sumut Ali Amas,” ujarnya. Menurut Oloan, pemeriksaan terhadap jajaran staf dan pejabat Dishub Sumut tersebut dilakukan bergantian selama dua pekan terakhir Sejalan dengan upaya kejaksaan tersebut, Gubsu Gatot Pujo Nugroho juga perlu mengambil sikap tegas terhadap oknum-oknum pejabat dan staf di jajaran Dishub yang terbukti secara hukum ikut dalam kasus kejahatan tersebut “Tanpa tindakan dan sanksi tegas, praktik pungli di jembatan timbang sulit diberantas hingga tuntas. sehingga Gubsu harus benarbenar serius menuntaskan persoalan ini. Karena masyarakat khususnya para supir sangat dirugikan,” terangnya. Sementara itu, anggota Komisi A DPRD Sumut Syamsul Hilal juga berharap Kejatisu serius mengungkap dugaan pungli tersebut. Bahkan, segera meningkatkan proses pemeriksaan oknum-oknum yang terlibat dari tahap verifikasi, menjadi penyelidikan, penyidikan hingga ada yang ditetapkan sebagai tersangka. “Jangan ada kesan Dishub Sumut seperti instansi yang kebal hukum. Padahal soal indikasi pungli di jembatan timbang itu bukan rahasia umum lagi,” tegas politisi PDIP ini. Sedangkan anggota Komisi A lainnya Syahrial Harahap dari Fraksi PAN juga mensinyalir kontribusi dari jembatan timbang, yang diperoleh dari truk-truk kelebihan tonase tidak sebanding dengan kerusakan infrastruktur jalan yang diakibatkannya. “Yang kita takutkan, pendapatan dari jembatan timbang itu bahkan lebih banyak diambil oknum-oknum untuk kepentingan pribadi daripada masuk ke kas negara,” ucapnya.(adz/smg)


GELAP- Seorang anak memasang lilin untuk menerangi ruangan. Di Sumut masih banyak kepala keluarga yang masih belum menikmati aliran listrik.

421.660 KK Sumut Belum Nikmati Listrik

MEDAN- Hingga Maret 2013, sebanyak 421.660 Kepala Keluarga (KK) di Sumatera Utara (Sumut) masih belum menikmati aliran listrik. Umumnya, mereka berasal dari desa ataupun dusun yang daerahnya masih tergolong sulit dijangkau. Sekretaris Dinas Pertambangan dan Energi Sumut Indra Ginting, Jumat (5/4) mengatakan, pemenuhan kebutuhan engeri listrik untuk KK di Sumut belum mencapat 100 persen. “Saat ini ada 2.611.977 pelanggan KK PLN di Sumut. Namun, rumahnya yang belum dialiri listrik sebanyak 421.660 pelanggan,” sebutnya. Kata dia, rasio elektrifikasi di Sumut hingga Maret 2013 masih sebesar 86,45%. Sementara jumlah KK yang belum

menikmati listrik itu, semuanya tersebar di 1.154 desa dari 5.779 desa yang ada. 165 desa atau dusun berasal dari Kabupaten Tapanuli Utara. “Itulah jumlah KK di Sumut yang belum dialiri listrik baik oleh PLN maupun non PLN,” ujarnya dihadapan peserta Musrenbang 2013 Pemprovsu di Santika Hotel Medan. Ia memprediksi, jumlah KK yang belum dialiri listrik itu akan terus bertambah di masa depan. Sebab, prediksi itu mengacu

kepada rasio pertumbuhan kebutuhan listrik di Sumut yang rata-rata mencapai 7 persen per tahun. Sementara menurut data Bank Indonesia pada triwulan II-2012, Sumut mencatat pertumbuhan ekonomi sebesar 6,29 persen. “Kalau mengacu pada data tersebut, maka kebutuhan listrik pada tahun 2013 mengalami kenaikan 101,08 MW (mega watt) atau menjadi 1.545,08 MW dari 1.444 MW pada Waktu Beban Puncak (WBP) di tahun 2012, dengan daya mampu system sebesar 1.539 MW,” lanjutnya. Indra menjelaskan, berdasarkan daya mampu sistem pembangkitan Sumut pada

Jembatan Layang Simpang Pos Selesai Akhir 2014


IKANNelayan tengah menjaring ikan di tengah laut.

Ikan Habis Dipukat , Nelayan Terjepit MEDAN- Peringatan Hari Nelayan Nasionalkaliinimasihmengidentikkan kawasan pesisir Indonesia sebagai kantong kemiskinan. Begitu juga dengan Sumatera Utara (Sumut), kesejahteraan nelayan tradisional jauh dari harapan. Salah satu penyebabnya karena ikan semakinhabis,lingkunganrusak,illegal fishing semakin merajalela dan banyak persoalan lain. “Nasib nelayan tradisional dari dulu sampai sekarang tak berubah, begini-gini saja,” kata Jamaludin, Ketua Pelaut Rakyat Penunggu Indonesia di Desa Paluh Sibaji, Kecamatan Pantai Labu, Kabupaten Deli Serdang, Jumat (5/4). Menurut Jamal, 20 tahun lalu, nelayan dengan mudah mendapatkan ikan dengan memancing di pinggiran pantai. Ibu-ibu sebagai nelayan perempuan bisa mencari kepah dan kerang di pinggiran pantai dan berpenghasilanlebihdariRp75ribuper hari. Penghasilaninimembantuekonomi keluarga. Selain pendapatan suami yang saat itu lebih besar, karena tangkapan banyak dan harga bagus. Hanya dengan peralatan sederhana,

2012, maka cadangan listrik ideal yang dimiliki harus sebesar 461,7 MW. Namun, akibat kondisi mesin pembangkitan yang sudah uzur dan adanya komponen yang tidak diproduksi lagi, menyebabkan kelebihan daya listrik dari daya mampu hanya sebesar 95 MW. “Sehingga, apabila terjadi kerusakan di salah satu pembangkit utama di PLTGU Sicanang, Belawan atau Paya Pasir, maka pasokan listrik pasti akan terganggu. Kondisi inilah yang dialami KK Kota Medan dalam beberapa pekan terakhir,” tutut Indra.(ram/smg)

hasiltangkapannelayanterbilangbesar, meski lokasi tak sampai 10 mil dari garis pantai. ”Dulu mudah sekali menangkap ikan, istilahnya, dengan memancing sambil menghanyut, bisa dapat ikan karena jumlah melimpah,” kata Jamal lagi. Menurut dia, seiring pergeseran waktu terjadi perubahan drastis. Ikan semakin sulit didapat karena lingkungan rusak. Terumbu karang yang menjadi tempat pemijahan ikan hancur dengan beroperasinya pukat trawl di wilayah tangkap nelayan tradisional. Padahal, menurut Jamal, tidak ada satu pun regulasi yang membenarkan operasional pukat dengan jenis apapun di perairan Sumut. “Mau pukat teri, pukat grandong sampai pukat harimau, tidak boleh beroperasi,” kata Jamal. Kenyataannya, nelayan tradisional kerap kesulitan lantaran jaring yang di pasang habis di angkut pukat trawl yang beroperasi di lokasi sama. Pukat menyapu habis semuanya. “Kalau pukat sudah main, ikan kecil, ikan besar, sampai terumbu karang dan apa

pun yang ada di dalam laut bisa habis di sapu,” ujarnya. Akibatnya, nelayan terpaksa mencari ikan di wilayah yang semakin jauh ke laut lepas bahkan sering ke perbatasan perairan Indonesia dan Malaysia. Di sini, para nelayan berhadapan dengan kapal-kapal besar pencari ikan dengan kapasitas ribuan ton. Mereka pun terpaksa mengambil risiko ditangkap patroli Malaysia. Jika tertangkap, seluruh hasil tangkapan berikut peralatan tangkap dirampas dan disuruh kembali ke darat dengan minyak yang tersisa. ”Itu masih untung, kalau tidak dipukuli, atau di penjara di Malaysia,” ucapnya sedih. Jamal menilai, seharusnya ada perlindungan terhadap nelayan tradisional. Misalnya dengan jaminan 12 mil dari garis pantai bebas dari operasional kapal penangkap ikan yang peralatannya modern. “Jangan sampai bercampur di lokasi yang sama dan saling berhadapan, nelayan tradisional pasti kalah,” kata Jamal.(kps/int)

MEDAN- Pembangunan jembatan layang atau (fly over) di Simpang Pos, Kota Medan, diperkirakan selesai pada akhir 2014, karena saat ini pembangunannya telah berjalan. “Jika tidak ada arah melintang, pembangunan fly over Simpang Pos ini akan selesai pada Desember 2014. Untuk itu, kita akan terus bekerja keras merealisasikannya,” kata Kepala Satuan Kerja Pelaksanaan Jalan Nasional Metropolitan Medan Mula Tua Sinaga di Medan, Kamis kemarin. Menurut dia, saat ini pihaknya fokus pada penyelesaian pembangunan fly over Simpang Pos. Setelah itu akan fokus dua fly over lagi yakni fly over Pinang Baris dan fly over Jalan Gatot Subroto. Kemudian underpass Titi Kuning di Jalan Brigjen Katamso. “Untuk pembangunan underpass Titi Kuning, kini dalam tahap studi. Pembangunan fly over Pinang Baris sudah dalam tahap desain. Sedangkan satu lagi, kita sekarang sedang berjuang untuk membangun fly over Jalan Gatot Subroto. Sehingga dapat menjadi bagian fly over yang ada di Kota Medan,” katanya. Wali Kota Medan Rahudman Harahap juga menyempatkan meninjau pembangunan jalan fly over Simpang Pos tersebut. Kedatangannya untuk mengetahui sejauh mana proses pem-

bangunan yang sudah dilakukan. “Wali Kota juga ingin mengetahui apa yang menjadi kendala, sehingga mengganggu kelancaran pembangunan jembatan layang kedua di ibukota provinsi Sumut ini setelah fly over Pulo Brayan tersebut,” paparnya. Menurut Mula Tua, dari hasil peninjauan yang dilakukan, ia menilai proses pengerjaan jembatan fly over Simpang Pos yang dilakukan saat ini termasuk cepat. Rencananya, bulan ini, kiri kanan jalan sudah bisa dipergunakan supaya full pembuatan tiang tengah. Sebab, titik fokus pembangunan fly over adalah tiang tengah ini. “Karena itu saya berharap jangan ada lagi kendala-kendala sehingga mengganggu kelancaran pembangunan fly over,” ujarnya. Berdasarkan informasi yang diperoleh, kata dia, salah satu kendala yang mengganggu kelancaran pembangunan fly over terkait terjadinya kemacetan arus lalu lintas. Ternyata yang menjadi penyebabnya adalah kehadiran sejumlah stasiun-stasiun liar. “Untuk itu saya minta Satlantas Polresta Medan dan Dinas Perhubungan Kota Medan berkoordinasi untuk mengatasinya. Saya minta secepatnya harus ditertibkan agar pengerjaan fly over dapat berjalan dengan baik dan lancar,” katanya.(ant/int)

Semua KA Sumut Pakai AC MEDAN- Kereta Api (KA) di Sumut semua dilengkapi pendingin udara (AC). Itu salah satu upaya manajemen PT Kereta Api Indonesia (KAI) untuk meningkatkan pelayanan secara nasional. “Jurusan Medan-Tanjung Balai, MedanRantau Prapat dan Medan-Siantar, semuanya sejak akhir Februari 2013 sudah pakai AC. Di Jawa, masih ada KA yang belum memakai faslitas itu,” kata Humas PT KAI Divre I Sumut-Aceh Rapino Situmoroang, Kamis kemarin. Menurut dia, penggunaan AC itu dilakukan sejalan dengan pembenahan stasiun dan perubahan jadwal keberangkatan kereta api yang diberlakukan mulai 1 April. Perubahan jadwal keberangkatan KA dilakukan untuk memenuhi keinginan pasar. Mereka meminta agar jadwalnya bersinergi dengan transportasi lainnya. Sekaligus untuk

menyesesuaikan dengan jam penerbangan di Bandara Kualanamu pengganti Polonia, Medan. “Dengan tambahan fasilitas AC dan layanan yang lebih maksimal, tarifnya juga naik. Tetapi dewasa ini untuk promosi, manajemen masih menjual tiket dengan harga lebih murah,” katanya. Kata Rapino, untuk Medan-Tanjung Balai misalnya, harusnya Rp45 ribu per orang menjadi Rp30 ribu per orang. kemudian Medan-Siantar dari harga Rp40 ribu per orang menjadi Rp30 ribu per orang. Anggota DPD RI utusan Sumut Parlindungan Purba mengaku, upaya manajemen KAI membenahi fasilitas dan layanan memang sangat diharapkan. “Penggunaan yang tinggi pada KA akan (FOTO:INT) sangat membantu pemerintah menekan kemacatan lalulintas di jalan lintas Sumut,” FASILITAS- Para penumpang dengan nyaman menikmati fasilitas yang ada di kereta api. terangnya.(ant/int)

JUMAT 5 April 2013

Warga ..

Sambungan hal 8 listrik ini, yang dianggap paling mengganggu oleh masyarakat adalah, tersendatnya distribusi air dari PDAM Tirta Kualo, kepada masyarakat sebagai pelanggan. Sebagaimana diketahui, selama ini, pihak PDAM mengandalkan tenaga listrik, untuk menggerakkan mesin distribusi, untuk men-suply air bersih kepada masyarakat. Akibat dari pemadamaninipun,supplyairmenjaditerganggu. Ijab Kabul Diterangi Lampu Petromak Terlepas dari kerugian-kerugian warga akibat pemadaman PLN ini, ada sejumlah cerita menggelitik dari masyarakat, yang konon muncul, akibat pemadaman listrik ini. Seperti yang diutarakan Sinar, seorang ibu rumah tangga asal Kelurahan Muara Sentosa. Kata Sinar, beberapa waktu lalu, salahseorang anaknya baru saja menikah, dan melangsungkan proses ijab kabul, di kediaman mereka.Acara sacral itu, kata dia, sempat terganggu karena listrik tiuba-tiba padam, sehinggapeneranganharusdigantidenganlampu petromak. “Jadi, anak saya lagi ijab kabul. Pas acaranya, lampu tiba-tiba padam. Mau tak mau, acara terganggu, kami pinjam lampu petromak dulu, baru acara bisa dilanjutkan,” sebut Sinar, yang mengaku jengkel dengan keadaan itu. Lain halnya dengan Arif(49), Warga Teluk Nibung. Kata dia, karena pemadaman oleh PLN beberapa waktu lalu, acara keagamaan yang tengah dilangsungkandikediamannyaterganggu, karena pemadaman terjadi saat acara tengah digelar. “Waktu Takjiah, tiba-tiba lampu padam. Yah, mau tak mau, gelap-gelapan acaranya,” kata dia. Sementara itu, pihak PT.PLN(Persero) Tanjungbalai Ir.Abdul Kholik Nasution, melalui salahseorang stafnya bermarga Panjaiatan menjelaskan, pemadaman ini tak hanya terjadi di Tanjunbalai, melainkan seluruh Sumatera Utara. Menurut dia, hal ini disebabkan terjadinya kerusakan pada turbin uap, di PLTU Sicanang Belawan. “Pemadaman ini menyeluruh, tidak hanya di Tanjungbalai, jadi, mohon bersabar,” katanya.(Ilu)

Polisi ..

Sambungan hal 8

rum Komunikasi Pemuka Agama (FKPA) Kota Tanjung Balai kepada METRO, Jumat (5/4). Katanya, maraknya aktifitas penjualan kupon judi togel tersebut membuktikan bahwa polisi kurang serius untuk memberantasnya. “Maraknya aktifitas penjualan kupon judi togel itu akibat bandarnya yang belum tersentuh hukum. Walaupun selama ini, para juru tulis togel sudahbanyakyangmendekamdibalikjerujibesi,” ujar Uztad imran Bhakti Panjaitan. “Selama ini, polisi hanya menangkap atau mengeskpos para juru tulis togel saja, sementara bandarnya tetap dibiarkan bebas untuk meraup kuntungan. Buktinya, sampai saat ini belum pernah terdengar ada bandar togel yang mendekam di penjara,” kata Arsyad, warga Kota Tanjung Balai mengamini. Kedua tokoh ini menilai, polisi sengaja melindungi bandar, sehingga yang ditangkap hanya penjual saja. “Saya menilai polisi sengaja melindungi bandar togel itu. Tidak mungkin Polisi tidak tahu siapa bandarnya. Kalaumerekaserius,kanbisasajapolisimelakukan pengembangan dari para jurtul yang ditahan itu,” ucap kedua tokoh mengakhiri keterangannya. Amatan METRO, sampai Jumat (5/4) kemarin, memperlihatkan aktifitas penjualan kupon judi togel ini pada umumnya dilakukan di warungwarung kopi atau kios-kios rokok bahkan kedai minuman.Danpenjualannyadilakukanbervariasi, ada yang menggunakan kupon atau selembar kertas, dan ada juga dengan SMS melalui handphone. (Ck-5)

Perayaan Paskah LP Labuhan Ruku Hikmat BATUBARA-Seratusan warga binaan lapas (Lembaga Permasyarakatan) kelas II A Labuhan Ruku, Kabupaten Batubara merayakan Paskah dengan hikmat, meskipun di dalam rumah tahanan lembaga permasyarakatan. Tembang lagu puji-pujian erkumandang menggema dalam Ruangan Aula Lapas Labuhan Ruku, saat acara digelar, Jumat (5/4). Salah seorang penghuni lapas, M.Sitanggang, mengatakan,”Pembinaan rohani sudah biasa dilakukan dalam lapas untuk memasyarakatkan serta mendidik masyarakat yang telah terganjal kesalahan,untuk kebaikan mental dan pikiran rohanian penghuni lapas,seperti saya yg sudah beberapa tahun mengikuti paskah dilapas ini,”ucapnya kepada METRO.

Dalam khotbahnya yang disampaikan oleh Pdt.A.ginting,STh, yang dikutib dari John 14;6 : Kata Yesus kepadanya”Akulah jalan kebenaran dan hidup, tidak ada seorangpun yang datang kepada Bapa kalau tidak melalui aku” yang dipetik dari Kisah para rasul 5:3031,serta matius 28;7-8 Ka.PLP S . B e r u t u , S . S o s, B c . I P, M s i mengatakan,kegiatan perayaan paskah, sudah setiap tahunnya dirayakan untuk memperkokoh keimanan serta mengajak perubahan bagi umat kristiani memiliki makna paskah yang sejati. Tampak hadir dalam acara tersebut KPLP Labuhan Ruku, S.Berutu, Drs.Sahala Nainggolan, Pdt.Johannes Simanjuntak,STh, Pdt.M.barus,STh, Pdt.S.Ginting,STh, Pdt.A.girsang,STh, dan sejumlah undangan lainnya.(Mag-09)

„ Para narapidana mengikuti kebaktian

Pansus Diminta Usut Kasus Rekening Baru Pemko Sambungan hal 8 Katanya, Pansus harus mempertanyakan keuntungan Pemko Tanjung Balai didalam pembukaan rekening baru tersebut. “Sesuai dengan ketentuan yang telah berlaku selama ini, Pemko Tanjung Balai secara resmi hanya membuka rekening di PT Bank Sumut selaku perbankan milik daerah. Jika Walikota Tanjung Balai membuka rekening baru di bank yang lain dengan mengalihkan sejumlah besar uang milik pemerintah daerah, maka harus jelas aturan mainnya terutama keuntungannya bagi Pemko Tanjung Balai,” tegas Herna

Veva,Amd. Seperti diketahui, kasus pembukaan rekening baru Pemko Tanjung Balai diluar dari PT Bank Sumut tersebut sempat membuat heboh kalangan politisi dan juga pejabat di Kota Tanjung Balai. Pasalnya, kasus tersebut secara blak-blakan langsung diungkapkan oleh Ketua DPRD Kota Tanjung Balai H Romaynor,SE dalam suatu rapat paripurna DPRD yang dilaksanakan pada akhir tahun 2012 lalu. Akan tetapi, kasus tersebut sempat menghilang, sejalan dengan adanya jawaban dari Walikota tanjung Balai Dr H Thamrin Munthe,MHum yang

mengatakan, pembukaan rekening baru tersebut dilakukan untuk penyehatan dunia perbankan di Kota Tanjung Balai, tanpa menjelaskan alasan – alasan lainnya. Soalnya, pembukaan rekening baru tersebut justru dilakukan pada salah satu bank yang berkantor di Medan. “Kita melalui Pansus LKPJ akan mencoba untuk menelusurinya nanti dengan cara, meminta rekapnya dari SKPD terkait. Soalnya, Pansus itu bukan hanya saya, sehingga segala sesuatunya akan dibicarakan dengan seluruh anggota Pansus,” singkat Wakil Ketua Pansus LKPJ, Hakim Tjoa Kien Lie, saat dikonfirmasi. (Ck-5)

Ratna... Sambungan hal 8 mereka yang selama ini terpinggirkan. Intimidasi sampai kurungan jeruji besi pernah dijalaninya, namun ia terus maju memperjuangkan apa yang diyakininya. Belakangan, putri pasangan Saladin Sarumpaet dan Yulia Hutabarat ini lebih dikenal sebagai seorang Aktivis. Namun jauh sebelum itu, ia terlebih dahulu terjun ke dunia teater. Adik kandung aktris gaek Mutiara Sani ini pernah berkuliah di Fakultas Teknik Arsitektur serta Fakultas Hukum UKI. Namun, belum sempat menamatkan studi di kedua bidang tadi, Ratna memutuskan untuk memilih teater sebagai pilihan karirnya. Pada 1969, anak kelima dari sembilan bersaudara ini belajar ber teater selama 10 bulan di Bengkel Teater Rendra. Setelah itu, ia memutuskan untuk belajar secara otodidak kemudian mendirikan kelompok Teater Satu Merah Panggung di tahun 1974. Sebagai seniman teater, Ratna tak hanya piawai berakting di atas panggung, namun juga mampu menulis naskah drama yang sebagian besar temanya seputar nasib orang-orang pinggiran. Naskah yang pertama kali ditulisnya berjudul Rubayat Umar Khayam yang dibawakan bersama sanggar teater miliknya. Naskah-naskah tersebut kemudian dipentaskan keliling kota, provinsi, hingga mancanegara. Pada 1997, Ratna menghadiri 4th International Woman Playwright Center di Galway, Irlandia. Pada tahun yang sama, ibu empat anak ini melakukan presentasi tentang naskahnaskah drama yang ia tulis di Jerman dan Inggris. Dari panggung teater, mantan istri mendiang Achmad Fahmy Alhady ini kemudian merambah dunia televisi dan film sebagai penulis skenario dan sutradara. Dalam kapasitasnya sebagai editor film, Ratna bahkan pernah bekerjasama dengan MGM, Los Angeles, Amerika Serikat. Sejak pertengahan tahun 80-an, Ratna Sarumpaet kerap mendapat undangan untuk berbicara dalam berbagai kegiatan seni budaya di luar negeri. (Int)

SPBU Yos Sudarso Utamakan Pembeli Pakai Jerigen Minim Sambungan hal 8 per liter, yang diberlakukan. “Kalau untuk pengisi jerigen, kalau tak silap, per liter dijual diatas HET. Bahkan, pemilik jerigen, juga harus mengeluarkan fee untuk operator, untuk mengisi tiap jerigen, dengan besaran yang berpariasi,” tukas seorang sumber, yang mengaku memahami system permainan tersebut. Selain itu, diperoleh pula informasi, jika solar yang dibeli dengan jerigen itu, akan

dijual kembali kepada agen – agen, yang beroperasi di gudang, atau pinggiran sungai Kuala Kapias, dan Teluk Nibung. Oleh mereka, minyak itu kembali dijual kepada nelayan dengan harga di atas HET, namun di bawah dari harga pembelian BBM Solar di SPDN, atau SPBB, yang menjual solar non subsidi kepada nelayan seharga Rp 11 ribu per liter. “Sebenarnya ini dilematis sekali ya. Satu sisi, harga solar di SPDN itu mahal, dan stock mereka juga terbatas. Akhirnya, hal ini

terpaksa dilakukan, meskipun memang ini sudah melanggar,” sebut sumber. Sedangkan SPBU PT.Prima Agung Perkasa, melalui Hutagalung mengakui hanya mampu melayani konsumen yang datang membeli minyak solar dan pelayanan itu tanpa terkecuali termasuk pengendera sepeda motor dan pembeli menggunakan jeregen apabila pembeli menggunakan jerigen dibekali surat dari Dinas Perdagangan(Disperindag) Tanjungbalai.(ILU)

Anggaran Keberangkatan Ke PRSU Disoal Sambungan hal 8 dapat digunakan. Karena hasil evaluasi gubernur Sumatera Utara atas Rancangan APBD TA.2013 Kota Tanjung Balai baru disahkan oleh Badan Anggaran (Banggar) legislative dan eksekutif pada tanggal 20 Maret 2013. Sementar,a PRSU sudah berlangsung sejak tanggal 15 Maret 2013.. Namun, aku Hakim Tjoa, keikut sertaan dalam PRSU tersebut tidak jadi masalah jika Pemko Tanjung Balai menggunakan anggaran tersendiri diluar dari APBD. Karena, jika

menggunakan dana dari APBD, maka hal itu sama saja dengan melakukan perbuatan yang melanggar peraturan pemerintah tentang pengelolaan keuangan pemerintah. Secara terpisah, Kepala Bagian Humas Sekdakot Tanjung Balai, Dra Darul Yana Siregar yang dihubungi METRO melalui sellularnya membenarkan, bahwa Pemko Tanjung Balai ikut ambil bagian dalam menyemarakkan PRSU ke-42 tersebut. Namun, Darul Yana mengaku tidak tahu menahu soal anggaran Pemko Tanjung Balai dalam PRSU tersebut. “Benar,

Pemko Ta n j u ng Balai turut menyemarakkan PRSU ke-42 itu. Akan tetapi, soal anggarannya, itu adalah urusan dari Dinas Perindustrian dan Perdagangan, silahkan tanyakan sama mereka,” ujar Darul Yana. Sementara, Kepala Dinas Perindustrian dan Perdagangan (Disperindag) Kota Tanjung Balai, Nedi Hamlet,SE yang dihubungi menolak untuk menjawab. “Nanti kukabari ya, saya masih di Medan mengikuti Musrenbang Provinsi,” jawab Nedi Hamlet singkat. (Ck-5)

Penerangan.. Sambungan hal 8 METRO, Jumat (5/4) mengakui hal itu. Seperti Sumarni (40), Zulham (25) saat ditemui secara terpisah, mereka mengakui, kurangnya sarana penerangan jalan di tempat itu, telah beberapa waktu lalu telah memicu terjadinya sejumlah kasus kejahatan. “Di sekitar jalan ini memang sudah rawan.Pernah dulunya ada terjadi peristiwa perampokan hingga menghilangkan nyawa korban.Bahkan ada juga Satpam meninggal karena dirampok dan pelakunya tidak pernah terdengar tertangkapm,” lata Zulham. Disamping itu ,Zulham juga menjelaskan bahwasanya kejahatan perampokkan terjadi pada menjelang malam hari.” Jangan cobacoba melintas di jalan itu lewat diatas jam dua belas malam keatas,” Ungkapnya mengingatkan. Meskipun demikian ketiga warga ini berharap agar pihak Pemkab Batu-Bara secepatnya melakukan pemasangan lampu jalan di sepanjang jalan tersebut. ” Kalau sudah malam sepanjang jalan ini gelap gulita.Agar tidak ada lagi aksi kejahatan di sepanjang itu ya lampu penerang jalannya agar dipasang,” ungkap mereka. (CK3)

Sambungan Metro Asahan Jalan Kaki Tembus Hutan, Honor 2 PENUMPANG TEWAS hanya Rp150 Ribu Sebulan Sambungan Halaman 1

Sambungan Halaman 1 jalan di tengah hutan (Gotting Babiat) yang kebetulan rombongan mobil Turdes Bupati Tapsel sedang mengalami mogok akibat sulit melewati jalan setelah diguyur hujan. Aktivitas mengajar tetap dipertahankannya sekalipun telah menikah dengan Ritonga (27). Sekitar 4 tahun terakhir, ia harus menempuh jarak yang cukup jauh ke sekolah. Karena ia ikut suami dan tinggal di Desa Baringin, Kecamatan Dolok, Kabupaten Padang Lawas Utara (Paluta). “Saya ingin terus mengabdikan diri berbagi ilmu dengan anak anak kampung kelahiran saya. Apalagi di sana, tenaga saya masih dibutuhkan,” ujarnya sambil menjelaskan dalam seminggu dirinya hanya masuk 3 kali saja. Lebih lanjut, Alumni D2 kependidikan Universitas Muhammadiyah Tapanuli Selatan (UMTS) tersebut mengungkapkan, pada hakikatnya upah yang diterimanya dalam mengambdikan diri di bangku sekolah tidaklah memenuhi kebutuhan hidup. Namun karena dorongan ingin tetap mengajar, berbagi ilmu dan juga berharap adanya perhatian pengangkatan status honor menjadi Pegawai Negeri Sipil (PNS), dirinya terus bertahan dengan penuh

kesabaran. Sekalipun untuk memenuhi kebutuhan hidup harus dibarengi membantu suami dengan kerja keras di sawah, ladang dan kebun milik mereka. ”Selain mengajar, saya membantu suami bertani, kadang ke sawah, ke kebun untuk menderes agar kebutuhan ekonomi keluarga bisa terpenuhi,” sebutnya. Ia mengaku hanya menerima honor sekali dalam tiga bulan (per triwulan) dengan jumlah Rp450 ribu. Ketika mengarungi hutan lebat menuju tempat mengajar, Siti Mariani mengaku, sama sekali tidak merasa takut lagi, walau harus berjalan sendiri. “Saya sudah biasa mungkin dengan lingkungan hutan ini, hanya takut hujan saja. Dan terkadang akibat hujanm dirinya jadi sering terlambat,” ucapnya sambil menjelaskan untuk memenpuh sekolah dibutuhkan waktu 1 hingga 1,5 jam. Di hadapan Sekda Kabupaten Tapsel, Ir Aswin Siregar yang kebetulan berada di lokasi ketika perbincangan awak koran ini dengannya, Siti Mariani juga berseloroh dengan harapan agar ada perhatian pemerintah terhadap guru seperti dirinya. “Kalau bisa ada kejelasanlah pak,” ucapnya. (***)

Pria warga Laguboti, Kabupaten Tobasa itu, mengangkut salah satu media terbitan Jakarta. selain mengangkut koran, dia juga membawa empat penumpang antara lain Adi Saputra Simatupang (49), warga Jalan Percut Kota Medan, Tiurma Br Siagian (46) warga Jalan TB Simatupang Medan, Karne Br Nainggolan (77) warga Jalan Narumambing Siraituruk Kecamatan Porsea Tobasa dan supir utama L-300 bernamaFransyangmelarikandiri setelah kejadian. Sementara, dari arah berlawanan melintasBus Karya Agung BK7655TLyangdikemudikanSaut Manurung (36), warga Dolok Nauli Kecamatan Porsea Tobasa mengangkut enam penumpang masing-masing Gito Marpaung (77) warga Jalan Sitorang Jahe, Toba Samosir, Sondang Mar-

paung(65)wargaLumbanLintong Porsea, Tobasa, Jinggar Marpaung (39), Mangiran Marpaung (45), Mitton Marpaung (45) dan Nursalam Napitupulu (58), warga Tobasa. Beberapa saksi mata menerangkan, saat itu kedua bus melaju dengan kecepatan tingggi. Diduga supir L-300 mengantuk saat mengemudikan mobil dan mengambil jalur terlalu ke tengah. Karenamelajukencang,BusKarya Agung tak sempat mengelakkan bus yang ada di depannya hingga tabrakan dengan posisi laga kambing terjadi. Selanjutnya, keduamobilbergesermelintangdi jalan. Warga yang mendengar suara dentuman keras, langsung menuju lokasi berusaha memberikan pertolongan dan sebagian menyampaikan kejadian itu kepada pihak kepolisian. Saat dievakuasi, salah seorang

penumpangBusKaryaAgungGito Marpaung dinyatakan tewas di lokasi kejadian, sementara seluruh korban lain dilarikan ke Rumah Sakit Mina Padi Sinaksak. Namun setelah sampai di IGD RS Mina Padi, seorang penumpang lagi, Sondang Marpaung yang mengalami luka serius di seluruh tubuh dan kepalanya tidak dapat terselamatkan. Dia meregang nyawa di ruang IGD RS Mina Padi. Sementara, seluruh penumpang di dua bus tersebut tampak mengalami luka dan menjalani perawatan di rumah sakit itu. Johan Hutapea, pengemudi bus L-300 ketika ditanyai METRO mengatakan, bus tersebut sebelumnya dikemudikan Frans. Karena lelah, Frans memintanya untuk mengemudikan bus. Tepat sampai Timbangan Dolok Melangir, Johan yang sebelumnya tidur langsung mengambil alih kemudi. “Sebelumnya aku sudah

nolak karena capek dan ngantuk Bang. Tapi kawan itu tetap saja ngotot untuk minta gantian nyetir. Waktu tabrakan aku tidak sadar karenamasihmengantukdantibatiba mobil sudah ringsek akibat tabrakan. Selain itu laju mobil juga tidak ingat kencang atau pelan. Setelah kejadian aku keluar dari dalam mobil dan tergeletak di pinggir jalan. Begitu sadar, polisi sudah datang,” kata supir itu. Masih kata Johan, dia kenal dengan Frans sewaktu di Medan. Tetapikeduanyatidakterlaluakrab karena Frans sering keluar kota. Selama ini, dia jarang ikut dengan Frans untuk mengantar koran, tetapi karena ingin pulang kampung ke Laguboti dia berniat menumpang. “Aku sama dia belum terlalu dekat Bang. Karena dia terus sibuk bekerja, aku ikut samadiakarenaakuadajanjisama lae (saudara ipar, red) ku Bang. Kami rencananya mau jumpa

karena ada urusan keluarga. Tapi belum juga sampe aku sudah kaya gini,” tambah pria kurus yang mengaku sudah duda itu. Sementara, tak berapa lama saudara korban tewas yang mendapatkabardukadatangkerumah sakit, kemudian membawa jenazah ke rumah duka di Tobasa untuk disemayamkan, sedangkan korban yang mengalami luka-luka masih dirawat. Kapos Lantas Dolok Melangir Aiptu E Simanjorang ketika dikonfirmasi mengatakan, kecelakaan bus L-300 kontrak bus Karya Agung sudah mereka tangani. Begitu juga dengan para korban sudah dievakuasi ke rumah sakit. Untuktindaklanjut,pihaknyaakan memeriksa Johan Hutapea selaku pengemudi L-300. (mag-10/ eko)

Petani Tewas Disembelih Petani Sambungan Halaman 1 usai menghabisi nyawa korban. Petugas yang mengetahui hal itu langsung menyerahkan tersangka ke Polres Pakpak Bharat, karena tempat kejadian perkaranya di Pakpak Bharat. Kepada polisi, M Manik mengakui perbuatannya dengan menyerahkan barang bukti berupa sebilah parang

yang telah berlumuran berdarah. Tersangka M Manik mengutarakan, dirinya menuding Ukuk Tinambunan menggunagunai ayahnya Rikwan Manik hingga meninggal empat hari lalu. Hal ini dikuatkan karena sebelumnya Tinambunan terlibat cekcok dengan Rikwan Manik. Setelah percekcokan itu, ayah tersangka terbaring sakit.

Sejak itu, M Manik menaruh dendam kepada Ukuk Tinambunan yang masih berikatan saudara dengannya. Pada hari naas itu, tersangka yang sedang berada di ladangnya melihat korban berjalan menuju ladang cabainya. Kebetulan, lokasi ladang keduanya berdekatan. Melihat Tinambunan, seketika Manik emosi. Tersangka lalu mengambil

parangnya dan menyerang korban dari belakang. Sabetan parang tersangka mengenai kepala korban. Seketika itu juga Ukuk Tinambunan roboh. Namun bacokan tersebut bukan membuat tersangka berhenti. Manik langsung menarik leher Tinambunan lalu menggoroknya. Korban pun tewas bersimbah darah. Wakapolres Pakpak Bharat

Kompol Supriatmono ketika dikonfirmasi melalui telepon selulernya, kemarin (5/4) membenarkan adanya pembunuhan tersebut. “Tim Reskrim Polres Pakpak Bharat telah diturunkan ke lapangan untuk melakukan olah Tempat Kejadian Perkara (TKP). Kami juga sudah menyita barang barang bukti sebilah parang,” ujar Wakapolres. (buyung/pmg)

Edisi 93 thn VI

JUMAT 5 April 2013

Pansus Diminta Usut Kasus Rekening Baru Pemko TANJUNGBALAI-Panitia Khusus Laporan Keterangan Pertanggungjawaban Walikota Tanjungbalai Tahun Anggaran (TA) 2012 diminta untuk mengusut keabsahan pembukaan rekening baru pemko Tanjungbalai, yang diketahui dibuka pada salahsatu Bank, di luar PT Bank Sumut pada tahun 2012 lalu. Pembukaan rekening baru dengan mengalihkan uang Pemko Tanjungbalai dari PT Bank Sumut tersebut dilakukan Walikota secara mendadak, tanpa adanya persetujuan dari DPRD, dinilai merupakan modus mencari keun-


tungan. Permintaan tersebut diungkapkan Herna Veva,Amd, mantan anggota DPRD Kota Tanjung Balai kepada METRO di kediamannya, Jumat (5/4). „) Baca Pansus ...Hal 7

atna Sarumpaet

Seniman & Aktivis HAM

„ Petugas SPBU sedang mengisi BBM ke dalam jerigen

SPBU Yos Sudarso UTAMAKAN PEMBELI PAKAI JERIGEN TANJUNGBALAI-Ketimpangan dalam system penjualan BBM bersubsidi, khususnya jenis solar di Kota Tanjungbalai terus terjadi. Paling tidak, hal ini dapat disaksikan di SPBU milik PT Prima Agung Perkasa, di Jalan Yos Sudarso, Kelurahan Muara Sentosa, Kecamatan Teluk Nibung. SPBU ini, dalam beberapa hari terakhir,

terpantau mengutamakan melayani pembeli yang menggunakan jerigen. Amatan METRO, kemarin, sekitar pukul 14.00 WIB, 2 unit becal bermotor bermuatan puluhan jerigen terlibat memasuki areal SPBU, dan langsung menuju salahsatu pompa pengisian. Selanjutnya, setelah berbincang sejenak, operator pompa SPBU itu,

Anggaran Keberangkatan ke PRSU Disoal TANJUNGBAL AI-Keikut sertaan Pemko Tanjung Balai dalam even ekonomi, budaya, kesenian dan pariwisata tahunan Pekan Raya Sumatera Utara (PRSU) ke-42, yang diselenggarakan sejak 15 Maret hingga 15 April mendatang mulai dipertanyakan. Hal itu terkait dengan tidak jelasnya mata anggaran, yang dipakai untuk mendanai keikut sertaan Pemko Tanjung Balai dalam perhelatan itu, termasuk besaran serta tata cara penghunjukan rekanan untuk mengelola kegiatan Pemko Tanjung Balai di lokasi PRSU di Medan. “Kita mendukung keikutsertaan Pemko Tanjung Balai pada even PRSU, karena itu bertujuan

lantas mulai mengisi puluhan jerigen, yang telah disusun di atas bettor tersebut. Ironisnya, nyaris tidak ada terlihat raut wajah cemas di wajah sang operator, maupun penarik bettor itu, terhadap aksinya, yang bisa saja memunculkan protes dari kalangan warga. Informasi yang berhasil

„) Baca SPBU ...Hal 7

Polisi Dituding Tak Serius Berantas Togel TANJUNGBALAI-Masih maraknya perjudian seperti penjualan kupon toto gelap (togel) di Kota Tanjung Balai membuat kalangan tokoh agama di kota itu resah.

Pasalnya, maraknya aktivitas penjualan kupon togel tersebut menimbulkan kesan, bahwa penulis maupun Bandar tidak takut jika suatu saat akan berhadapan dengan aparat

untuk mengembangkan ekonomi kerakyatan sekaligus diharapkan dapat menarik minat investor untuk berinvestasi. Tapi, keikutsertaan Pemko Tanjung Balai dalam even tersebut tentunya dengan menggunakan anggaran pemerintah, yang aturan mainnya telah diatur melalui peraturan pemerintah,” kata anggota DPRD Tanjungbalai, Hakim Tjoa Kien Lie, kemarin. Menurut Hakim, keikutertaan Pemko Tanjung Balai dalam PRSU itu dilakukan pada saat Anggaran Pendapatan dan Belanja Daerah (APBD) Tahun Anggaran (TA) 2013 belum

BATUBARA -Ruas jalan Acces Road menuju kawasan industry Tanjung Gading di Kecamatan Sei Suka Kabupaten Batu Bara rawan kejahatan. Hal ini ditengarai, sebagai dampak dari minimnya sarana penerangan jalan. Kondisi ini dianggap cukup mengganggu, mengingat di kawasan itu, sejumlah industry berskala besar beroperasi. Sejumlah warga saat ditemui

„) Baca Anggaran ...Hal 7

„) Baca Minim ...Hal 7

Wak Alang: Petugas didesak berantas judijenis toto gelap. Wak Ongah: Baguslah itu. Kita mendukung. . (***)

dihimpun awak koran ini kemarin, konon katanya, ada sejumlah SPBU di Kota Tanjungbalai memprioritaskan pengisian BBM bagi pengguna jerigen, karena harga yang mereka tetapkan lebih tinggi, dari harga eceran Rp 4500

penegak hukum seperti polisi. Keresahan tersebut diungkapkan oleh Uztad Imran Bhakti Panjaitan, Sekretaris Fo„) Baca Polisi ...Hal 7

Minim Penerangan, Acces Road Tanjung Gading Rawan Kejahatan


Seniman teater sekaligus aktivis HAM ini terkenal dengan pementasan monolog Marsinah Menggugat yang pernah dicekal di zaman Orde Baru. Perempuan yang pernah mendekam di penjara karena menyerukan perubahan ini siap melakukan apapun untuk keadilan, kemanusiaan dan kebenaran. Vocal, dan berani, adalah kesan yang pertama kali tertangkap pada sosok perempuan kelahiran Tarutung, 16 Juli 1949 ini. Berkutat di organisasi sosial kemasyarakat dipilihnya demi membela nasib „) Baca Ratna ...Hal 7

PT PLN Labukan Pemadaman Bergilir

Warga Tanjungbalai Mulai Resah TANJUNGBALAI-Pemadaman bergilir yang diberlakukan PT PLN mulai membuat masyarakat merasa risau. Garagaranya, sejumlah aktivitas mereka harus terganggu, karena ketiadaan pasokan listik, yang konon diakibatkan oleh kerusakan mesin PLTU Sicanang Belawan. Di Tanjungbalai, dan sejumlah daerah sekitarnya, diperkirakan, puluah ribua lebih konsumen PT PLN juga mulai resah, dengan kebijakan PT PLN, yang melakukan pemadaman bergilir ini. Di satu sisi, bagi mereka yang tidak memiliki sumber daya listrik buatan semisal Genset, kondisi ini ten-

tunya sangat mengganggu aktivitas keseharian mereka. Pun, bagi mereka pemilik mesin genset, dipastikan, harus mengeluarkan cost lebih, untuk membeli bensin, untuk dapat mengoperasikan genset, yang kemudian akan menghasilkan energy listrik, pengganti listrik PLN yang padam. “Serba sulit memang kalau sudah listrik padam begini. Semua-semuanya terganggu,” kata Amri, seorang masyarkat di Kelurahan Sei Raja, Kecamatan Sei Tualang Raso, kemarin. Efek fatal dari pemadaman „) Baca Warga ...Hal 7

(FOTO : Eko Sirait)

TANPA PENERANGAN - Pengendara melintas di kawasan accesroad Tanjung Gading, yang minim sarana penerangan. Kondisi ini membuat, kawasan ini rawan terhadap tindak kejahatan.

„) Baca Home ...Hal 7

„) Baca Pemko ...Hal 7


Nominatif Honorer K2 Labuhanbatu Tidak Transparan RANTAU- Pemkab Labuhanbatu dituding tidak transparan dalam mengumumkan data 600 honorer kategori dua (K2) yang terdaftar dalam nominatif calon pegawai negeri sipil (CPNS) tahun 2013. Pasalnya, selain minim diumumkan di media cetak maupun elektronik, isi pengumuman tidak mencantumkan secara terperinci nama-nama 600 tenaga honorer yang terdaftar itu. “Nggak jelas pengumumannya, isinya hanya mengumumkan ada 600 orang honerer K2 yang terdaftar masuk nominatif CPNS. Tapi „) Baca Nominatif ...Hal 10


DUA KELAMIN- Islin, menggendong bayinya yang memiliki alat kelamin mirip laki-laki dan perempuan (kiri), dan bayi yang dianggap sebagai laki-laki tetapi disebut dokter sebagai perempuan (kanan).


Jenis Kelamin Anak Diragukan MENGAMUK- Nurbaiti keluar dari dalam kantor CIMB Niaga usai mengamuk.

Kijang Innova Ditarik Debt Colektor


AEK KANOPAN- Budiono (37) dan istrinya Islin (33), meragukan jenis kelamin bayinya yang lahir di Dusun Huta Baru, Desa Pulo Dogom, Kecamatan Kualuh Hulu, Labura, Senin (1/4). Pasalnya, bayi memiliki alat kelamin pria dan alat kelamin perempuan sekaligus.

Kepada METRO, Jumat (5/4), orangtua Budiono (37) dan istrinya Islin (33) mengatakan, kelahiran anaknya normal dan dibantu oleh bidan. Saat lahir, bayi yang belum diberi nama tersebut dipastikan sebagai bayi lakilaki. Namun setelah dua hari setelah lahir, pasangan suami-istri ini heran dan baru mengetahui bayi mereka membuang air kecil bukan melalui penis tetapi dari „) Baca Jenis Kelamin ...Hal 10

RANTAU- Nurbaiti Siregar (48), warga Jalan Sisingamangaraja Kecamatan Rantau Selatan mengamuk di kantor leasing CIMB Niaga di Jalan Ahmad Yani Rantauprapat, Jumat (5/4). Pasalnya, pihak perusahaan menolak menerima angsuran pembayaran mobil Kijang Innova BK 1238 JE yang tertunggak selama enam bulan. Kepada METRO, Nurbaiti mengatakan, pihak perusahaan menolak uang tunggakan angsuran yang hendak dibayarkannya selama 7 bulan. “Saya menunggak angsuran ke-14 sampai angsuran ke-21. Jumlah angsurannya setiap „) Baca Nasabah ...Hal 10

KPUD Diminta Sosialisasikan Aturan Pencalegan SIDIMPUAN- KPU Padangsidimpuan diminta pro aktif menyosialisasikan Peraturan KPU Nomor 13 tahun 2013 atas perubahan Peraturan KPU Nomor 7 tahun 2013 tentang pencalonan anggota DPR RI, DPRD provinsi dan DPRD Kabupaten/kota. Menurut Ketua Pekerja Sosial (Peksos) Tabagsel Baun Aritonang, hal itu bertujuan agar ada pemahaman dan penafsiran yang tepat khususnya bagi seluruh pihak terutama yang akan mencaleg khususnya anggota DPRD yang akan mencaleg kembali di tahun 2014 ini. Dikatakannya, dalam peraturan KPU Nomor 13 tahun 2013 atas perubahan Peraturan KPU Nomor 7 tahun 2013 tentang pencalonan anggota DPR RI, DPRD Provinsi dan DPRD Kabupaten/kota ini di pasal 19 ayat j dikatakan persyaratan caleg bagi anggota de„) Baca KPUD Diminta ...Hal 10

Premanisme harus Diberantas SIDIMPUAN- Pemerhati kepolisian Malik Assalih Harahap ST, menegaskan hukum adalah tiang utama dalam aturan penegakan masalah di Indonesia. Untuk itu, negara tidaklah boleh kalah dengan bentuk premanisme dan penyakit masyarakat. “Premanisme harus diberantas. Judi dalam bentuk apapun bentuknya harus diberantas. Sebab, judi sumber dari kejahatan selain narkoba. Untuk itu, ayo kita dukung polisi memberantas premanisme dan judi,” kata Malik, kemarin. Dikatakannya, polri sebagai yang bertugas memelihara keamanan dan ketertiban masyarakat harus berani menindak premanisme dan memang benar-benar menegakkannya. “Agar tindak kejahatan tidak terjadi, negara tidak boleh kalah dengan bentuk premanisme,” tambah Malik yang dikenal dekat dengan para petinggi polri ini. „) Baca Premanisme ...Hal 10


BATAS HGU- Ketua kelompok tani Parit Minyak Bersatu Amiruddin menjelaskan batas-batas HGU PT MJIR.

Lahan PT MJIR akan Diukur Ulang AEK KANOPAN- Pertemuan antara masyarakat yang tergabung dalam kelompok tani Parit Minyak Bersatu dengan Pemkab Labura serta pihak PT Marbau Jaya Indah Raya (MJIR) di Aula pertemuan kantor Bupati Labuhanbatu Utara, Kamis (4/4) tidak di hadiri oleh pihak PT MJIR. Namun hasil keputusan pertemuan tersebut, lahan milik PT MJIR akan diukur ulang untuk memastikan luas lahan yang dikuasai sesuai hak guna usaha (HGU). Ketua kelompok tani Parit Minyak Bersatu, Desa Aek

Korsik, Kecamatan Aek Kuo Amiruddin menjelaskan, tanah yang disengketakan dengan pihak PT MJIR berkisar 250 hektare. Tanah tersebut di luar lahan hak guna usaha milik PT MJIR yang terletak di Desa Aek Korsik Kecamatan Aek Kuo, Labura. Sebelum dirampas PT MJIR, lahan 250 hektare telah dikuasai warga kelompok tani. “Kami sangat kecewa, karena dalam pertemuan ini

SILANG- Guru mengawasi siswa yang melaksanakan UN. Tahun ini silang murni dilakukan, untuk mengawasi pelaksanaan UN.

Pengawasan UN Silang Murni SIDIMPUAN-Sistem pengawasan pelaksanaan ujian nasional (UN) untuk seluruh tingkat di Kota Padangsidimpuan (Psp) April mendatang, akan dilakukan dengan silang murni. Di satu ruangan akan ada 2 pengawas dibantu pengawas independent dari dari Medan. Medan. Hal ini dikatakan Kepala Artinya, guru pengawas Dinas Pendidikan (Kadisdik) yang akan ditempatkan untuk Kota Psp, Drs Abdul Rosad mengawasi peserta UN tahun Lubis MM. Katanya, sama 2013 ini, dipastikan tetap akan seperti tahun lalu, tahun ini mengadopsi subsidi silang juga sistem pengawasan akan murni. Guru pengawas yang dilakukan sistem subsidi ada di satu sekolah tidak akan silang murni. mengawasi sekolahnya, teta“Guru di satu sekolah tidak pi mengawasi sekolah lain. mengawasi peserta UN di Mereka akan dibantu dibantu sekolahnya, tetapi mengawasi pengawas independen bekerjasama dengan universitas „) Baca Pengawasan Hal 10


„) Baca Lahan PT MJIR ...Hal 10

Pengangkatan Pejabat Tidak Sehat RANTAU- Proses pengangkatan sejumlah pejabat di Lingkungan Pemkab Labuhanbatu dinilai tidak sehat serta tidak sesuai aturan. Kepada METRO, Jumat (5/4) Ketua Ketua Lembaga Cegah Kejahatan Indonesia LCKI Drs Parlindungan Sihotang mengatakan, setelah pihaknya menurunkan tim investigasi ditemukan bahwa pelaksanaan mutasi dan pemberhentian pejabat struktural di lingkungan Pemkab Labuhanbatu lebih berorientasi kepada kepentingan pihak-pihak tertentu, bukan atas dasar profesionalisme dan kepatutan. “Kita mendapatkan laporan investigasi dari lapangan bahwa banyak hal yang tidak sehat beroperasi di pemerintahan dokter Tigor-Suhari,” kata Parlin. Bahkan menurut dia, bukan hanya persoalan

birokrasi, tetapi juga persoalan indikasi mafia proyek yang gentayangan di bumi Ika Bina En Pabolo ini. “Indikasi-indikasi kejahatan itu, menjadi masukan yang berarti bagi LCKI, sehingga temuan tersebut akan disikapi dan ditindaklanjuti,” katanya. Ditambahkan Parlin, terkait mutasi yang dialami pejabat eselon IV Supardi Sitohang SE yang juga Ketua LCKI Labuhanbatu, sesuai pasal 14 ayat (1) huruf c Peraturan Pemerintah R.I Nomor 9 Tahun 2003 tentang wewenang pengangkatan, pemindahan dan pemberhentian Pegawai Negeri Sipil adalah kewenangan Pejabat Pembina Kepegawaian Kabupaten/Kota. Sehingga perpindahan tugas Supardi Sitohang pada antar instansi „) Baca Pengangkatan ...Hal 10

PALAS- Kejaksaan Tinggi Sumatera Utara (Kejatisu) diminta turun ke Palas, untuk mengusut dugaan penyimpangan Dana bantuan operasional sekolah (BOS) tahun anggaran 2012 dan 2013. Ada sekitar Rp6,9 miliar setiap triwulannya anggaran dana BOS untuk Palas. Kenyataannya di lapangan, banyak sekolah ditemukan kondisi ATK-nya tidak

pernah diganti, tapi setiap tahun menerima dana BOS. Permintaan ini disampaikan Aktivis Gerakan Rakyat Berjuang, karena dugaan korupsi dana BOS Palas sudah menggurita, dan sangat mudah untuk membutikannya. Aktivis Gerakan Rakyat Berjuang Mardan Hanafi Hasibuan SH kepada METRO, Jumat (5/4) mengatakan, modus yang dilakukan oknum kepala sekolah dalam dugaan penyimpangan tersebut terjadi dalam beberapa kebijakan, misalnya dalam pengadaan alat tulis kantor (ATK) dan buku sekolah. Di mana, pihak sekolah tidak mengganti buku lama, tapi dalam laporannya telah membeli buku baru. „) Baca Kejatisu ...Hal 10

Tak Enak di Entong Tapi Penuh di Kantong Maryati (bukan nama sebenarnya), memang tidak cantik, tapi duitnya beratus-ratus juta. Maka Wariyun (nama samaran), sebagai tetangga doyan saja meniduri wanita kesepian ditinggal suami jadi TKI tersebut. Prinsip pria pengangguran itu mungkin: yang penting penuh di kantong, meski tak enak di entong.

BANYAK lelaki penganut paham kebendaan. Mereka ini mencari pasangan hidup bukan berdasarkan cinta, tapi berdasarkan materi. Dianya yang ganteng kayak bintang film, mau saja kawin dengan perempuan model “mercon bantingan”, karena mengharapkan kekayaannya. Biar saja orang mengatakan sebagai “kawin harta”, toh kalau benar-benar miskin apa mereka mau menyantuni? Salahsatu lelaki model demikian adalah Wariyun (35), warga Desa Banyubang, Kecamatan Solokuro, Kabupaten Lamongan (Jatim). Sebagai lelaki pengangguran tapi punya keluarga, memang membutuhkan anggaran banyak untuk

menafkahi anak istri. Cari kerja yang pasti tak laku, padahal keluarga dan dirinya juga tak bisa makan opak angin (hawa) sepanjang hari. Maka selagi ada “terobosan” menjanjikan, harus diambil tak peduli apa resikonya. Di dekat rumahnya selang beberapa rumah, ada wanita “nganggur” karena lama ditinggal suami jadi TKI di Malaysia. Namanya Maryati (37). Meski namanya cukup bagus, jangan bayangkan wajahnya macam Sri Maryati penyiar TVRI tahun 1980 dari Utan Kayu itu. Orangnya hitam, rambut agak keriting – merah lagi– dan tubuhnya relatif pendek. „) Baca Tak Enak ...Hal 10


6 April 2013

Pengawasan UN Silang Murni Sambungan Halaman 9 di sekolah lain dan begitu juga sebaliknya. Nantinya, dalam satu ruangan akan ada 2 pengawas dibantu pengawas independen dari Medan,” ucapnya. Soal berapa jumlah pengawas yang disiapkan, masih belum ditetapkan karena masih melakukan persiapan tekhnis terutama soal bertapa sekolah yang nantinya akan digunakan untuk melaksanakan UN. Sementara nilai ratarata UN untuk tahun 2013 ini adalah 5,5 sedangkan nilai rata-rata mata pelajaran adalah 4,0, namun penentuan kelulusan adalah 40 persen nilai UAS dan 60 persen nilai UN. “Jadi,nilaiUASjugasangatmenentukankelulusan. Kitaharapkantingkatkelulusanbisasepertitahunlalu mencapai99persen.SelamamenjelangUNinikita melakukan try out dengan sekolah kemudian memerintahkan sekolah melakukan try out dan pelajarantambahan,”jelasnya. Perbedaannya dari pelaksanaan UN tahun lalu kata Rosad adalah menggunakan sistem bacode. Dimana lembar soal dan lembar ujian mempunyai kode yang sama, sehingga begitu UN selesai, keduaya bersamaan dikirim kembali ke Disdik Provsu Sumut. Selain itu, pada tahun lalu dalam satu ruangan pesertanya 20 orang, maka ada 5 paket soal ujian dengan mata pelajaran yang sama atau satu sama lain tidak sama soal ujiannya meskipun mata pelajarannya sama, maka pada tahun ini, jika satu ruangan 20 orang maka seluruhnya berbeda atau ada 20 paket soal ujian yang berbeda. “Kemudian jika pada tahun lalu tingkat kesulitannya atau soal ujian yang sangat sulit ada sekitar10persenmakapadatahunininaikmenjadi sekitar20persen.Jaditahuninibenar-benarsangat beratbagianakdidikkitapesertaUN.Kitaharapkan sekolah benar-benar mempersiapkan anak didiknya menghadapi UN ini,” katanya. Adapun mata pelajaran yang akan di UN-kan untuk tingkat SD yakni mulai tanggal 6-8 Mei untuk UN utama, yakni Bahasa Indonesia, Matematika dan IPA yang dimulai pukul 08.0010.00 WIB sedangkan UN susulan dilaksanakan pada tanggal 13-15 Mei. Adapun mata pelajaran yang akan di UN-kan untuk tingkat SMP, MTs dan SMPLB yakni mulai tanggal 22-25 April untuk UN utama, yakni Bahasa Indonesia, Bahasa Inggris, Matematika dan IPA yang dimulai pukul 07.30-09.30 WIB sedangkan UN susulan dilaksanakan pada tanggal 29 April-2 Mei. Adapun mata pelajaran yang akan di UN-kan untuk tingkat SMA dan MA, yakni mulai tanggal 15-18 April untuk UN utama, yakni Bahasa Indonesia untuk program IPA, IPS, Program bahasa dan MA program keagamaan yang dimulai pukul 07.30-09.30 WIB. Kemudian dihari kedua untuk program IPA mata pelajaran Fisika dimulai pukul 07.30-09.30 WIB dan Bahasa Inggris dimulai pukul 10.3012.30 WIB, program IPS mata pelajarannya Ekonomi dimulai pukul 07.30-09.30 WIB dan Bahasa Inggris dimulai pukul 10.30-12.30 WIB, untuk Program bahasa mata pelajarannya bahasa asing dimulai pukul 07.30-09.30 WIB dan Bahasa Inggris dimulai pukul 10.30-12.30 WIB, untuk program MA mata pelajarannya tafsir dimulai pukul 07.30-09.30 WIB dan Bahasa Inggris dimulai pukul 10.30-12.30 WIB. Dihari ketiga untuk program IPA, IPS, bahasa dan MA mata pelajarannya Matematika dimulai pukul 07.30-09.30 WIB. Sedangkan dihari terakhir untuk program IPA mata pelajaran Kimia dimulai pukul 07.30-09.30 WIB dan Biologi dimulai pukul 10.30-12.30 WIB, program IPS mata pelajarannya Sosiologi dimulai pukul 07.30-09.30 WIB dan Geografi dimulai pukul 10.30-12.30 WIB. Untuk Program bahasa mata pelajarannya Antropologi dimulai pukul 07.30-09.30 WIB dan Sastra Indonesia dimulai pukul 10.30-12.30 WIB, untuk program MA mata pelajarannya Fikih dimulai pukul 07.30-09.30 WIB dan Hadis dimulai pukul 10.30-12.30 WIB. Sedangkan untuk UN susulan dilaksanakan mulai tanggal 22-25 April. Selanjutnya untuk tingkat SMK, adapun mata pelajaran yang akan di UN-kan mulai tanggal 1517 April untuk UN utama mata pelajarannya Bahasa Indonesia, Bahasa Inggris dan Matematika yang dimulai pukul 07.30-09.30 WIB, kemudian UN susulan dilaksanakan pada tanggal 22-24 April. (phn/mer)

Jenis Kelamin Anak Diragukan Sambungan Halaman 9 sebuah lubang yang berada di bawah penis milik bayi. “Kami heran dan kemudian membawanya ke dokter sepesialis anak, dan dokter mengatakan anak kami perempuan

bukan laki-laki,” kata Budiono. Dijelaskan pria yang sehari-hari bekerja sebagai pandai besi ini, dokter spesialis anak dr H Charles Siregar SpA di Aek Kanopan menyarankan agar membawa bayi ke RSUD Labura. Pihaknya kemudian membawa ke RS

Labura, tetapi oleh pihak rumah sakit malah disarankan membawa ke rumah sakit yang lebih lengkap peralatannya, karena di RS Labura kelainan bayinya tidak dapat ditangani. “Kami bingung, jika bayi ini harus dioperasi.

Nominatif Honorer K2 Labuhanbatu Tidak Transparan Sambungan Halaman 9 tidak mencantumkan nama-nama ke-600 honorer itu,” ujar Muktar Efendi (29), warga Kelurahan Perdamean Sigambal, Jumat (5/4). Menurutnya, pengumuman yang dibuat Pemkab Labuhanbatu sangat tidak sesuai dengan Surat MenPAN-RB Nomor B/751/M.PAN-RB/03/2013 tanggal 18 Maret 2013 peri-

hal Penyampaian Data Tenaga Honorer K2 Kepada PPK Pusat dan Daerah. “Dalam surat edaran itu mengharuskan semua pejabat pembina kepegawaian, baik di pusat maupun daerah wajib mempublikasikan secara lengkap data honorer kategori II melalui media cetak selama 21 hari kerja setelah menerima daftar dari BKN,” kata Muktar Efendi. Dijelaskan Muktar, bentuk pengumumam

yang dibuat Pemkab Labuhanbatu hanya akal-akalan untuk mengelabui publik, agar tidak dapat mengontrol adanya unsur-unsur manipulasi data honorer K2 yang terdaftar dalam nominatif CPNS tahun 2013. Sementara Kepala BKD Labuhanabtu Aswad Siregar, Jumat (5/4) belum berhasil dikonfirmasi wartawan terkait tidak transparannya pengumuman nominatif honorer kategori dua. (CR-01)

Nasabah CIMB Niaga Mangamuk Sambungan Halaman 9 bulan sebesar Rp3.740.000 selama 4 tahun. Jadi saya mau membayar tujuh bulan angsuran yang tertunggak. Namun pihak perusahaan tidak mau menerimanya. Dengan alasan harus dibayar lunas. Inikan tidak sesuai lagi dengan kontrak. Makanya saya mengamuk,” katanya. Dijelaskan Nurbaiti, mobil Kijang Innova miliknya telah diambil paksa oleh debt collector pada hari Minggu (31/3) lalu. “Minggu semalam mobil ku itu diambil paksa oleh debt collector. Anehnya, debt col-

lector tersebut ditemani salah seorang oknum Brimob dengan menggunakan laras panjang. Bahkan, Brimob itu menakuti kami dengan mengatakan kami melakukan penggelapan mobil. Karena saya takut, mobil itu saya serahkan. Kata debt collector itu, jika mau menebus mobil itu, harus dibayar semua angsuran yang tertunggak. Namun, saat saya mau membayar mereka tak mau menerimanya. Tadi saya sempat mengamuk. Baru lah mereka mau menyelesaikan masalah ini Senin depan. Mudah-mudahanlah mobilku itu bisa keluar,” kata Nurbaiti.

Terpisah, Manager CIMB Niaga melalui admin penarikan Ilham Nainggolan mengatakan mobil Kijang Innova tersebut sudah kategori WO, sehingga pihak perusahaan melakukan penarikan. “Mobil itu sudah tertunggak selama 6 bulan. Dan saat ini mobil itu kategori WO, dan harus ditarik. Nah, jika pihak konsumen mau membayar tunggakan tersebut maka kami akan mengembalikannya. Tapi, hari ini kami tidak bisa menerima angsuran itu, karena pimpinan lagi keluar kota. Jadi, hari Senin masalah ini akan diselesaikan,” kata Ilham. (CR-02)

KPUD Diminta Sosialisasikan Aturan Pencalegan Sambungan Halaman 9 wan yang pindah parpol harus dilengkapi surat pernyataan pengunduran diri dari dewan dan surat keputusan pemberhentian sebagao anggota dewan. Kemudian masih pasal 19 ayat k dikatakan apabila surat pemberhentian masih dalam proses, maka batas waktu penyerahan paling lama adalah saat masa perbaikan Daftar Caleg Sementara (DCS). “Jadi surat pemberhentian itu adalah SK Gubsu, artinya PAW terjadi sebelum DCS diumumkan. Maka kalau yang bersangkutan tidak dapat SK pemberhentian dari Gubsu maka tidak bisa tampil di DCS atau batal jadi caleg. Ini terkhusus bagi anggota dewan yang partainya tidak lolos menjadi peserta pemilu, tapi ingin menjadi caleg dari partai lain,” jelasnya. Untuk itu, Baun meminta dengan tegas kepada KPU, Panwas, DPRD dan Walikota Psp harus tegas dan jangan ada permainan, karena aturannya tegas. “Terkhusus bagi KPU untuk aktif

mensosialisasikan ini,” katanya. Sementara itu, menurut jadwal, pada 9-22 April 2013 adalah waktu penyerahan DCS ke KPU. Untuk Kota Psp, akan banyak anggota dewan asal partai yang tidak masuk peserta pemilu 2014 yang harus mundur dari jabatan sebagai anggota DPRD,jikamasihinginmajumenggunakanpartai politik lain yang masuk dalam 12 partai peserta Pemilu 2014. Adapun anggota DPRD Psp yang partainya tidak lolos di pemilu 2014 ini antara lain, Sopian Harahap dari Partai Republikan, Soritaon Siregar dari PSI, Siti Hawani Harahap dari PKPB, Ashari Harahap dari PDP, Hamdani Nasution dari PBR, Marataman Siregar dari Buruh, Indar Sakti Tanjung dari PKNU, Mahmuddin Nasution dari Merdeka, Frans Mico Copian Lubis dari PDS dan Samiun Siregar dari Patriot. Berdasarkan keputusan KPU Pusat, sebanyak 11 partai lolos verifikasi menjadi peserta Pemilu Legislatif 2014. Partai tersebut adalah Partai Amanat Nasional (PAN), Partai Demokrasi Indo-

nesia Perjuangan (PDIP), Partai Demokrat, Partai Gerakan Indonesia Raya (Gerindra), Partai Gololongan Karya (Golkar), Hati Nurani Rakyat (Hanura), Partai Keadilan Sejahtera (PKS), Partai Kebangkitan Bangsa (PKB), Partai Nasional Demokrat (Nasdem), Partai Persatuan Pembangunan (PPP), Partai Bulan Bintang (PBB) dan PKPI. Sementara Ketua KPU Kota Psp Muzakkir Khotib Siregar mengatakan, sosialisasi aturan pencalegan telah mereka sampaikan kepada partai-partai politik yang akan mengikuti Pemilu Legislatif 2014 mendatang. Pemberitahuan tertulis tentang aturan pencalegan juga telah diantar langsung ke sekretariat atau pimpinan partai yang akan ikut Pemilu 2014. “Sebenarnya, aturan-aturan pencalegan sudah kita sosialisasikan ke partai politik. Kalau Peraturan KPU Nomor13 tahun 2013 itu baru kami terima, kemarin. Inilah mau kami sosialisasikan lagi ke partai-partai,” jelasnya. (phn)

Premanisme harus Diberantas Sambungan Halaman 9 Ia juga mendukung sepenuhnya komitmen Kapolres Psp AKBP Budi Hariyanto SIk Msi untuk menyikathabissegalabentukperjudian,pekatdan juga premanisme di Kota Psp. Menurutnya, pemberantasan judi, pekat dan premanisme merupakan atensi dari Kapolri Jenderal Pol Timur Pradopo dan Kapoldasu Irjen Pol Drs Wisjnu Amat Sastro SH. “Jadi apa yang dilakukan Kapolres Psp sudah merupakan

tindakan yang tepat. Kita apresiasi langkah dan tindakan Kapolres yang tidak kenal kompromi dengan tindakan perjudian, pekat dan premanisme di Kota Psp,” ujarnya. Kemudian, sambung Malik, untuk masalah razia pekat yang dilakukan Polres Psp sudah merupakan langkah yang tepat dan patut didukung semua pihak di Kota Psp. “Karena Kota Psp selama ini dikenal sebagai kota religius yang selamainikitakenalmasyarakatnyataatberibadah. Walaupun ini sebenarnya sudah menjadi tugas

polri,tapiapresiasiyangsetinggi-tinginyapatutkita acungkan terhadap Kapolres Psp,” jelasnya. “Kitasangatmendukungsecaramoralgebrakan itu. Siapapun yang membackingi tempat-tempat maksiat harus disikat habis, siapapun dia tanpa terkecuali.KitameyakiniKapolresPspberkomitmen untuk menuntaskan persoalan yang menjadi perhatian publik atau kasus yang meresahkan masyarakat di Psp. Kita memberikan dukungan moraluntukmenyikathabispraktikjudi,pekat,dan premanismediKotaPsp,”tambahnya.(phn)

Lahan PT MJIR akan Diukur Ulang pihak PT MJIR tidak hadir,” kata Amiruddin. Sementara Asisten I Sekadakab Labura Habibuddin mengatakan, pihaknya setuju jika dilakukan pengukuran ulang lahan yang dikuasai PT MJIR. Untuk menuntaskan masalah sengketa kelompok tani dan pihak perusahaan, akan dibentuk Tim Sengketa Tanah dengan surat keputusan Bupati Labura. “Jika dalam pengukuran tersebut ada yang berlebih dari HGU maka lebih tanah tersebut

yang di luar HGU akan kembali kepada Negara,” kata Habib. Hal senada disampaikan perwakilan Badan Pertanahan Nasional (BPN) Labuhanbatu S Pandia. Bagian sengketa di BPN Labuhanbatu ini mengaku siap untuk mengukur lahan milik PT MJIR. Kapolsek Aek Natas AKP Heri Sugiarto SH yang turut hadir mengatakan pihaknya telah berusaha mendatangkan pihak PT MJIR, namun pihak perusahaan tidak mau datang. “Kita tetap mengimbau seluruh pihak yang

bersengketa untuk mematuhi hukum,” kata Heri. Pada akhir pertemuan Asisten I Sekadakab Labura Habibuddin membacakan kesimpulan hasil pertemuan mediasi. Dalam kesimpulan, PT MJIR tidak beritikad baik untuk menyelesaikan sengketa tanah dan beberapa kali di undang di fasilitasi pihak PT MJIR tidak hadir. S epakat untuk dilakukan pemeriksaan batas -batas HGU PT MJIR agar permasalahan sengketa dapat diselesaikan, dan tim sengketa tanah Pemkab Labura akan merekomendasikan ke Bupati agar melibatkan pejabat yang berwenang. (st)

Pengangkatan Pejabat Tidak Sehat di lingkungan Pemerintah Kabupaten Labuhanbatu itu adalah kewenangan penuh atau hak prerogatif Bupati Labuhanbatu dr H Tigor Panusunan Siregar, SpPD. Namun,jelasParlin,dalampelaksanaanpengangkatan, pemindahan dan pemberhentian Pegawai Negeri Sipil dalam jabatan struktural tertentu, Tim Baperjakat (Badan Pertimbangan Jabatan dan Kepangkatan) yang diangkat dan ditetapkan Bupati Labuhanbatu1kalidalam3Tahun,wajibmematuhi Undang-undang Nomor 32 Tahun 2004 tentang Pemerintahan Daerah, Peraturan Pemerintah Nomor 100 Tahun 2000 tentang

Pengangkatan Pegawai Negeri Sipil Dalam Jahatan Struktural, Peraturan Pemerintah Nomor 13 Tahun 2002 tentang Perubahan Peraturan Pemerintah Nomor 100 Tahun 2000, Keputusan Kepala Badan Kepegawaian NegaraNomor13Tahun2002tanggal17Juni2002 tentang Ketentuan Pelaksanaan Peraturan Pemerintah Nomor 100 Tahun 2000 Tentang Pegawai Negeri Sipil Dalam Jabatan Struktural sebagaimana telah diubah dengan Peraturan Pemerintah Nomor 13 Tahun 2000 serta Surat Edaran Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi RI Nomor 16 Tahun 2012 tentang Tata Cara Pengisian Jabatan Struktural yang lowong secara terbuka di lingkungan instansi pemerintah.

Kami tidak punya biaya, biarlah sudag dari Tuhan seperti ini,” kata Budiono, pasrah. Terpisah, dr H Charles Siregar SpA mengaku bayi anak Budiono berjenis kelamin perempuan, tetapi memiliki kelainan kelamin karena kelebihan hormon. (st)


Kepala BKD Mangkir MADINA- Komisi 1 DPRD Kabupaten Mandailing Natal (Madina) akan memanggil kembali Badan Kepegawaian Daerah (BKD) Madina untuk dimintai keterangan seputar data honor kategori II (K-II). Alasan pemanggilan, agenda rapat kerja pada hari Kamis (4/4) kemarin ditunda, karena tidak dihadiri Kepala BKD Madina Syahdan Lubis AP. “Kita sudah jadwalkan hari Kamis kemarin, namun yang hadir hanya staf BKD saja. Kita menginginkan keterangan dari Kepala BKD, dan informasi dari stafnya diketahui kepala BKD lagi di luar kota. Untuk itulah, kita akan memanggil kembali Kepala BKD pada Selasa (9/4) mendatang,” ucap Ketua Komisi 1 DPRD Madina Abdul Kholil, Jumat (5/4). Dia juga menjelaskan pihaknya ingin mengetahui berapa jumlah honor K.II di lingkungan Pemkab Madina yang diumumkan olehBKN,danapakahsudahdisampaikankepada masyarakat khusus bagi tenaga honor itu sendiri. “Dan sampai sekarang kami belum tahu pasti mengenaidataitu,kamitidakinginadapermainan dan persoalan dalam hal honor K.II ini, dan akan memantau maksimal di lapangan,” tambahnya. Untuk itulah, Kholil juga berharap BKD mengumumkan data honor K-II itu secara transparan supaya masyarakat luas tahu itu. Seperti diberitakan sebelumnya, Ketua Pekerja Sosial Masyarakat (PSM) Kabupaten Madina Ahmad Suheri Nasution Ssos menyebutkan, pengumuman honor K-II ini harus disampaikan secara transparan dan terbuka untuk seluruh masyarakatluas,agartidakadadugaanpermainan di dalamnya, sebab Suheri khawatir akan terjadi manipulasi data jika tidak diumumkan dengan transparan. Begitu juga disampaikan Ketua DPC Perhimpunan Advokat Indonesia Padang sidempuan mewilayahiTabagsel, H Ridwan Rangkuti SH MH. “Demi terwujudnya pemerintahan yang bersih dan transparan, khususnya mengenai data tenaga Honorer K-II ini, saya minta kepada Kepala BKD Madina dan BKD se Tabagsel agar mengumumkan nama-nama tenaga Honorer K-II melalui media cetak lokal. Bukan hanya ditempel di papan pengumuman saja,” sebutnya. (wan/mer)

Kejatisu Diminta Turun Sambungan Halaman 9 Kecurigaan lainnya, penyaluran dana BOS yang tidak sesuai Petunjuk Teknis (Juknis) pelaksanaannya di lapangan, sehingga perlu dievaluasi dan dilakukan pengawasan di lapangan.“PihakpengeloladanaBOSjanganasal mencairkan saja, tapi juga melakukan monitoring dengan baik di lapangan,” tegas Mardan. Katanya, selain indikasi korupsi, mark up dana BOS juga diduga terjadi pada jumlah siswa penerima BOS, baik tingkat SD dan SMP. Karena data-datanya disinyalir tidak akurat. Pasalnya, pada tahun anggaran sebelumnya, jumlah siswa penerima dana BOS-nya tidak jauh berbeda. Karena dugaan-dugaan tersebut, Mardan Hanafi meminta aparat penegak hukum dari Kajatisu dan aparat hukum di Palas untuk aktif mengawasi penyaluran dana BOS. Apalagi program pendidikan secara nasional sudah gratis, namun masih tetap saja dilakukan pungutan liar oleh sekolah. Bahkan, ada dalihnya untuk biaya ATK, padahal dana BOS ada. “Kejatisu harus turun, sebab kinerja kejaksaan di wilayah Kabupaten Palas, sepertinya mandul dalam mengusut penyimpangan dana BOS di Palas. Padahal permainan ini ang sudah lama terjadi,” terangnya. PenggiatPendidikanPalasAlekSabarNasution SPd juga menyetujui agar Kajatisu sejatinya harus jemput bola, bukan menunggu delik aduan. “Kejaksaan harus mengusutnya, karena sangat membahaykan pendidikan di Palas,” ucapnya. Dimanasesuaidatayangdimilikipihaknya,untukTA 2012 data penerima dana BOS, jumlah siswa SD penerimadanaBOSsebanyak37.311siswa,dimana setiapsiswamendapatRp145.000setiaptriwulannya. Kemudian, untuk SMP jumlahnya 6.387 siswa, dengandanasetiapsiswaRp177.500pertriwulan. Sekretaris Dinas Pendidikan Palas Aslamiah Harahap saat dikonfirmasi mengenai terkait masalah dugaan penyimpangan Dana BOS Kabupaten Palas untuk TA 2012 dan TA 2013, tidak memberikan jawaban. “Nanti saya akan evaluasi ya, karena ada yang membidangi masalah BOS,” katanya singkat. (amr/mer)

Tak Enak di Entong Tapi Penuh di Kantong Sambungan Halaman 9 Jika ada nilai plus, bodinya memang lumayan sekel nan cemekel. Tapi biar jelek, duitnya banyak dia. Tiap bulan Hardo (nama samaran), suaminya yang jadi operator alat-alat berat di Negeri Jiran, kirim duit puluhan juta. Maka tak mengherankan rumah Maryati paling bagus dari tetangga yang lain. Selain gede, berkeliling pakai kaca, sehingga di dalam rumah istri Hardo ini macam kembang gulo dalam lodong (stoples). Meski bergelimang harta, sebagai wanita yang masih muda dan enerjik, sangat kesepian Maryati ini. Habis tiap malam hanya tidur sendirian. Maka diam-diam dia memberi perhatian khusus pada Wariyun

tetangganya ini. Eh, siapa tahu dia bisa memberikan “solusi” sementara. Ternyata harapannya tak sia-sia, karena lelaki tetangga ini memberi respon juga. Padahal motif Wariyun bukan sekadar pemenuhan rasa sepi. Ajakan mesum selalu diladeni, meski ibarat kata Wariyun harus menutup muka Maryati dengan kalender bergambar Ashanti atau Syahrini. Sebab pertimbangan politiknya, dengan pelayanan entong dia bisa membobol isi kantong. Dan ternyata benar. Karena dapat pelayanan istimewa, kiriman uang dari Malaysia yang selalu datang mengucur, Wariyunlah yang mengurusnya, sampai jumlahnya Rp650 juta. Ngakunya disimpan di bank, padahal resminya sebagian besar dikantongi

sendiri. “Masak KPK akan ngurus korupsi beginian,” kata Wariyun. Skandal Maryati baru terungkap saat suami pulang. Uang yang dikirimkan selama ini ternyata nyaris tak bersisa. Kata para tetangga buat foya-foya bersama tetangganya Wariyun. Tapi celakanya, jangankan lelaki itu mengakui perselingkuhannya, sedangkan uang yang Rp650 juta itu mengaku sudah habis. Untuk menguji kebenaran dan kejujuran “perampok” berdarah dingin ini, Hardo (40) sampai menantang Wariyun sumpah pocong. Ngakunya sih siap, tapi ketika sudah disiapkan properti, justru Wariyun tak menampakkan batang hidungnya. Terpaksa dia dilaporkan ke polisi. Enak Wariyun, sudah berhasil cuci uang, dapat cuci mata pula. (int)


6 April 2013

Korban Salah Tangkap HIDUP 42 TAHUN DALAM PENJARA ARIZONA – Pria di Negara Bagian Arizona, Amerika Serikat (AS) akhirnya menghirup udara bebas setelah dipenjara selama 42 tahun. Louis Taylor dilepaskan setelah pengadilan menyatakan tidak ada bukti cukup yang menunjukkan dia bersalah. Taylor ditahan polisi pada tahun 1970 silam saat dia masih berusia 16 tahun. Dia dituduh menjadi dalang peristiwa kebakaran Hotel

Pioneer yang menewaskan 28 orang. Taylor diberikan dua pilihan oleh pengadilan. Menerima putusan itu dan

„ Louis Taylor

bebas secepatnya atau menjalani proses persidangan selama dua tahun lagi agar dapat membersihkan namanya. Taylor merasa masa hidupnya di dalam penjara sudah terlalu lama dan memutuskan untuk tidak meneruskan kasus tersebut. Taylor menyebut hakim

yang mengadilinya 42 tahun silam menjalankan persidangan dengan tidak adil. Saat itu sang hakim memutuskan dia bersalah walaupun tidak memiliki bukti yang cukup. “Ada dua tragedi dalam hidup saya, peristiwa kebakaran itu dan masa hukuman yang saya terima,” ujar Taylor. (oz/nik)


EKSPRESI UNIK-Foto wajah manusia dengan ekspresi unik bagian tubuh yang dipotong dari majalah fashion.

ajah Anda Wuih, Ada Tarantula Sebesar WWajah SRILANKA - Kebanyakan orang pasti akan merasa takut melihat laba-laba. Yang kecil saja bisa membuat bergidik, apalagi yang besar. Kini telah ditemukan spesies laba-laba baru berjenis tarantula sebesar wajah Anda. Wow! Tarantula tersebut ditemukan penduduk desa di Srilanka. Sebelumnya pada 2009, warga sempat membawa laba-laba itu kepada ahlinya setelah membunuh spesies reptil berbahaya tersebut. Para ilmuwan menduga laba-laba jenis arachnid ini adalah spesies yang tidak pernah ditemukan sebelumnya. Tetapi kini para ahli, mengonfirmasikan jika masih ada turunan laba-laba tersebut, Jumat (5/4). ”Kami mencari di setiap

lubang pohon dan batang kulit pohon, ini juga untuk kepuasan pencarian kami juga,” tutur sang peneliti Ranil Nanayakkara. Tarantula itu, menjadi

bagian dari gen laba-laba harimau, mempunyai tanda khusus termasuk dafodil yang memiliki warna kuning di kakinya dan berwarna pink di bagian perutnya.

Berdasarkan penelitian dari Biodiversity Education and Research Organization Srilanka, reptil ini ditemukan hidup di sekitar rumah sakit di daerah Mankulam. Mereka

PROMO IKLAN JITU JITU 2013 2013 Pasang Iklan Baris, GRATIS berlangganan koran 1 bulan SUPRA X 125 NEW R Th 10-12: lelang 1 ANlelang utk umum hrg 4 jtan tempat: halaman rumah, Jl.jend.A.Yani (dpn makam pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) BEAT TH 11- 12 : Lelang 1 An-lelang Utk Umumhrg 4jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) AB.VARIO TECHNO TH 12: Lelang 1 An-lelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang) SCOOPY TH 11-12 : Lelang 1 An-lelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.jend.a. Yani(dpn Makam Pahlawan)-R.Prapat . Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) AB. REVO/BLADE TH 08-11 : Lelang 1 Anlelang Utk Umum-hrg 3jtan--tempat: Halaman Rumah, Jl. Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang)

YAMAHA BYSON TH11-12: lelang 1 an-lelang utk umumhrg 10 jtan. tempat di Halaman rumah, Jl.Jend. A.Yani (dpn makam pahlawan) Rantauprapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (alto lelang) XEON--TH 11-12 : Lelang 1 An-lelang Utk Umumhrg 3jtan. tempat di Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 85380613, 087807037277 (Alto Lelang) MIO SOUL TH 09-12: Lelang 1 An-lelang Utk Umum-hrg 3jtan-di Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) JUPITER MX NEW TH 11-12 : Lelang 1 Anlelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391,0852 8538 0613 (Alto Lelang) MIO TH 09-12 : Lelang 1 An-lelang Utk Umumhrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub :0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) JUPITER Z NEW TH 10-12 : Lelang 1 An-lelang Utk Umum-hrg 4jtan--tempat: Halaman Rumah, Jl. Jend. A.Yani (dpn Makam Pahlawan) R.Prapat. Hub : 0812 6323 8391, 0852 8538 0613 (Alto Lelang) VEGA ZR TH 09-12 : Lelang 1 An-lelang Utk Umum-hrg 2jtan--tempat: Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang)

SUZUKI TITAN TH 10: Lelang 1 An-lelang Utk Umum-hrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A. Yani(dpn Makam Pahlawan)-R. Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang)

MOBIL & MOTOR LELANG 250 MOTOR & 15 UNIT MOBlL Harga Limit 2 Jt S/D 7 Jtan Th 08-12. Lelang Satuan, Terbuka Untuk Umum, Berbagai Merek & Tipe, Cek Fisik Tgl 13 S/D 17 Desember 2012. Lelang 18 Desember 2012 Pukul 13 ; 00 Tempat: Dpn Makam Pahlawan,Jl.Jend.A.Yani-Rantau Prapat. Hub: 0812 6323 8391, 0852 8538 0613, O878 0703 7177 (alto Lelang)


-Ertiga DP. 25Jt-an Ang. 5Jt-an -APV Arena DP. 19Jt-an Ang. 3Jt-an -Carry PickUp DP. 18Jt-an Ang. 2Jt-an -Mega Carry DP. 19Jt-an Ang. 3Jt-an -Swift ST DP. 36Jt-an Ang. 4Jt-an -Splash DP. 46Jt-an Ang. 3,6Jt-an Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028 MITSUBITSHI READY STOCK: Pajero sport, Outlander sport,Mirage, strada triton, Lancer,(chasis, box, tangki, bus, dump truck colt diesel & fuso, pick up & min bus L300 & T120ss), Bunga Angsuran mulai dari 0%. Hub : BAYU 0852 7696 8284


• Pick Up Dp. 25% angsuran 2 Jtan • Xenia Dp. 25% angsuran 3 Jtan • Terios Dp. 25% angsuran 3 Jtan • Luxio Dp. 25% angsuran 3 Jtan • Sirion Dp. 25% angsuran 3 Jtan HUB: DTM MHD ISA, 0823 6408 5006


Promo Akhir Tahun • Daihatsu Paket Ringan

• Gran Max Pick Up Dp. 11Jtan angs 2Jtan • Xenia Dp. 27Jtan angs 3Jtan • Terios Dp. 24Jtan angs 4Jtan Proses cepat, pasti oke+hadiah menarik Rudi Astra, 0813 9611 6389 NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739 HONDA 100% BARU • All new CRV • New JAZZ • New BRIO • New FREED Ready stock. Cash / credit. Dp. Rendah + hadiah + discount Hub: Aldy – 0853 7131 6440 Cab : Rantau prapat DAIHATSU BARU : Ready stock semua type dgn Dp. 20Jtan (Xenia) Dp. 22Jtan (Terios) Dp. 13Jtan (Pick Up/Minibus) Pesan sekarang juga, data dijemput dan proses leasing dibantu. Sariaman Marpaung, HP. 0852 7023 1310, Pin BB 297B2A40.

PROMO AWAL TAHUN CAPELLA DAIHATSU RANTAUPRAPAT XENIA DP 27 jt Ang. 2jt an Terios DP 35 jt Ang. 3jt an Pick up DP 12 jt Ang. 2jt an Grand max mini Bus DP 20 jt Ang. 2jt an PROSES CEPAT DATA SIAP DI JEMPUT Hub : SYAHRINAL SIREGAR HP 0812 6547 1399


• Pick Up Dp. 25% angsuran 2 Jtan • Xenia Dp. 25% angsuran 3 Jtan • Terios Dp. 25% angsuran 3 Jtan • Luxio Dp. 25% angsuran 3 Jtan • Sirion Dp. 25% angsuran 3 Jtan Hub: ZUL CAPELLA, 0823 6253 2633 MITSUBISHI BARU “PT. Sumatera Berlian Motors” Tersedia : • Fuso • Colt Diesel Canter • L300 Pick Up / Minibus • Mirage & Outlander Proses cepat & data dijemput. Hub: OLOAN SIMARMATA; HP. 081 26 558 178 MITSUBISHI MOTORS Promo 2013: Fuso & Colt Diesel ( Bus, Tangki, Box, Dump Truck, Dll) Colt L300 & Colt T 120ss (Pick Up, Bus, Box, Dll) L200 Strada Triton, Pajero Sport, Out Lander Sport, Mirage, Lancer. Hub: Doni: 0813 6224 2904 / 0852 6130 5040. MITSUBISHI BARU Dealer Resmi di Medan; Tersedia : • L300 PU / Minibus • Colt Diesel, 110 HD, 125 HD • Colt Diesel, 136 HD, HDL • Fuso, T120SS • Pajero Sport/Dakar • Outlander Sport dan Mirage Semua ready stock! Hub: SIMARMATA, 0812 6484 8168 DIJUAL: Sedan Hundai Avega tahun 2008. Warna coklat Metalik surat lengkap Pajak hidup harga 100 juta. Hub 0857 6213 3722 - 0623 94759 Ibu Aisyah Jl. MT HARYONO OVER KREDIT / DI JUAL : COLT DIESEL CANTER HD 125 PS, thn 2008 bak kayu warna kuning, PLAT HITAM, BK RANTAUPRAPAT. Kondisi 90% mulus. Balik DP 40jt. Angsuran 6,5jt per bulan, sudah jalan 4 bulan, Selama 3 tahun. Boleh juga di beli kontan. Hub pemilik langsung : EDO – 0812 6560 9737. RANTAU PRAPAT.

MITSUBISHI SUPER HEMAT Ready stock : - Colt diesel - L300 pu & T120ss - Fuso - L200 Triton - Pajero Sport - Outlander - Mirage DP RENDAH – ANGSURAN TERJANGKAU, BUNGA MULAI 0% Hub : ARIE – 0813 6207 1094; 0853 7216 1877 YAMAHA HORAS MOTOR, Jual sepeda motor Yamaha, cash& credit terbaru, dapatkan Helm LOVENZO Cuma-cuma dengan pembelian new zupiter Z1 (kesempatan terbatas). Dialer Telp:0622-31883. Jl. Jend. Sudirman Kota Indrapura, B.Bara. CV PARNA JAYA MOTOR: Jual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN.•Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung.

NAGA MAS MOTOR: Services - Ganti Oli - Spare Parts - Accessoris. Jl. Teuku Umar Ujung, Tj.Balai. Hub: AKIET - 0852 7668 8988 DIJUAL: Bahan & Peralatan Chrom yang masih berjalan diberikan pelatihan & alamat Suplier bahan baku, Peminat serius Hub:061-7870503 (Jam Kerja) "CV. ANUGRAH JAYA" Kontraktor, Lepelansir, Biro Jasa, Dagang umum, Pertanian, Sedia&Jual barang-barang serta peralatan bangunan,dll. Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram,Batubara. hub:Ibu Ani-0853 6067 1005 UD. ABANG ADIK: Menerima Tempahan Kosen, Pintu, Jendela dan Menjual segala ukuran jenis Kayu. Jl. Dr. Hamka ( RSU ) R.Prapat. Hub: 0813 6159 0689 TOKO PRABOT HJ. MARIAM jual berbagai prabot rumah tangga, lemari, kursi, tempat tidur, terbaru dan lengkap. Furniture harga Famili, barang istimewa dan memuaskan. Simpang gallon Jl. Access Road INALUM, Kuala tanjung, HP: 0823 6986 5100 “TOKO TUNAS BARU”. Menjual kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, B.Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agam, HP : 0812 6474 707 AIR MINUM KESEHATAN & KEBUGARAN” Air super alkali pertama di Indonesia”.Membantu proses penyembuhan berbagai macam penyakit:kolestrol,asam urat,susah BAB, asma, diabetes, panas dalam, hipertensi, maag, sakit kepala, sakit otot, sendi,dsb. An. Bapak Kodimin HP 0813 6113 2128 “RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batubara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166. “UD MANDIRI”: Jual segala Sparepart sepeda motor & menerima boring, pasang botol,siting klep, pasang sokar, jual accessories & sepeda anak-anak, menjual secara Grosir & eceran. Access Road Kuala Tanjung, Hub: UDIN - 0813 7024 4402.

UD. JANNAH: Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, HARGA GROSIR. Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, B.Bara. HP: 0852 7680 942 UD ISKANDAR Jual barang & alat-alat bangunan, kontraktor, levelansir. Harga standar & terjangkau, dll. Jl. Masjid Lama No. 41 Talawi B.Bara. Hub. Hj Ani - 0852 7508 7880 UD IRFAN JAYA Panglong Jual segala jenis papan(papan Boat/Sampan) & alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya. Dusun II Jl. Merdeka Tanjung Tiram B.Bara. Hub: Bpk Irfan, HP : 0812 6456 2615 PENGEN PUNYA SEPEDA MOTOR BARU?? Datang aja ke PT. CAKRA ADI DHARMA Jl. A.YANI RANTAU PRAPAT. atau hub: DARMA 0823 6430 3119; 0831 9372 2227 DP ringan – angsuran murah, proses cepat, data siap di jemput.

PARIS – Salah satu karya seni yang aneh muncul di Paris, Perancis. Karya seni ini dibuat dengan menggabungkan wajah seseorang dengan bagian tubuh manusia yang diambil dari majalah untuk membuat ekspresi wajah yang aneh. Seniman Bruno Metra dan Laurence Jeanson membuat seni ekspresi wajah dengan menggunakan foto bagian tubuh yang dipotong dari majalah fashion. Kedua seniman Perancis ini membuat proyek unik yang disebut ID, dimana mereka menunjukkan gambaran keindahan yang tidak alami, seperti seseorang yang menjalani operasi plastik.

dinamakan Poecilotheria, sebagai lambang kehormatan terhadap inspektur polisi Michael Rajakumar Purajah, yang memimpin penelitian tersebut. (oz/nik)

Hanya ulan b Rp 60.000,-/

kirim langsung data anda ke:


Foto Unik dari Potongan Tubuh Tampil Majalah

“CAHAYA PRABOT” cash & credit, berbagai macam prabot, rak tv, meja makan, sofa, springbed, meja belajar, elektronik, kulkas, mesin cuci, TV, LCD, DVD, kompor gas, dll. Kunjungi: Jl. Access road inalum, desa pakam raya no.20 (depan pajak sore). (0622) 31326/3327. “DINDA Keyboard” Entertainment Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, B.Bara Toko Batik NUR’ ALFI: Jual batik pekalongan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, B. Bara. Hub: Rosini - 0812 6002 9388 CV PARNA JAYA MOTORS: Jual beli mobil baru dan bekas, melayani tukar tambah Cash & Kredit, menerima leasing BPKB Mobil, Toyota, Mitsubishi, Suzuki, Honda, Daihatsu, Isuzu, Desa tanah rendah, Indrapura. Telp. 0622 646378 PERCETAKAN & ADVERTISING BIMA: Terima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288 Indrapura B. Bara

“BOMBAY SPORT”: Jual alat2 Olahraga sport, sepatu futsal/bola, kaos, baju , sandal, tas , asesori sport, dll. Barang bagus-Harga Memuaskan. HUB: M Yusuf, SE - HP: 0813 7635 8395 0812 9436 3434. Jl. Jend. Sudirman, Indrapura (depan UGD) TOKO CANTIKA COLLECTION :Jual jilbab, busana muslim, pakaian pria & wanita, serta perlengkapan baby, accesoris jilbab, mukenah,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No. 40 (Depan Pajak Tanjung Tiram) B.Bara. Hub:Jonni Hendra, SPd. - 0823 6269 4535

”PIONER GYFSUM”: Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani / Psr. Mereng Simp. 4 Talawi - Batu Bara. DIKA GORDYN Menerima Segala Jenis Tempahan Gordyn, Kebaya, Seragam; menerima Bordir. Terima Anak Kustum (Wanita). Hub: Ibu Indah 0821 6432 2396, di Jl. Kopertis Lingkungan 7 Indrapura B.Bara. HENDY GETs Stiker & Aksessories: Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177; Telp. 0622 - 646 144. ANDREAN GYPSUM: Profesional dalam pemasangan Plafon Gypsum, Accessories Gypsum, atap baja ringan, stainless stell & desainer. Dapat juga pertamanan, poid balkon, kanopy, dll. Jl. Diponegoro No.212/283 KISARAN. Telp: (0623)-43611; HP: 0812 6399 062. Pimpinan Baginda Muslim Harahap (Asien) GROSIR ULOS BATAK DONGANTA, Jual Berbagai Jenis Ulos Batak, partai besar dan kecil. Hub: RAMSES TAMBUNAN, HP: 0812 6875 1155 - 0877 6864 2302. Jl. Perintis Kemerdekaan No.165 Blok 8, Lima Puluh, B.Bara USAHA TANPA MODAL: Pertama di kisaran AMWAY sebagai bisnis yang bisa dibanggakan, rencana untuk sebuah hasil yg lebih baik. Tersedia Nutrilite Vitamin, artistry Cosmetic, Farpum bermacam macam, pengkilat Sepeda Motor, odol, sabun dan lain lain. KISARAN Hub: 0813 6113 2128

LKP “UNI SMART COM” Kursus Komputer Mahir program Office 2007, Desain Grafis (Ps CS4, CorelDRAW X4), Teknisi Komputer dan Jaringan, MYOB Acc V.17, (Belajar sampai Mahir) Hub: 0877 4930 6155. Jl. Lintas Sumatera KM.137, Bangun Sari, B.Bara.

Dalam karya seni yang dibuat oleh Metra dan Jeanson ini menggunakan cara menempelkan potongan-potongan foto bagian tubuh seperti mata, hidung, bibir dari majalah ke wajah seseorang model untuk difoto dan menampilkan ekspresi yang aneh. Metra mengatakan bahwa media seperti majalah fashion dapat mempengaruhi orang-orang dalam berdandan dan bersikap. “Majalah dan televisi terus menciptakan hal baru yang menjadi referensi sosial. Kekuatan media juga dapat mempengaruhi identitas seseorang,” kata Metra, Jumat (5/4). (oz/nik)

Untuk Pemasangan Iklan Hub: 1. Leo Siagian 2. Dini 4. Porno

: 0823 6980 5009 0877 4471 8592 : 0813 6237 1211 : 0813 9776 2062


5. Budi (R.Prapat) 6. Agus Tanjung (Aek kanopan) 7. Vino (Tanjung Balai)

MAGIC ENERGY ION BOTOL: Menghasilkan energy air dalam 1 detik. Kaya Oksigen, bermolekul kecil mudah diserap tubuh. Tubuh lebih Fit & Konsentrasi, melancarkan peredaran darah & Detoks, cegah penuaan Dini. Cegah Penyakit Jantung, Liver, Pankreas, ginjal, usus serta kanker. Tersedia 3 ukuran ( 500 ml, 700 ml, 1000 ml ) di KISARAN. Hub. 0813 6113 2128 CASH & KREDIT PERUMAHAN MUTIARA REGENCY KISARAN Bulan promosi selama persediaan masih ada, Tersedia type 48 & 60. Harga terjangkau. Fasilitas : Listrik, Sumur Bor, PLN Prabayar, Batu Block, Satpam. Siap HUNI. Hub: Bpk. Kodimin – 0813 6113 2128. BERGEGASLAH LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit-rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota B.Bara. APOTIK KARYA: Jual berbagai obat dan Lengkap, Harga terjangkau. Terima pasien & konsultasi kesehatan. Jalinsum Desa Tj. Gading, Simp. Kuala Tanjung, Indrapura, B.Bara. Telp: 0622-632751 "Balai Pengobatan ELLY” Izin No : 800/3244/ DINKES SOS/2008, Penanggung Jawab: Dr HIDAYAT MKes. Sedia berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda & keluarga, bersedia datang ke rumah anda untuk panggilan pengobatan di rumah; waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab. Batu Bara. Hub: IBU ELLY-0852 7668 2236 APOTIK MENTARI: Jl. KH Ahmad Dahlan No. 23 Rantau Prapat Telp: 0624 - 22597 Menjual : Obat-obat paten, harga terjangkau, Memberikan pelayanan yang memuaskan. Juga menerima resep dokter. “KLINIK HERBAL” Ahli Penyakit Kronis tnp Operasi/Injeksi +GURAH+ Penyakit yang sdh Terbukti SEMBUH, & Mengobati brbagai penyakit lainnya. Buka Praktek Jam: 08.0020.00WIB. Hari libur/besar tetap Buka. Jl. Jend. Sudirman No. 28/ JALINSUM, Indrapura. HP 0812 6327 9810 - 0853 7066 9348 “DIVA SALON & SPA” Perawatan rambut, wajah & tubuh terlengkap di B.Bara. Paket Hemat SPA (Masage+Lulur+ Spa:Rp.180rb) hny Rp.150rb; Paket Face To Hair Sacial+Creambath Rp.80rb hny Rp.50rb. Hub: 0852 7508 4444, Jalinsum Binjai Baru, B.Bara. MARI SALON SANGGUL: Menerima : rias pengantin, gunting, creambath, masker, hair spa, facial, lulur, smooting/bonding, cat rambut, kriting/klintong, sambung rambung dll. Menerima siswa/siswi yang mau belajar & dan punya keahlian di idang kecantikan. Biaya terjangkau & dpt di cicil. Membutuhkan : karyawati/asisten salon yang berpengalaman dgn Gaji nego. Alamat : Pasar Gelugur Lantai 2 Blok B No. 43 dekat Musholla. HP 0821 6547 7080 BINTANG PANGKAS: Khusus pangkas pria.Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara “AA” Fashion: jual berbagai jenis pakaian muslim,wanita, pria, anak2, & dewasa, berbagai merek dan ternama, & terbaru. Melayani eceran & grosir. Jl. Jend. Sudirman, Indrapura, Kab. B.Bara. HP: 0813 6154 2640 MAJESTYK: Sedia bermacam jenis roti dan Bolu: Bika Ambon, Lapis Legit, Kue MP, Bolu Gulung, Roti Tawar, Donat dan dll. Terima pesanan untuk acara Rapat, Arisan & Ultah. Hub: 0622-646300 ; Jl. Jend. Sudirman No. 75 INDRAPURA, Kab. B.Bara TELAH BUKA DEPOT AIR MINUM KESEHATAN BUKIT WATER Reverse osmosi system (RO) Menerima pesanan dan siap antar ketempat anda. Jl. By Pass Kel. Lobu Sona, Rantau Prapat Hp 0853 7241 6308; 0853 5861 4890

ANDA MAU BUKA WARNET??? Kami menyediakan jasa layanan pembelian, service, maintenance, upgrade, instalasi, setting jaringan lan dan microtik squid. Hub : Queengaming - 0813 9759 6596 Jl. Imam Bonjol No. 126 Rantau Papat

: 0852 9779 9501 : 0813 7630 5720 : 0812 6539 6060

“WARUNG MPOK ATIK” Menyediakan masakan : nasi Goreng, soto, mie goreng/ tiaw, aneka ikan bakar, dan menyediakan aneka juice . Jl. ACCES ROAD INALUM, Simp Durian. Hub: Ibu Atik- 0852 6546 3152. RUMAH MAKAN CAHAYA MINANG: Sedia masakan Khas Padang Pariaman, terkenal lezat, sedia ayam bakar, minuman, kopi susu, teh susu & Juice, terima pesanan nasi kotak. Jl. Jend. Sudirman No. 72 INDRAPURA Rumah No.404. Hub : 0813 7655 6793 SALMA D’CAFÉ Sedia sarapan pagi,serba 7000-hidangan istimewa. Nasi/Mie goreing, bakso/pangsit/siomai, Batagor, bandrek, aneka juice. Terima nasi kotak dan rantangan. Hub: Ibu salma , 0812 6349 7777 Jl. Kula Tanjung Kebun Kopi Indrapura, B.bara. “WARUNG BAMBU AYAM PENYET” menjual : Ayam Penyet, Tom Yam, Ifu Mie/ Mie Telur, Bebek Goreng, Cah kangkung, cap cai, sop Buah & aneka juice. Jl. Access Road Kuala Tanjung. Hub: Kak Lina - 0853 6058 1512 BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP 0812 6217 910 RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Aneka minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Simp.Kuala Tanjung, Indrapura, B.Bara. RM FAMILI MINANG: Khas Minang tersedia rendang daging sapi, kambing, ayam, cincang, ikan panggang, harga Rp.7000. Hub: Ibu Nisa - 0853 5835 6505, di Simp. Sumodang Jl. Kuala Tanjung (Inalum), Sei Suka, B.Bara. RM Nasi SOTO: Sedia kare sapi, soto, sop, ayam goring sambal balado, gulai asam, gulai lemak, dll. Hub: Bpk Junaidi 0852 7074 7147, di Brohol Simp. Kenangan, Kuala Tanjung, B Bara “RM DENAI MINANG” Jual masakan khas padang, dengan menu istimewa: Nasi serba Rp8000, rendang, gulai pari, daging sapi, ikan mas, khas masakan rendang padang, menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum Lima Puluh B.Bara RUMAH MAKAN MINANG BAHARI: Menyajikan berbagai masakan Padang serba Rp. 7.000. Terima pesanan nasi bungkus & nasi kotak, aneka juice. Harga terjangkau Jl. SM. Raja No. 344 (Depan Rumah Sakit Umum) Kisaran. HUB: 0823 7041 0944 BAKSO PAKDE: Sajian Bakso, Mie Ayam, Nasi/Mie Goreng, Minuman : Jus Tomat, Jus Mangga, Jus Wartel, Jus Timun, Jus Pokat, Jus Jeruk. Hub: 0813 7645 3399–0823 6432 1148-0819 9041 4222. Simpang Kuala Tanjung (INALUM) SHE NDA KING JOSS: Obat kuat & tahan lama khusus dewasa:- anti lemas - anda puas - istri semakin gemas. Untuk pemesanan: Klinik Fengshui Jl. Sempurna (Gg. Buntu) R.Prapat. Hub: 0813 2424 1415 “WONG BEJO BELI RUMAH GAK PAKE MIKIR. INVESTASI BAGUS DANO BALE.2 YOO PASTI UNTUNG” CV. CENTRAL PROPERTY : 0853 5875 3027/ 0852 7643 6884 0823 6983 1000/ 0812 6340 7121. Gunakan FACEBOOK-mu untuk menghasilkan uang.Join oriflame-dBCN. Info. : Atauu add FB saya: BUTUH: Surveyor kredit bank, SMU, gaji tetap & komisi. Punya motor & HP. CV ke PT Wira, Plaza Pasifik A4/77 Jkt-14240/E:hrd@wira. PT Penempatan area Rantau Prapat INVESTASI: Perhari dapat 5% selama 88 hari (Tanpa Rekrut) KLIK? /ID.8880044 / SMS “BERMINAT” HP 087801710444; 081379285333; Telp. 021- 41013414 DI JUAL MURAH: Kebun sawit luas 3,5 Ha Rp 150 jt nego Surat Camat lokasi ladang di Teluk Dalam Hubungi Amir / Ameng 0823 6566 7959 – 0852 7087 1694 AORA TV SATELIT: Asyik nya 24 Jam, Pasang Aora Sekarang saluran hiburan keluarga lengkap, Paket Asyik 30 Ch.Rp 59.000/Bln Harga Paket Paling Terjangkau. Hub: AHMAD AORA - 0813 9751 1818 Rantau prapat. AORA TV SATELIT: Asyiknya 24 jam: Butuh hiburan, biar nonton tv jadi makin asyik??? Pasang aora sekarang!!!! Saluran hiburan keluarga lengkap. Harga paket paling terjangkau, bandingkan & buktikan sendiri!!! Hub:0812 6527 2182 ; 0852 7599 7798 Kisaran BT/BS BIMA KISARAN: Membimbing siswa/i kelas IV,V,VI SD. VII,VIII, IX SMP. X, XI, XII SMA. Untuk sukses UASBN, UN, SBMPTN, STAN. Alamat Jl. SM Raja No. 321 Telp. 0623 - 42920 Kisaran. (Ingat Bima Ingat Belajar)


Fakta dan Mitos Kesehatan Reproduksi

Para ahli kesehatan sudah memperingatkan bahwa merokok meningkatkan risiko berbagai jenis kanker. Dan, risikonya akan semakin tinggi tergantung waktu perokok menghisap rokoknya.

Banyak mitos beredar seputar kesehatan reproduksi. AGAR tidak tersesat informasi yang salah, berikut fakta sebenarnya tentang fungsi dan sistem reproduksi yang perlu Anda cermati. MITOS: Perempuan yang lebih cepat mendapat haid pertama (menarche) = perempuan nakal FAKTA: Tidak ada hubungannya antara menarche dengan perilaku nakal. Menarche pada usia 10-15 tahun dipengaruhi faktor gizi dan keturunan. Semakin muda usia menarche, semakin tua usia menopause. MITOS: Perawan akan berdarah pada hubungan seks pertama atau malam pertama. FAKTA: Keperawanan punya aspek fisik yang mengacu pada selaput dara dan aspek sosial yang mengacu pada seorang yang pernah berhubungan seksual. Selaput dara memiliki bentuk elastis. Perempuan akan mengeluarkan cairan vagina jika terangsang sehingga tidak semua perempuan mengalami pendarahan saat berhubungan seks untuk pertama kalinya. MITOS: Masturbasi atau onani hanya dilakukan pria dan menyebabkan dengkul kopong FAKTA: Masturbasi bisa dilakukan baik perempuan ataupun laki-laki. Dan perilaku ini bisa menyebabkan luka, keletihan, dan kelelahan jika berlebihan, merasa berdosa, tidak

konsentrasi, ketergantungan, dan tidak merasa butuh pasangan. MITOS: Orang hiperseks, jalan mengangkang dan bentuk bokong rata. FAKTA: Ini tidak berhubungan dan hanya pasangannya yang tahu bahwa ia hiperseks. MITOS: Payudara bisa diperbesar dengan meremasnya. FAKTA: Besar kecilnya payudara disebabkan faktor keturunan. Meremas hanya memperbesar sementara karena rangsangan. Sementara itu, payudara besar tidak mempengaruhi jumlah produksi ASI. MITOS: Hubungan seks sekali tidak menyebabkan hamil. FAKTA:Pertemuanspermadanseltelur dapatmenyebabkankehamilanwalaupun hanya berhubungan seks sekali. MITOS: Makan nanas menyebabkan keguguran. FAKTA:Apapun yang dimakan secara berlebihan akan menyebabkan gangguan. Pengaruh makanan akan berdampak pada lambung dan usus, bukan pada alat reproduksi.(int)

PARA ilmuwan dari Penn State College of Medicine di Pennsylvania menegaskan untuk tidak merokok di pagi hari. Pasalnya, perokok yang selalu merokok setelah bangun tidur lebih mungkin terkena kanker paru-paru. Dalam Journal of Cancer mencatat bahwa nikotin yang dihisap sekitar 30 menit setelah bangun memberikan efek dua kali lipat lebih berbahaya pada paruparu. “Para perokok ini lebih mungkin memiliki tingkat nikotin dan racun lainnya lebih tinggi dalam darah tubuh mereka dan membuat

Bakar Kalori di Kantor

APABILA Anda t e r m a s u k karyawan yang bekerja di dalam ruangan, tentunya sebagian besar dari aktivitas Anda duduk di depan komputer, menulis laporan, menghadirirapat,menggandakandokumendan aktivitas ringan lainnya. Nah, pelajari berapa banyak kalori yangAnda bakar lewat aktivitas ringan Anda dan lakukan alternatif-alternatif tertentu untuk memperbesar angkanya. Naik Tangga ke Kantor Bersyukurlah bila ruang kantorAnda berada di lantai 19 sebuah gedung pencakar langit. Pilihannya: Anda bisa berhenti menggunakan lift atau turun di lantai 5 dan melanjutkannya dengan naik tangga. Naiktanggaselama30menitakanmembakar kalori sebesar 122,5 kcal. Itu setara dengan kandungan kalori dalam sekaleng minuman soda non-diet.

Duduk di Cubicle Jumlah kalori yang dibakar relatif kecil, hanya 10ckcalperjam.Andabisamemperbesarjumlah kalori yang dibakar bila Anda melakukan peregangan ringan setiap sejamAnda duduk, itu akan membakar 126 kcal per jam. Atau selingi dengan berdiri dan berjalan untuk mengambil air minum atau alasan apapun yang bisaAnda temukan. Mau lebih lagi? Ganti kursi kerja Anda dengan gym ball. Menghadiri Rapat Melakukan presentasi Daripada duduk diam dan menahan kantuk, hanya membakar 105 kcal per jam- tingkatkan metabolisme Anda hingga membakar 126 kcal per jam dengan mengambil posisi aktif. Meningkatkan partisipasi aktifAnda di ruang rapat bukan hanya membuatAnda membakar lebih banyak kalori, tetapi bisa juga memuluskan karier Anda. (int)

mereka jauh lebih kecanduan,� ungkap pemimpin penelitian Dr Joshua Muscat, dilansir dari BBC News (1/4).(int)


6 April 2013



(21 Desember -19 Januari)

Karier: Kalau memungkinkan, selesaikan pekerjaan yang tertunda. Asmara: Harus lebih percaya sama dia, bukan sama temanny


(20 Januari - 18 Februari)

Karier: Tim kerja membutuhkan seseorang yang bisa menjadi perencana yang baik. Asmara: Cinta tidak bisa dipaksakan.


19 Februari - 20 Maret

Karier: Jangan terlalu membayangkan hal-hal sempurna. Asmara: Salah satu rencana bersama dia akan terlaksana.


(21 Maret - 20 April)

Karier: Jangan habiskan hari-hari hanya untuk memikirkan pekerjaan. Bisa jenuh. Asmara: Aman-aman saja.


(21 April - 20 Mei)


(21 Mei - 20 Juni)

Karier: Mainkan kartu dengan tepat, kamu pasti bisa maju. Asmara: Cinta mulai merasuki hidup Anda.

Karier: Awas stres karena sedang tak ada kesibukan atau pekerjaan. Lakukan sesuatu. Asmara: Yang namanya hubungan cinta memang tidak selalu mulus.


(21 Juni- 20 Juli)

Karier: Gunakan sejumlah pemikiran rasional. Hadapi hari esok dengan tenang dan percaya diri. Asmara: Semakin lengket.


(21 Juli-21 Agustus)

Karier: Anda tidak mempunyai rencana yang baik dalam menjalani pekerjaan. Sikap ini membuat Anda cepat merasa bosan. Segeralah susun rencana dan target.


(23 September - 22 Oktober)

Karier: Bakal ketemu orang yang akan mengubah hidup kamu. Tetapi semua butuh proses. Asmara: Jangan kecewakan si dia.


(23 Agustus-22 September)

.Karier: Akan ada keberuntungan di kantor Anda Asmara: Bagaimanapun juga hati Anda masih untuk si dia.


(23 Oktober – 22 November)

Karier: Curahkan kreativitas Anda. Percaya diri sajalah. Asmara: Anda diminta si dia untuk bersabar.


( 23 November - 20 Desember)

Karier: Jangan menumpuk pekerjaan, jika memang bisa Anda selesaikan hari ini. Asmara: Makin akrab, makin asyik.

PASUKAN khusus kepolisian (SWAT) Los Angeles menyerbu rumah Rihanna, Kamis (4/4) malam. Langkah tersebut dilakukan setelah seorang pria tak dikenal menghubungi hotline darurat 911. Disebutkan pemilik hit "Umbrella" itu dalam bahaya besar. Dua pria bersenjata berhasil memaksa masuk rumah serta seorang diantaranya berulangkali melepas tembakan. Kepolsiain dan pasukan SWAT dengan kendaraan lapis baja langsung diturunkan. Hasilnya, dua orang bersenjata tadi ternyata tak ada. Rihanna yang dalam laporan per telepon disebut berada dalam rumah, malah baru muncul beberapa jam setelah penyergapan berlangsung. Pejabat kepolisian Los Angeles (LAPD) khawatir kasus serupa akan terus berlangsung. Laporan palsu yang memaksa SWAT turun atau biasa disebut SWATED ini, dikhawatirkan meminta korban orang tak bersalah. Bisa saja kepolisian menembak penghuni rumah sendiri yang kesal rumahnya diserbu pihak berwajib. Belum lagi properti rumah rusak akibat penyerbuan polisi yang terpaksa harus menerobos. Swated kini seperti jadi epidemi yang sulit diberantas kepolisian Ameika Serikat. Selebriti lain seperti Justin Bieber, Clint Eastwood, Miley Cyrus, dan Tom Cruise sempat jadi korban. Kasus ini sempat membuat seorang bocah berumur 12 tahun ditahan karena diduga membuat laporan palsu lewat 911. (jpnn)

ATIQAH Hasiholan belum menentukan bagaimana konsep pernikahannya bersama sang kekasih, Rio Dewanto. Namun, ia ingin pernikahannya nanti berlangsung sederhana, intim, dan indah. "Yang pasti sederhana, kan dasarnya simpel, aku mau kelihatan elegan tapi juga simpel. Simpel yang elegan," ucapnya ditemui di Hotel Ritz Carlton, Pacific Place, Jakarta. Namun, wanita kelahiran Jakarta, 3 Januari 1982 itu, masih merahasiakan jadwal pernikahannya. Ia berkilah tanggal pernikahannya memang belum ditentukan. Makanya, ia belum bisa membeberkan. "Kan saya sudah lamaran ya, terus kalau tanggalnya ada berita di bulan Agustus, tapi sebenarnya kami belum tahu tanggalnya kapan. Yang jelas, karena sudah lamaran pasti tujuannya ke sana," ucapnya. Pokoknya, lanjut dia, secepat mungkin. Tapi, pernikahan itu nampaknya tidak akan dilangsungkan Agustus 2013. Mengingat kesibukannya yang padat. Demikian pula Rio. "Yang pasti setelah Agustus, karena kan ya kesibukan masing-masing," ucapnya. Setelah Lebaran? "Insya Allah," tandasnya. (tr/int)


AKTRIS dan bintang sinetron Risty Tagor mulai mengurangi aktivitasnya di depan layar kaca sejak memiliki anak, Arsen Raffa Balweel yang sudah menginjak dua tahun. "Semua kegiatanku bisa di-manage dan suami syuting sinetron, jadi quality time saat bangun tidur, ngurus sarapan dia dan diatur sedemikian rupa dan cari nyamannya. Karena aku nggak mau ninggalin anak kalau nggak ada suami atau keluarga," ujarnya di kawasan Kebayoran Baru, Jakarta Selatan, Jumat (5/ 4). Dengan membatasi aktivitas, bintang film Bestfriend tersebut kini

bisa lebih memaksimalkan waktu bersama anak semata wayangnya. "Kami lebih sering kumpul bareng-bareng kalau Rifky libur kami berenang. Kalau ada event ultah kami usahain ngumpul dan biasanya keluarga besar aku juga akhir minggu selalu kumpul," papar dara berusia 23 tahun tersebut. Risty pun menikmati menjadi ibu muda dengan satu anak. Namun, belum ingin tambah anak. "Kalau di mulut sih, pingin, tapi di hati Allah tahu yang terbaik dan anak aku masih butuh banyak didampingi," tuturnya. (idc/int)



6 April 2013

Bukan Hari TERBAIK Pedrosa DANI PEDROSA secara mengejutkan hanya mampu finis kedelapan pada free practice atau sesi latihan bebas perdana MotoGP Qatar. Pembalap Repsol Honda itu mengaku, ”Ini bukan hari saya.” Penampilan mengecewakan diperlihatkan Pedrosa. Pebalap yang sedang dalam kondisi terbaik selama tes itu hanya mampu mencatat waktu 1 menit 57.749 detik. Pedrosa tertinggal jauh 1.064 detik dari Jorge Lorenzo yang menjadi pembalap tercepat. Motor pebalap yang tahun lalu menjadi runner up itu ternyata harus melebar sebanyak dua kali dalam tes itu. Pedrosa mengatakan motornya memiliki masalah saat hendak memasuki tikungan di Sirkuit Losail. “Hari ini bukan terbaik buat kami. Kami tidak mampu mengendarai motor dengan baik karena saya memiliki sedikit masalah saat hendak memasuki tikungan,” jelas pebalap asal Spanyol itu, diberitakan Crash. Dalam sesi pembuka itu, Pedrosa memang terlihat tidak mampu bersaing dengan

Jorge Lorenzo mengawali kiprahnya di MotoGP Qatar dengan baik. Pebalap andalan Yamaha itu mencatat waktu tercepat dalam sesi latihan bebas pertama, di depan Cal Crutchlow dan Valentino Rossi. LORENZO, Crutchlow, dan Rossi bersaing ketat dalam sesi di Sirkuit Losail. Namun, Lorenzo-lah yang akhirnya sukses mengukir waktu tercepat dengan catatan 1 menit 56,685 detik. Crutchlow harus puas menempati posisi kedua. Pebalap Yamaha Tech 3 itu membukukan waktu 1 menit 56,743 detik atau berselisih 0,058 detik dari catatan waktu Lorenzo. 1. Jorge Lorenzo 2. Cal Crutchlow 3. Valentino Rossi 4. Marc Marquez 5. Andrea Dovizioso 6. Alvaro Bautista Gresini 7. Stefan Bradl LCR 8. Dani Pedrosa 9. Aleix Espargaro 10. Nicky Hayden 11. Bradley Smith 12. Andrea Iannone Pramac 13. Ben Spies Pramac 14. Hector Barbera Avintia 15. Randy de Puniet 16. Karel Abraham Cardion 17. Colin Edwards Forward 18. Yonny Hernandez PBM 19. Hiroshi Aoyama Avintia 20. Claudio Corti Forward 21. Danilo Petrucci 22. Bryan Staring Gresini 23. Lukas Pesek 24. Michael Laverty

Rossi yang kembali bernaung di bawah bendera Yamaha juga terlihat sangat kompetitif. Catatan waktunya 1 menit 56,756 detik. Posisi keempat jadi milik pebalap debutan yang membela Repsol Honda, Marc Marquez. Andrea Dovizioso juga meraih hasil cukup bagus bersama Ducati dengan duduk di urutan kelima. Dani Pedrosa hanya menduduki posisi kedelapan,

di belakang Alvaro Bautista dan Stefan Bradl. Aleix Espargaro dan Nicky Hayden melengkapi posisi sepuluh besar. (int)

Hasil Free Practice I MotoGP Qatar Yamaha 1m56.685s Tech 3 Yamaha 1m56.743s + 0.058s Yamaha 1m56.756s + 0.071s Honda 1m57.276s + 0.591s Ducati 1m57.538s + 0.853s Honda 1m57.601s + 0.916s Honda 1m57.670s + 0.985s Honda 1m57.749s + 1.064s Aspar Aprilia 1m57.843s + 1.158s Ducati 1m57.926s + 1.241s Tech 3 Yamaha 1m58.369s + 1.684s Ducati 1m58.559s + 1.874s Ducati 1m58.575s + 1.890s FTR-Kawasaki 1m59.608s + 2.923s Aspar Aprilia 1m59.633s + 2.948s Aprilia 1m59.758s + 3.073s FTR-Kawasaki 2m00.341s + 3.656s Aprilia 2m00.426s + 3.741s FTR-Kawasaki 2m00.563s + 3.878s FTR-Kawasaki 2m01.227s + 4.542s Ioda-Suter-BMW 2m01.438s + 4.753s FTR-Honda 2m01.942s + 5.257s Ioda-Suter-BMW 2m02.079s + 5.394s PBM-Aprilia 2m02.135s + 5.450s

Hasil lengkap babak perempatfinal: Dae Eun Kim/Baek Choel Shin vs Ricky Karanda Suwardi/Md Ulinnuha 13-21 21-17 21-12 Suo Di vs Lindaweni Fanetri 21-13 21-18 Liu Yuchen/Huang Dongping vs Markis Kido/ Pia Zebadiah Bernadet Shin Baek Cheol/Jang Ye Na vs Riky Widianto/Richi Puspita Dili 16-21 21-7 13-21 Kim Dae Eun/Baek Choel Shin vs Ricky Karanda Suwardi/M Ulinnuha 13-21 21-17 21-12 Savitree Amitrapai/Sapsiree Taerattanachai vs Komala Dewi/Jenna Gozali 21-9 21-9 Irfan Fadhilah/Weni Anggraini vs Kim Dae Eun/Kim So Young 21-17 21-12 Angga Pratama/RyanAgung Saputra vs Berry Angriawan/Yohanes Rendy Sugiarto 21-11 21-18 Mohammad Ahsan/Hendra Setiawan vs Kien Keat Koo/Boon Heong Tan 21-18 21-15 Alamsyah Yunus vs Lee Dong Keun 21-12 21-14 Aprilsasi Putri Lejarsar Variella/Vita Marissa vs Vivian Kah Mun Hoo/Khe Wei Woon 21-11 21-19

motor tim Yamaha yang mendominasi pada sesi ini. Selain Lorenzo, pembalap Yamaha Tech 3, Cal Crutchlow juga mampu menempati peringkat kedua dan Valentino Rossi ada di posisi ketiga. “Itu yang membuat kami tidak mampu mencat atkan waktu terbaik. Kami berharap semua membaik pada sesi besok dan kami bisa mencatatkan waktu lebih baik lagi,” tandasnya. (int)

Hasil Free Practice I Moto2 Qatar

Rafid Topan Terpuruk Australia Grand Prix Gold

Indonesia Loloskan 5 Wakil ke Semifinal

INDONESIA hanya meloloskan lima pemain ke babak semifinal Australia Grand Prix Gold 2013. Nomor ganda putra menjadi Wakil yang terbanyak karena meloloskan dua pasangan. Dalam pertandingan di Sydney Convention & Exhibition Centre, Jumat (5/4), ganda putra Mohammad Ahsan/Hendra Setiawan berhasil mendapatkan tiket ke babak empat besar setelah menumbangkan pasangan Malaysia, Kien Keat Koo/ Boon Heong Tan 21-18 21-15. Tiket ke babak semifinal juga berhasil diraih Angga Pratama/Ryan Agung Saputra. Ganda putra unggulan kedua ini mendapatkan satu tiket setelah menyingkirkan rekan

senegaranya Berry Angriawan/ Yohanes Rendy Sugiarto lewat straight game 21-11 21-18. Kejutan kembali berhasil dibuat Alamsyah Yunus. Pemain yang menempati unggulan ke-12 ini menjadi tunggal putra tersisa Indonesia di turnamen ini di babak semifinal. Alamsyah mengalahkan Lee Dong Keun lewat straight game 21-12 21-14. Aprilsasi Putri Lejarsar Variella/Vita Marissa juga berhasil mendapatkan satu jatah tiket ke babak semifinal. Secara mengejutkan pasangan Indonesia menyingkirkan Vivian Kah Mun Hoo/Khe Wei Woon yang menempati unggulan ketiga dengan skor 21-11 2119. (int)

Legenda F1 Jagokan Hamilton Juara LEGENDA Formula One, Jackie Stewart tidak meragukan kemampuan pembalap Mercedes, Lewis Hamilton untuk menjuarai Formula One musim ini. Menurut Stewart, Hamilton memulai musim 2013 dengan baik, meski sebagian pihak sempat meragukan driver asal Inggris itu. Hamilton finis di peringkat kelima pada balapan pembuka musim ini di Grand Prix Australia, dan menyelesaikan balapan di posisi ketiga sepekan kemudian di Grand Prix Malaysia. Stewart percaya Hamilton masih punya peluang untuk sukses, terutama tren positif yang terus ditunjukkan mantan pembalap McLaren. “Ya, mereka (Mercedes) bisa memenangkan balapan. Lewis (Hamilton) akan mengemudkan mobilnya dengan maksimal, tak peduli mobil apa yang dia kendarai,” ujar Stewart, seperti dilansir BBC Sport, Jumat (5/4).

“Mereka bisa menjadi penantang untuk gelar musim ini, tapi mereka butuh lebih berkembang untuk menyamai Red Bull dan Ferrari,” jelasnya. Stewart menyatakan, kendati beberapa tim juga bakal kompetitif, seperti Lotus dan McLaren, pria berusia 73 tahun ini yakin Mercedes memiliki faktor lain yang bisa menjadikan pabrikan asal Jerman menjadi juara. “Lotus sangat kompetitif juga, dan McLaren akan berusaha membuktikan, tapi Ross Brawn (Tim Prinsipal Mercedes) adalah pria bertalenta luar biasa. Mercedes mampu untuk menang, dan mereka punya sumber daya yang memadai,” tandasnya. (int)

DONI Tata Pradita dan Rafid Topan Sucipto tidak berdaya menghadapi free practice I atau sesi latihan bebas Moto2 di Qatar. Kedua pebalap tidak mampu menembus 10 besar dalam sesi pembuka ini. Dalam sesi latihan bebas yang berlangsung di Sirkuit Losail, Jumat

(5/4), Doni yang Hasil Free Practice I Moto2 Qatar memperkuat Federal 1. Takaaki NAKAGAMI, Japan (KALEX), 2:00.924 Oil Gresini tampil 2. Esteve RABAT, Spain (PONS KALEX), 2:01.016 (PONS KALEX), 2:01.110 lebih baik. Pembalap 3. Pol ESPARGARO, Spain (KALEX), 2:01.433 kelahiran Sleman itu 4. Scott REDDING, UK 5. Julian SIMON, Spain (KALEX), 2:01.838 hanya mampu 6. Simone CORSI, Italy (SPEED UP), 2:01.846 menempati 7. Dominique AEGERTER, Swis (SUTER), 2:01.940 peringkat 28 dengan 8. Mika KALLIO, Finland (KALEX), 2:01.981 catatan waktu 2 9. Alex De Angelis, San Marino (SPEED UP), 2:02.051 menit 05.087 detik. 10. Nicolas TEROL, Spain (SUTER), 2:02.121 Sedangkan hasil —lebih buruk didapat 28. Doni Tata PRADITA, Indonesia (SUTER), 2:05.087 oleh Rafid Topan. 32. Rafid Topan SUCIPTO, Indonesia (SPEED UP), 2:07.050 Topan yang Takaaki Nakagami. Pembalap asal merupakan pembalap QMMF Racing Jepang itu melesat di urutan Team, justru berada di posisi paling terdepan dengan catatan waktu buncit dari 32 pebalap yang 2’00.924 detik. Dua pebalap asal mengikuti tes ini.Topan hanya Spanyol Esteve Rabat dan Pol mampu mencatat waktu 2’07.050 Esparago berada tepat di detik. belakangnya. (int) Pebalap paling cepat diraih


DIJADIKAN Nama Jalan di Inggris KUMPULAN istri dan kekasih atau yang lebih dikenal dengan nama WAGs (Wifes and Girlfriends) semakin terkenal saja di Inggris. Istilah WAGs memang muncul di Negeri Ratu Elizabeth II tersebut ketika para istri dan kekasih timnas Inggris berbondong-bondong menyaksikan kekasih mereka di Piala Dunia 2006. Tak heran jika Inggris menamakan jalanan di London dengan nama WAGs. Ya, Kini para WAGs pesepakbola Inggris boleh berbangga hati karena kini ada nama jalan yang bernama “Wagmore Street, W1”. Adalah Danielle O’ Hara (Istri pesepakbola Wolverhampton Wanderers, Jamie O’Hara) Nicola McLean (Istri Tom Williams dari Notts County) dan Bianca Slater (Kekasih Ryan Bertrand dari Chelsea) yang didaulat meresmikan nama jalan yang sebelumnya bernama “Wigmore Street” tersebut. Rupanya ketiga wanita cantik ini merupakan duta besar dari Football Pools, yaitu sebuah badan taruhan resmi di Inggris. “Kami sangat bersemangat untuk menunjukkan ke masyarakat di Inggris jika WAGs juga mengetahui sepakboa,” ujar Danielle seperti dilansir (int)


SABTU 6 April 2013



Bursa METRO WBA ½ : 0 Arsenal Prediksi Skor WBA 1-2 Arsenal

DUO pemain Arsenal Theo Walcott dan Jack Wilshere tengah menepi karena bekapan cedera. Keduanya diprediksi absen saat Arsenal melawat ke kandang West Bromwich Albion (WBA), dan mungkin kembali bermain mulai pekan depan.


ilshere kembali menda patkan cedera pada 12 Maret lalu. Dia diprediksi membutuhkan waktu selama tiga pekan untuk menyembuhkan cedera pergelangan kaki yang membekapnya. Belum juga Wilshere pulih, satu

„ Walcott dan Wilshere

Chelsea 3-1 Rubin Kazan


Ketajaman El Nino DUA gol yang diciptakan Fernando Torres ke gawang Rubin Kazan membuat manajer interim Chelsea, Rafa Benitez, puas. Benitez pun berharap Torres bisa mencetak gol lagi di laga selanjutnya. Torres tampil cemerlang saat Chelsea menjamu Rubin di leg pertama perempatfinal Liga Europa, Jumat (5/4) dinihari. El Nino mencetak dua gol dan membantu The Blues menang dengan skor 3-1. Dengan tambahan dua gol itu, Torres sudah mencetak 19 gol dalam 52 laga di semua kompetisi musim ini. “Ini bagus untuk kepercayaan dirinya. Tapi, kinerjanya di lapangan juga sangat bagus. Jadi, saya sangat senang dengannya,” aku Benitez yang dikutip BBC. Saat ini Torres tak mendapatkan jaminan sebagai starter di lini depan Chelsea. Striker asal Spanyol itu harus menghadapi persaingan dengan Demba Ba. “Dia berlatih dengan sangat baik setiap hari, jadi ini cuma masalah waktu saja. Dia mencetak dua gol hari ini dan semoga akan begitu lagi di pertandingan berikutnya,” kata Benitez. Harusnya Menang Besar Skor 3-1 yang didapat The Blues tak lantas memuaskan Rafael Benitez yang merasa skuatnya layak unggul lebih besar. Di Stamford Bridge, Jumat (5/4) dinihari, dua gol kemenangan Chelsea dibuat Fernando Torres sementara satu lainnya dilesakkan oleh Victor Moses. Gol balasan tim tamu datang dari eksekusi penalti Bebars Natcho. Meski meraih kemenangan, Rafael Benitez tak sepenuhnya puas dengan hasil tersebut. Chelsea disebutnya bisa tampil lebih baik lagi dan mencetak keunggulan dengan skor lebih besar. “Itu bisa saja lebih baik lagi, tapi saya tak bisa mengubah keadaannya sekarang. Penalti itu keputusan yang keras, tapi Anda tak bisa mengubah keputusan itu, jadi Anda harus melanjutkannya dan mencetak gol ketiga. Kami berhasil melakukannya (mencetak gol ketiga) tapi saya mengharapkan gol keempat,” sahut Rafa usai pertandingan seperti diberitakan BBC. Kecolongan satu gol saat bermain di kandang bisa jadi membahayakan peluang Chelsea lolos. Di leg kedua yang dilangsungkan pekan depan, Chelsea bakal terdepak andai wakil Rusia itu bisa menang 2-0. Namun Rafa yakin dengan kemampuan timnya yang punya banyak pemain top dunia. “Akan lebih sulit (di leg kedua) karena mereka akan bermain menyerang dan menyerang, tapi kami punya kualitas di tim kami,” lanjut pelatih berkebangsaan Spanyol itu. Jalan Pertandingan Percobaan Ramires pada menit ke-11 tak terlalu membahayakan gawang Rubin. Sepakan kerasnya dari luar kotak penalti masih melambung tinggi. Lima menit kemudian, Chelsea membuka skor. Umpan panjang David Luiz dari tengah lapangan diterima Torres yang berlari di kotak penalti. Meski dikawal satu bek lawan, Torres masih bisa

kabar kurang menggembirakan didapat oleh Arsenal. Walcott mengalami cedera kunci paha usai memenuhi panggilan membela Inggris di kualifikasi Piala Dunia. Terkait kondisi Walcott dan Wilshere, asisten manajer ‘Gu-

dang Peluru’, Steve Bould, menyampaikan kabar positif. Dia mengungkapkan bahwa kedua pemain itu diprediksi bakal comeback pekan depan. “Kami mempunyai kabar bagus terkait keduanya,” ungkap Bould seperti dilansir situs resmi Arsenal. “Jack (Wilshere) dan Theo (Walcott) sudah bisa berlari di luar latihan tim dan memiliki peluang untuk bisa masuk dalam pertandingan melawan Norwich (City) pada hari Sabtu pekan depan,” tambahnya. (int)

- Arsenal berhasil menaklukkan West Bromwich Albion 2-0 pada pertemuan pertama kedua tim musim ini di Emirates Stadium, berkat dua penalti Mikel Arteta. Ini adalah kemenangan ketiga Arsenal atas West Brom secara beruntun. Arsenal juga berhasil mengalahkan West Brom 3-2 pada pertemuan terakhir kedua tim di Hawthorns musim lalu. West Brom belum pernah lagi mengalahkan Arsenal di Hawthorns sejak Oktober 2005. - West Brom belum beranjak dari peringkat-8 klasemen dengan 44 poin dari 31 pertandingan, terpaut sembilan poin dari Arsenal di zona Eropa. West Brom menyerah 1-3 dari West Ham akhir pekan lalu, dan harus rela kehilangan gelandang

Youssouf Mulumbu yang mendapat kartu merah. - Performa West Brom sedang tidak konsisten, hanya mampu meraih tiga kemenangan dari 12 laga terakhirnya di Premier League dan menelan tujuh kekalahan. - West Brom juga selalu kebobolan dari enam laga kandang terakhirnya di Premier League, dengan tiga kemenangan dan menelan dua kekalahan. Sebanyak 26 dari total 41 kebobolan West Brom tercipta di babak kedua. - Striker West Brom Romelu Lukaku adalah topskor klub dengan 13 gol. - Arsenal belum beranjak dari peringkat-5 klasemen dengan 53 poin dari 30 laga, terpaut hanya dua poin

dari zona Champions. Arsenal berhasil membantai Reading 4-1 akhir pekan lalu di Emirates Stadium. - Arsenal hanya kalah sekali dari delapan laga terakhirnya di Premier League, meraih enam kemenangan dan sekali imbang. Performa tandang Arsenal di Premier League sejauh ini adalah enam kemenangan, lima imbang, dan empat kekalahan. - Arsenal tidak pernah gagal mencetak gol pada sembilan laga terakhirnya di Premier League. Arsenal juga tidak pernah gagal mencetak gol pada delapan laga tandang terakhirnya. - Gelandang Arsenal Santi Cazorla adalah topskor klub dengan 12 gol. Sebanyak 36 dari total 59 gol Arsenal tercipta di babak kedua

PRAKIRAAN PEMAIN: West Bromwich Albion ( 4-3-3 ) : 1.Ben Foster ( Kiper ) , 3.Jonas Olsson ( Bek ) , 6.Liam Ridgewell ( Bek ), 23.Gareth McAuley ( Bek ), 12.Steven Reid ( Bek ), 5.Claudio Yacob (Gelandang ), 7.James Morrison ( Gelandang ) , 21.Youssuf Mulumbu (Gelandang ), 22.Zoltán Gera (Striker), 9.Shane Long ( Striker ),24.Peter Odemwingie (Striker) Arsenal ( 4-4-2 ) : 24.Vito Mannone, ( Kiper ) , 4.Per Mertesacker ( Bek ) , 5.Thomas Vermaelen (Bek ), 11.Andre Santos ( Bek ), 6.Laurent Koscielny ( Bek ), 2.Abou Diaby ( Gelandang ), 8.Mikel Arteta ( Gelandang ) , 19.Santiago Cazorla (Gelandang ), 16.Ramsey ( Gelandang ), 17.Olivier Giroud ( Striker ), 9.Lukas Podolski ( Striker ).

Musim Bale Terancam Habis

„ Torres menceploskan bola ke dalam gawang melewati hadangan kiper Sergei Ryzhikov. Rubin hampir saja menyamakan kedudukan pada menit ke-20. Tendangan Natcho dari luar kotak penalti melaju deras ke gawang Chelsea, tapi Petr Cech mampu mementahkannya. Tim tuan rumah menggandakan keunggulannya pada menit ke-32. Moses yang mendapatkan bola liar di kotak penalti Rubin melepaskan tendangan voli yang tak bisa diantisipasi Ryzhikov. Berselang delapan menit, Rubin mendapatkan hadiah penalti menyusul handball John Terry di area terlarang. Natcho maju sebagai eksekutor dan sukses mengelabui Cech. Chelsea 2, Rubin 1. Rubin nyaris menyamakan skor pada menit ke-45. Sial buat mereka, sepakan keras Cristian Ansaldi masih melenceng tipis. Empat menit setelah babak kedua dimulai, Juan Mata punya kesempatan untuk mencetak gol. Namun, tendangannya bisa digagalkan Ryzhikov. Peluang yang didapat Terry pada menit ke-60 juga tak mengubah keadaan. Sundulannya meneruskan sebuah sepak po-

jok masih melambung. Beberapa saat kemudian, gawang Chelsea diancam Salomon Rondon. Tapi, tembakan Rondon dari depan kotak penalti bisa diamankan Cech. Memasuki menit ke-70, Torres kembali mencatatkan namanya di papan skor. Diawali umpan silang Mata dari sisi kiri, dia mengalahkan Ansaldi dalam duel udara dan menanduk bola ke dalam gawang. Ramires menjajal peruntungannya lagi pada menit ke-90 lewat tendangan voli dari luar kotak penalti. Tapi, arah bola masih melebar. (int) SUSUNAN PEMAIN CHELSEA: Cech, Azpilicueta, Luiz, Terry, Bertrand, Ramires, Lampard, Moses (Hazard 65'), Mata (Oscar 78'), Benayoun (Marin 83'), Torres RUBIN: Ryzhikov, Navas, Kuzmin (Kasaev 82'), Kaleshin, Ansaldi, Orbaiz, Sharonov, Eremenko, Natcho, Karedeniz, Dyadyun (Rondon 46')

LONDON- Gareth Bale terkapar di atas lapangan dan mengerang kesakitan sebelum ditandu keluar lapangan. Terpelintir di bagian pergelangan kaki, Tottenham Hotspur terancam ditinggal pemainnya itu sampai akhir musim. Sempat tertinggal dua gol, Tottenham Hotspur akhirnya bermain imbang 2-2 saat menjamu FC Baseldilegpertamababakdelapan besarLigaEuropa.KubuSpursjelas tak puas dengan hasil tersebut, namunadahallainyangmembuat mereka masih merasakan kegetiran terkait kondisi Gareth Bale. Saat pertandingan memasuki periode injury time babak kedua, Bale terjatuh dalam posisi yang tidak sempurna usai berebut bola dengan pemain Basel. Tayangan ulang memperlihatkan pergelangan kaki pemain Wales itu seperti terpelintir. Kondisi tersebut membuat dia dikhawatirkan mengalami cedera parah di pergelangan kaki dan bisa menyebabkan dirinya absen hingga musim ini tuntas. Bale langsung terkapar di atas rumput usai momen tersebut. Dia terlihat mengerang kesakitan dan langsung dihampiri tim medis The Lillywhites. Pesepakbola yang telah mencetak 22 gol di sepanjang musim 2012/2013 itu kemudian ditandu keluar lapangan. “Pergelangan kakinya terputar, saat ini dia merasakan sakit yang amat, tapi semoga yang terjadi bukanlah yang terburuk,” ungkap Andre Villas Boas pada BBC usai pertandingan.

„ Gareth Bale AbsennyaBaleakanjadipukulan buat Spurs di sisa musim ini. Selain akan ditunggu laga sengit pada leg kedua di kandang Basel, mereka masih bertarung untuk meraih posisi empat besar demi meraih tiket Liga Champions musim depan. Basel tercatat tampil sedikit mendominasi dengan memenangi penguasaan bola hingga 51%. Namun, kedua tim sama-sama mendapatkan shots on target sama banyak, yakni enam. Dengan dua gol di markas Spurs, Basel punya keuntungan sebelum berlaga di kandang sendiri pada leg II pada 11 April mendatang. Newcastle Kalah Sementara itu di Stadion Da Luz, Newcastlekalah1-3melawanBenfica. Keunggulan yang diciptakan PapissCissedimenitke-12menjadi

tidakberarti.Setelamenerimaumpan dari Moussa Sissoko, Cisse dengan mudah melepaskan sontekan kaki kanan. Keunggulan ini hanya bertahan sampai menit ke25. Rodrigo membuat tim tuan rumah menyamakan kedudukan lewat sebuah tendangan dari jarak dekat.Sebelumgolitutercipta,Tim Krul sempat memblok seranngan Oscar Cardozo. Babak pertama berakhir dengan skor 1-1. Namun, Benfica yang tampil relatif lebih dominan, dan melepaskan sebanyak 20 tembakan sepanjang laga, menambah dua gol lagi di babak kedua. Kedua gol itu diciptakan oleh Lima Dos Santos pada menit ke-65 dan penalti Cardozo di menit ke-71 — setelah Steven Taylor handball di dalam kotak penalti.(int)


SABTU 6 April 2013





25 2

3 70-31


2 Man City


18 8

4 55-26


3 Tottenham


17 6

8 53-38


4 Chelsea


16 7

7 59-32


5 Arsenal


15 8

7 59-33


6 Everton



5 47-35


7 Liverpool


13 9

9 59-40


8 West Brom



13 5


9 Swansea City 31




10 Fulham


10 9



11 West Ham


10 6



12 Southampton 31

8 10



13 Stoke City


7 13



14 Norwich City 31

7 13



15 Newcastle






16 Sunderland


7 10



17 Wigan






18 Aston Villa






19 QPR


4 11



20 Reading








24 3

2 90-33


2 Real Madrid


19 5

5 72-28


3 Atlético Madrid 29

19 4

6 51-25


4 Real Sociedad 29

13 9

7 51-37


5 Málaga


13 8

8 41-28


6 Valencia


13 7

9 42-41


7 Real Betis


13 5



8 Getafe


12 7



9 Rayo Vallecano 29

13 2



10 Levante


11 7



11 Sevilla


11 5



12 Espanyol






10 5



13 Athletic Club 29



23 3

1 78-13


2 Dortmund


15 7

5 62-32


3 Leverkusen


14 6

7 50-35


4 Schalke 04


12 6

9 46-43


5 Mainz 05


10 9

8 34-30


6 Frankfurt


11 6

9 39-37


7 Freiburg


10 9

8 35-33


8 M’gladbach


9 11

7 35-37


9 Hamburger SV 27

11 5



10 Hannover 96 27

11 4



11 Nürnberg


8 10

8 29-32


12 Stuttgart






13 Bremen






14 Wolfsburg






15 Düsseldorf






16 Augsburg






17 Hoffenheim






18 Greuther









BARCELONA akan menyambut kembalinya Tito Vilanova di bench pertandingan La Liga. Akankah sang pelatih juga membawa kembali superioritas Barca yang sempat menurun?


arca akan menghadapi Real Mallorca pada Minggu (7/4) dinihari di Camp Nou. Menghadapi peringkat 19 klasemen sementara, tentu bukan perkara yang sulit untuk Los Cules. Namun Xavi Herandez dkk patut waspada, karena statistik menunjukkan mereka selalu kebobolan dalam dua partai terakhir di liga, meski melawan tim yang di atas kertas jauh di bawahnya. Dengan cederanya Lionel Messi dan baru pulangnya mereka dari lawatan ke Paris Saint Germain, peluang lawan agak membesar. Bahkan pelatih Mallorca, Gregorio Manzano, telah menyatakan ketidakhadiran Messi sebagai berkah. Tapi kembalinya Vilanova tentu akan membuat skuad Barca lebih bergairah. Barca yang mendapatkan hasil seri dan kekalahan di dua El Clasico di liga musim ini hanya perlu menghindari terjadinya krisis dan kesalahan seperti yang terjadi beberapa saat lalu agar tidak tersusul Madrid. Meski Messi cedera, namun kehadiran Vilanova di tepi lapangan tentu memberi suntikan moral pada para pemain. Patut diingat bahwa Vilanova berhasil membawa anak-anak asuhnya menembus rekor me-

Prediksi Skor Barcelona 3-1 Mallorca Bursa METRO Barcelona 0 : 1 ½ Mallorca

raih 55 poin dari 57 di paruh pertama musim ini. Tanpa Messi Bertandang ke Camp Nou membuat pelatih-pelatih di Liga Spanyol harus berpikir keras untuk meraih hasil terbaik. Tiadanya Lionel Messi setidaknya membuat pelatih Mallorca berkurang pusingnya. Mallorca akan menjadi tamu berikutnya yang berkunjung ke Camp Nou dalam lanjutan Liga Spanyol akhir pekan ini. Meski The Catalans baru bertarung habis-habisan di Liga Champions, tuan rumah tetap dijagokan bisa meraih hasil maksimal dalam laga yang akan digelar. Sadar laga akan sangat sulit, Mallorca setidaknya dapat sedikit kabar baik karena Lionel Messi dipastikan absen. Pemain terbaik dunia itu mengalami cedera hamstring saat berlaga di Paris. Dan disebut pelatih Gregorio Manzano, ketiadaan Messi mengurangi sakit kepala yang dia rasakan jelang laga tersebut. “Sakit kepala menjadi berkurang satu. Dengan Messi absen kami tak harus menghadapi mimpi buruk sepakbola atau mencoba menghentikan pemain yang mencetak gol lebih banyak dari tim yang jumlahnya

s a y a bahkan tidak tahu di Liga Spanyol ini,” seloroh Manzano di Football Espana. “Saya tidak bermaksud mengatakan kalau tanpa Messi berarti Barcelona bisa dikalahkan, karena masalahnya bukan itu. Kondisi yang sebenarnya adalah mereka kehilangan salah satu sumber golnya, pemain yang dikatakan mampu menentukan hasil pertandingan,” lanjut Manzano. Meski tipis, peluang Mallorca meraih poin dari lawatan ke Barcelona terbuka lebar. Selain karena faktor kelelahan, The Catalans fokusnya akan terbagi ke Liga Champions karena tengah pekan depan mereka akan gantian menjamu PSG. “Ya, hal itu jelas, tapi juga sangat relatif karena mereka tak ingin mengecewakan fansnya sendiri dan mencoba meraih kemenangan di akhir pekan ini,” papar dia lagi. (int)



21 5

4 59-19


2 Napoli


17 8

5 55-29


3 Milan


17 6

7 53-32


4 Fiorentina


15 6

9 54-37


5 Internazionale 30

15 5 10 47-39


6 Lazio


15 5



7 Roma


14 5



8 Catania


13 6



9 Udinese



8 38-38


10 Parma


10 8



11 Cagliari


10 8



12 Sampdoria


10 7



13 Bologna


10 6



14 Torino


8 12



15 Chievo


10 5



16 Atalanta


10 6



17 Genoa






18 Siena






19 Palermo


4 12



20 Pescara






AGENDA METRO SABTU (6/4) 15.30 WIB :Persija 21.45 WIB :Rennes 22.00 WIB :WBA 23.45 WIB :Juventus 23.45 WIB :Real Madrid

vs vs vs vs vs

Persiram (ISL) : PSG (Ligue 1 Prancis) : Arsenal (Liga Inggris) : Pescara (Serie A Italia) : Levante (Liga Spanyol) :

MINGGU (7/4) 00.45 WIB :Montpellier 03.40 WIB :Barcelona 15.30 WIB :Persib 18.30 WIB :Fiorentina 18.45 WIB :Saint-Etienne 19.00 WIB :Mitra Kukar 21.00 WIB :Sampdoria 20.30 WIB :Liverpool 21.45 WIB :Reims 22.00 WIB :Chelsea

vs vs vs vs vs vs vs vs vs vs

Valenciennes (Ligue 1 Prancis) : B Channel (Live) Mallorca (Liga Spanyol): (Trans TV) Persiba Balikpapan (ISL) : ANTV (Live) AC Milan (Serie A Italia) : TVRI (Live) Evian TG (Ligue 1 Prancis) : B Channel (Live) Barito Putera (ISL) : ANTV (Live) Palermo (Serie A Italia) : TVRI (Live) West Ham United (Liga Inggris) :Global Tv (Live) Lyon (Ligue 1 Prancis) : B Channel (Live) Sunderland (Liga Inggris) : Global Tv (Live)

ANTV (Live) B Channel (Live) Global TV (Live) TVRI (Live) Trans TV (Live)



Manfaatkan Euforia Champion WALAU peluang untuk mengejar Barcelona dalam perebutan gelar juara La Liga 2012/2013 sulit, Real Madrid tetap mematok poin penuh saat menjamu Levante akhir pekan nanti. Euforia kemenangan atas Galatasaray di leg pertama perempatfinal Liga Champion 2012/2013, akan menjadi penyemangat bagi skuad lapis kedua Los Blancos saat laga melawan Levante. Poin penuh wajib diusung skuad asuhan Jose Mourinho ini guna menghindari kejaran Atletico Madridyanghanyaberselisih1poindariRealMadrid. Jose Mourinho diprediksi akan menurunkan pemain pelapisnya pada laga melawan Levante nanti, guna memberi kesempatan untuk beristiraht bagi para pemain inti, karena tengah pekan depan Real Madrid kembali akan bertarung melawan Galatasaray di leg kedua babak perempat final Liga Champion 2012/2013. El Real yang tertinggal 13 poin dari Barcelona akan berusaha mengamankan posisi dua sekaligus menjaga peluang menjuarai Copa Del Rey dan meraih Liga Champions ke sepuluh. Mereka harus fokus bersaing dengan Atletico di liga dan final Copa. Meskipun pertengahan pekan ini Real Madrid harus melakukan pertandingan krusial di saat berhadapan dengan Galatasaray, namun El Real memiliki skuat hebat yang berlapis-lapis. Jika pun mereka menurunkan pemain lapis kedua pada pertandingan melawan Levante, hal itu tetap membuat Real Madrid lebih diunggulkan. Levante yang menempati posisi sepuluh klasemen sementara La Liga dengan koleksi poin sebanyak 40 angka, sejauh ini masih aman dari ancaman zona degradasi. Untuk itu, mereka akan

bermain bertahan dengan mengincar hasil minimal imbang dalam pertandingan ini. Hal itu sangat logis untuk dilakukan, mengingat skuad yang dimiliki oleh Levante masih kalah jauh secara kelas dari para pemain Real Madrid. Pada pertandingan pertama kedua tim di musim ini,RealMadridsuksesmengalahkanLevantedalam laga tandang di markas Levante. Saat itu, skuat besutan Jose Mourinho menang dengan skor tipis 2-1. (int)





SABTU, 6 April 2013



Edisi 92 „ Tahun V

13 Tersangka Bentrokan Dipindahkan ke Lapas SIDIMPUAN- Enam korban penembakan saat bentrok antara warga dengan polisi, yang sebelumnya dirawat di RSUD Kota Padangsidimpuan, kini harus mendekam di Lembaga Permasyarakatan (Lapas) Salambue.

Selain keenam korban, tujuh warga yang telah ditetapkan sebagai tersangka dan terlebih dahulu masuk tahanan polres, juga turut dipindahkan ke lapas. Mereka masuk Lapas Salambue, Jumat (5/4) sekira pukul 15.00 WIB. ‹ ‹ Baca 13

...Hal 2

Bina Marga Sumut Usul Rp1,8 T untuk Bangun Jalan dan Jembatan

Ayo, Dukung Polisi

BERANTAS Premanisme SIDIMPUAN- Pemerhati kepolisian Malik Assalih Harahap ST, menegaskan hukum adalah tiang utama dalam aturan penegakan masalah di Indonesia. Untuk itu, negara tidaklah boleh kalah dengan bentuk premanisme dan penyakit masyarakat. ‹ ‹ Baca Dihadiahi...Hal


„ Keenam korban menandatangani surat penahanan dan penangkapan setibanya dari RSUD Kota Psp di Polres Tapsel, Kamis (4/4) lalu.


Termasuk Jalan Lingkar Kota Psp MEDAN- Dinas Bina Marga Provinsi Sumatera Utara mengusulkan anggaran sebesar Rp1,835

triliun untuk program pembangunan jalan dan jembatan di Sumut tahun anggaran 2014 (belanja langsung), termasuk untuk biaya pembangunan Jalan Lingkar Kota Padangsidimpuan.

Hal ini terungkap dalam pemaparan dan pembahasan program kerja Dinas Bina Marga ‹ ‹ Baca Bina

Marga...Hal 2

Wanda Maretha Piliang

„ Baun Aritonang

KPU Psp Diminta Sosialisasikan Aturan Pencalegan SIDIMPUAN- KPU Padangsidimpuan diminta pro aktif menyosialisasikan Peraturan KPU Nomor 13 tahun 2013 atas perubahan Peraturan KPU Nomor 7 tahun 2013 tentang pencalonan anggota DPR RI, DPRD provinsi dan DPRD Kabupaten/kota. Menurut Ketua Pekerja Sosial (Peksos) Tabagsel Baun Aritonang, hal itu bertujuan agar ada pemahaman dan penafsiran yang tepat khususnya bagi ‹ ‹ Baca KPU

Psp ...Hal 2


„ Ilustrasi ujian nasional.

Panitia UN Antisipasi Serangan Fajar

Duma Riris Silalahi


SEORANG bocah menggembalakan sapi di Desa Lopo Ujung Kecamatan Padangsidimpuan Selatan. Foto sederhana sarat makna ini dijepret Wanda Maretha Piliang.

Lagu Romantis

MODAL dasar seorang fotografer adalah mental. Alat (baca: kamera) adalah urusan selanjutnya. Hal ini disampaikan founder FograferNet Kristupa Saragih, dalam suatu diskusi fotografi di

KERAP menyanyikan lagu-lagu sedih, Judika secara khusus menciptakan lagu romantis untuk sang kekasih, Duma Riris yang akan segera menjadi istrinya. Lagu romantis itu diciptakan Judika sekaligus ‹ ‹ Baca Dihadiahi...Hal


Kota Pematangsiantar. Dan, ucapan salahsatu fotogafer terbaik Indonesia ini, dibuktikan oleh Wanda Maretha Piliang. ‹ ‹ Baca Fotografer...Hal


JAKARTA- Serangan fajar tidak hanya terjadi di hari pencoblosan pemilu. Panitia ujian nasional (UN) 2013 juga mencium potensi praktik serangan fajar. Bedanya, serangan fajar UN tidak membagikan sembako atau uang, melainkan kunci jawaban kepada peserta ujian. Kepala Badan Standarisasi Nasional Pendidikan (BSNP) M Aman Wirakartakusumah menuturkan, indikasi praktik ‹ ‹ Baca Panitia

UN ...Hal 2

Permas Alamsyah, Drumer Tunanetra Profesional Pertama di Indonesia

Punya Empat Grup Band, Pernah Iringi Empat Presiden Tidak bisa melihat alias tunanetra bukan berarti kiamat. Itulah yang diyakini Permas Alamsyah (48). Dengan kondisi tersebut, dia justru mempunyai “penglihatan” yang tajam saat menggebuk drum. Beberapa penyanyi tenar pernah diiringinya. Bagaimana dia menjalani semua itu? AGUS WIRAWAN, Jakarta

SUASANA Kafe Prestige Dining di Jalan Kemang Utara Raya, Jakarta Selatan, tampak meriah Minggu malam (31/3). Puluhan pengunjung memadati lounge


PERMAS Alamsyah saat tampil bersama grup band Grasshoper di Prestige Dining Minggu malam (31/3) lalu.

Arti Kasih Sayang Ibu

dengan lampu remang-remang itu. Sambil minum-minum ringan, para ‹ ‹ Baca Punya

...Hal 7

KONON pada jaman dahulu, di Jepang ada semacam kebiasaan untuk membuang orang lanjut usia ke hutan. Mereka yang sudah lemah tak berdaya dibawa ke tengah hutan yang lebat, dan selanjutnya tidak diketahui lagi nasibnya. Alkisah ada seorang anak yang membawa orang tuanya (seorang wanita tua) ke hutan untuk dibuang. Ibu ini sudah sangat tua, dan tidak bisa berbuat apa-apa lagi. Si anak laki-laki ini menggendong ibu ini sampai ke tengah hutan. Selama dalam perjalanan, si ibu mematahkan ranting-ranting kecil. Setelah sampai di tengah hutan, si anak menurunkan ibu ini. “Bu, kita sudah sampai”,kata si anak. Ada perasaan sedih di hati si anak. Entah kenapa dia tega melakukannya. Si ibu , dengan tatapan penuh kasih berkata:”Nak, Ibu sangat mengasihi dan mencintaimu. Sejak kamu kecil, Ibu memberikan ‹ ‹ Baca Arti

Kasih ...Hal 7




6 April 2013

Ayo, Dukung Polisi Berantas Premanisme

Sambungan Halaman 1

kan yang tepat. Kita apresiasi langkah dan tindakan Kapolres yang tidak kenal kompromi dengan tindakan perjudian, pekat dan premanisme di Kota Psp,” ujarnya. Kemudian, sambung Malik, untuk masalah razia pekat yang dilakukan Polres Psp sudah merupakan langkah yang tepat dan patut didukung semua pihak di Kota Psp. “Karena Kota Psp selama ini dikenal sebagai kota religius yang selama ini kita kenal masyarakatnya taat beribadah. Walaupun ini sebenarnya sudah menjadi tugas polri, tapi apresiasi yang setinggi-tinginya patut kita acungkan terhadap Kapolres Psp,” jelasnya. “Kita sangat mendukung secara moral gebrakan itu. Siapapun yang membackingi tempat-tempat maksiat harus disikat habis, siapapun dia tanpa terkecuali. Kita meyakini Kapolres Psp berkomitmen untuk menuntaskan persoalan yang menjadi perhatian publik atau kasus yang meresahkan masyarakat di Psp. Kita memberikan dukungan moral untuk menyikat habis praktik judi, pekat, dan premanisme di Kota Psp,” tambahnya. (phn)

“Premanisme harus diberantas. Judi dalam bentuk apapun bentuknya harus diberantas. Sebab, judi sumber dari kejahatan selain narkoba. Untuk itu, ayo kita dukung polisi memberantas premanisme dan judi,” kata Malik, kemarin. Dikatakannya, polri sebagai yang bertugas memelihara keamanan dan ketertiban masyarakat harus berani menindak premanisme dan memang benar-benar menegakkannya. “Agar tindak kejahatan tidak terjadi, negara tidak boleh kalah dengan bentuk premanisme,” tambah Malik yang dikenal dekat dengan para petinggi polri ini. Ia juga mendukung sepenuhnya komitmen Kapolres Psp AKBP Budi Hariyanto SIk Msi untuk menyikat habis segala bentuk perjudian, pekat dan juga premanisme di Kota Psp. Menurutnya, pemberantasan judi, pekat dan premanisme merupakan atensi dari Kapolri Jenderal Pol Timur Pradopo dan Kapoldasu Irjen Pol Drs Wisjnu Amat Sastro SH. “Jadi apa yang dilakukan Kapolres Psp sudah merupakan tinda-

Panitia UN Antisipasi Serangan Fajar Sambungan Halaman 1

Kepala Pusat Penilaian Pendidikan (Kapuspendik) Kementerian Pendidikan dan Kebudayaan (Kemendikbud) Hari Setiadi mengatakan, kalaupun guru personel tim sukses mampu menyelesaikan soal, mereka akan kesulitan menandai kunci jawaban itu untuk kode soal nomor berapa. Tahun lalu setiap variasi lembar ujian memiliki kode tertentu, yakni kombinasi angka dan huruf. Untuk UN 2013, kode naskah ujian tidak lagi dimunculkan dalam bentuk huruf dan angka. “Kode hanya muncul dalam gambar barcode (kode batang, Red),” tandasnya. Untuk menekan potensi serangan fajar, guru mata pelajaran yang di-UN-kan diliburkan dan tidak boleh ada di lingkungan sekolah. Sementara itu, Inspektur Jenderal (Irjen) Kemendikbud Haryono Umar mengatakan, pengawasan distribusi naskah ujian dari rayon hingga ke sekolah akan diperketat. Personel pengawas dari perguruan tinggi akan diperkuat. “Tim Itjen Kemendikbud tidak berwenang penyelidikan. Jadi tidak bisa melakukan spy (mata-mata, red) dan lainlainnya. Itu nanti polisi, kita hanya mengaudit,” kata mantan pimpinan Komisi Pemberantasan Korupsi (KPK) itu. (wan/ca/jpnn)

serangan fajar hampir selalu terjadi setiap kali pelaksanaan UN. “Pelaku utamanya diduga para guru yang direkrut menjadi tim sukses UN,” katanya di Jakarta, kemarin (5/4). Tim sukses ini direkrut secara berjenjang. Mulai dari dinas pendidikan kabupaten/kota hingga di jenjang satuan pendidikan. Guru yang masuk dalam tim sukses inilah yang bertugas mengerjakan lembar jawaban. Kemudian hasilnya disebar ke siswa melalui pesan singkat (SMS). Cara itu dilakukan menyiasati lemahnya pengawasan. Aman mengatakan, potensi serangan fajar itu cukup besar. Hal itu karena jumlah variasi soal yang hanya lima jenis untuk setiap ruang ujian. “Jadi, kalau naskah itu diambil pukul 05.00 waktu setempat, masih ada jarak waktu yang panjang hingga UN berjalan (pukul 08.00),” katanya. Rata-rata perjalanan mengambil naskah ujian dari rayon ke sekolah adalah 15 menit hingga 30 menit. Nah, tahun ini potensi para guru personel tim sukses untuk mengerjakan soal UN kecil. Sebab, jumlah variasi soal saat ini dipatok 20 jenis per ruang ujian. Selain itu, UN 2013 berlangsung lebih pagi, yakni pukul 07.30 waktu setempat.

13 Tersangka Bentrokan Dipindahkan ke Lapas Sambungan Halaman 1 Salah seorang tersangka yang belum dipindahkan ke lapas, Akhmad Jazudi Harahap (26), dari balik jeruji besi tahanan Polres Tapsel, menyebutkan, hanya dua orang yang masih tinggal di tahanan polres, yakni ia dan Banua Nasution(50). Kedua warga Aek Buaton ini ditahan sejak Sabtu (23/3) lalu. Sedangkan tujuh rekannya plus enam korban penembakan yang baru dipindahkan dari RSUD Kota Psp, pada Kamis (4/ 4) lalu, juga sudah dibawa dengan menggunakan mobil tahanan Polres Tapsel untuk dititipkan ke lapas Salambue. “ Jam tiga tadi (kemarin) mereka dibawa. Mungkin besok (hari ini) aku dan Pak Banua Nasution juga dipindahkan,” ujarnya. Saat METRO hendak bertanya lebih lanjut, seorang polisi yang sedang berjaga langsung menyuruh Jazudi kembali.

“Sudah sana masuk kau!” ujarnya ketus kepada Jazudi. Dan, 13 tersangka yang sudah ditahan dan dibawa ke LP Salambue adalah; Murni Siregar (57), Huala Pulungan (18), Rustam Nasution (35), Masdawiyah Daulay (50), Rayan Pulungan (62) kelimanya warga Aek Buaton, dan Amir Pulungan (52) warga Hutabargot. Sementara itu, tujuh tersangka yang telah ditahan sebelumnya; Maradoli Nasution (45), Zulmanan Nasution (30), Pembina Daulay (36), Ridwan Nasution (60), Saunan Harahap (35), Tongku Nasution (22), dan Rakhmad Pulungan (20). Kepala Pengamanan LP Salambue, Maratoguan Harahap, membenarkan kepada METRO, Jumat (5/4) sekitar pukul 15.30 WIB ada 13 tahanan titipan dari Polres Tapsel. “Iya, ada 13 tahanan titipan yang terdiri dari dua wanita, dua remaja, dan selebihnya pria dewasa. Dan mereka sudah kita

Sambungan Halaman 1

Sumut untuk tahun 2014, pada Musyawarah Rencana Pembangunan (Musrembang) Provinsi Sumut tahun 2013, di Hotel Santika Medan, Jumat (5/4). Menurut Kepala Dinas Bina Marga Sumut, Effendy Pohan, jumlah usulan anggaran tahun 2014 itu meningkat tajam, yakni sekitar Rp1,088 triliun, bila dibandingkan anggaran tahun 2013, yang hanya sebesar Rp747,735 M. “Dana ini akan digunakan untuk peningkatan, dan perbaikan jalan dan jembatan di Sumut,” ujarnya. Dijelaskannya, usulan Rp1,835

triliun itu, terdiri dari program peningkatan/pembangunan jalan dan jembatan sebesar Rp1,424 triliun. Ditargetkan sepanjang 455,6 km jalan ditingkatkan dan dan Rp789,3 miliar jembatan dibangun. Kemudian program pemeliharaan jalan dan jembatan sebesar Rp372,051 miliar. “Anggaran ini menargetkan pemeliharaan berkala dan rutin jalansepanjang2.436,29km.Selain itu program pembinaan jalan dan jembatan Rp 39,5 miliar,” tambahnya. Program prioritas penanganan jalan dan jembatan 2014, yakni untuk mendukung kawasan strategis antara lain ruas jalan

Koran Kebanggaan Orang Tabagsel

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman Komisaris Utama Komisaris Direktur Utama Direktur Pengasuh Pemimpin Umum/Penjab/GM Wakil PU/Pimpinan Perusahaan Pimred Metro Siantar Pimred Metro Tapanuli Pimred Metro Tabagsel Pimred Metro Asahan Wapimred Metro Tapanuli Tim Ombudsman

: : : : : : : : : : : : : :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Maranatha Tobing Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Barumun Tengah yang meminta polisi membebaskan tiga pemuda Desa Aek Buaton; Banua Nasution (50), Tongku Nasution (24), dan Julmanan (30), yang ditangkap pada Sabtu (23/ 3) sekira pukul 05.00. Informasi dihimpun METRO, tiga pemuda itu, ditangkap aparat polisi Polsek Barumun Tengah (Barteng) saat berjaga di lahan sengketa antara warga Aek Buaton, Sidondong, dan Hutabargot, dengan salah seorang warga Desa Sayur Matua, Harapan Harahap. Mendengar kabar tiga temannya ditangkap, sekira pukul 07.00 WIB, secara spontan sekitar 200 warga dari tiga desa yang memang berdekatan ini berkumpul di Desa Aek Buaton. Tidak lama kemudian, sebagian besar warga yang menaiki sepedamotor dan sebagian kecil angkutan umum ini, bersamasama menuju Polsek Barteng, yang berjarak sekitar 10 kilometer dari Aek Buaton. (mag-01)

pendukung menuju KEK Sei Mangke. Program penanganan jalan feeder road yang strategis, antara lain yang menghubungkan antar lintas jalan nasional. “Kemudian penanganan jalan akses mendukung perkotaan dan ibukota kabupaten/kota antara lain Kota Medan dan Binjai, jalan arteri Kota Tanjung Balai, Jalan Lingkar Kota Padangsidimpuan,” tambahnya. Walaupun begitu, Effendi menyatakan ada kendala dan masalah dalam pelaksanaan pembangunan jalan dan jembatan di Sumut, yakni dari sisi kondisi geografis yang terletak

pada daerah tanah labil, kawasan dataran tinggi dan pantai barat yang kerap terjadi bencana alam. “Kemudian sulit proses ganti rugi tanah, kelangkaan aspal karena kebutuhannya yang sangat tinggi, tingkat kerusakan jalanyangtinggisedangkantingkat kemampuanpembiayaanrendah. Selait itu, kemampuan kontraktor masih rendah dan masih terjadi ketimpangan pembangunan antara jalan lintas timur dan lintas barat jalan nasional,” ujarnya. Sementara itu Junaidi mewakili Pemkab Langkat mengharapkan Pemprovsu memberi perhatian pada pembangunan jalan penghubung Langkat - Karo, yaitu

dari Berastagi menuju Bukit Lawang tanpa harus melalui Kota Medan. Kemudian diusulkan juga agar diperhatikan peningkatan jalan lingkar Kota Pangkalan Brandan, irigasi Sei Wampu dan pengembangan Pelabuhan Pangkalan Susu menjadi pelabuhan umum pasca diserahkan pihak PT Pertamina. Sementara perwakilan dari Pemkab Pakpak Bharat, mengusulkan agar penuntasan pembangunan jalan yang menghubungkan Pakpak Bharat dan Humbang Hasundutan (Humbahas), terus menjadi perhatianPemprovsu.(ram/smg)

Fotografer Tanpa Kamera Sambungan Halaman 1 Wanda Maretha Piliang, adalah salahsatu fotografer yang tergabung dalam Kopi Paet (Komunitas Fotografi Padangsidimpuan dan Sekitarnya). Ketiadaan kamera bukan penghalang baginya untuk berkomunitas sekaligus berkarya. “Saya tertarik fotografi karena kekaguman terhadap alam dan makhluk ciptaanNya,” sebut pria kelahiran 1 Maret 1992 membuka percakapan dengan METRO via BlackBerry Messenger (BBM), awal pekan lalu. Pria berdarah Minang yang lahir di Kota Padangsidimpuan ini, mengaku tertarik dengan dunia fotografi sejak tahun 2001. Saat itu, Wanda kecil yang berusia 9 tahun dapat hadiah kamera digital dari saudaranya di negri jiran, Malaysia. Mulai saat itu pula, ia selalu membawa kamera ke mana-mana untuk memotret apa saja yang ada di sekitarnya.

Keindahan alam, langit, air, aktivitas manusia, hewan, tumbuhan dan berbagai hal lainnya tak lepas dari bidikan kamera anak kedua dari tiga bersaudara ini. Hal itu pula yang mendasarinya tertarik dunia fotografi. Menurutnya, setiap moment yang telah terjadi tidak akan mungkin bisa diulang bagaimana pun caranya kecuali lewat foto. “Sekitar empat atau lima tahun lalu, kamera pemberian om rusak dan gak bisa hidup samasekali,” kenangnya. Namun, hal itu (kamera rusak) tidak serta-merta membuatnya patah arang untuk menekuni hobi fotografinya. Wanda tetap memotret. Ia memanfaatkan kamera handphone. Hingga akhirnya bergabung dengan komunitas Kopi Paet pada Januari lalu. Waktu itu, kata Wanda, Kopi Paet masih dalam rencana pembentukan. Dan, ia diajak temannya, Brian Wahyu, untuk

bergabung. “Awalnya nolak bergabung dengan alasan gak punya kamera. Tapi, abang itu bilang; kamera gampang. Gabung aja dulu. Sejak saat itu hingga sekarang, hobi fotografi tersalur dengan baik di Kopi Paet,” ujar Wanda. Menurut Wanda, meskipun sampai saat ini belum memiliki kamera yang menjadi alat vital seorang fotografer, ia tetap enjoy menjalani hobi fotografinya. Hal itu, tidak terlepas dari peran anak-anak Kopi Paet yang mengerti akan kondisi tersebut. “Biasanya mereka meminjamkan alat (kamera) saat hunting. Nah, dengan modal kamera pinjaman, saya menyalurkan hobi. Saat kamera dalam genggaman, pasti akan saya gunakan dengan semaksimal mungkin untuk melukiskan semua ciptaan Tuhan yang begitu luar biasa ini lewat foto,” jelas Wanda. Fotografer itu, sambung Wanda, adalah pekerja seni yang mengungkapkan jiwa,

emosi, pengalaman, aktivitas kehidupan, penghayatan yang penuh karakter dan cita-cita, yang diwujudkan melalui foto. Dan, untuk itu semua memang dibutuhkan kamera. Namun, sambung Wanda lagi, fotografi itu bukan hobi yang mahal. Sebab, fotografi dapat dilakukan oleh siapapun tanpa memandang usia. Apalagi di era digital saat ini. Hampir semua orang punya kamera, minimal kamera handphone. “Hobi fotografi berubah menjadi mahal apabila kebutuhannya juga berubah. Misalnya untuk memotret bertema macro, landscape, model. Saat memotret itu dibutuhkan peralatan tambahan, seperti lensa, lighting, dan sebagainya. Jika telah bersinggungan ke situ, baru bisa disebut mahal. Sebab, untuk itu semua membutuhkan budget lebih. Tapi, tidak ada yang lebih mahal di dunia ini selain kemauan dan kerja keras,” ucap Wanda.

Wanda mengaku sangat berterimakasih kepada keluarga, sahabat, dan anak-anak Kopi Paet tentunya. Mereka adalah orangorang yang mendukungnay dalam fotografi. “Dari apresiasi, kritikan, dan perhatian mereka terhadap hasil jepretan saya, membuat diri semakin termotivasi sekaligus menambah semangat untuk terus berkarya dan menghasilkan foto yang bagus dan original,” kata Wanda. Di akhir wawancara, Wanda berharap, hasil jepretannya tidak hanya muncul di layar kamera, melainkan muncul di halaman depan koran dan majalah, juga situs foto nasional bahkan internasional. “Saya akan terus menjepret dan berkarya dengan fasilitas yang diciptakan Tuhan. Saya akan selalu berusaha hasilkan gambar penuh cerita yang berkarakter dan original. Satu lagi, saya ingin memiliki kamera dan peralatan lainnya dari hasil keringat sendiri,” pungkas Wanda. (ann)

KPU Psp Diminta Sosialisasikan Aturan Pencalegan seluruh pihak terutama yang akan mencaleg khususnya anggota DPRD yang akan mencaleg kembali di tahun 2014 ini. Dikatakannya, dalam peraturan KPU Nomor 13 tahun 2013 atas perubahan Peraturan KPU Nomor 7 tahun 2013 tentang pencalonan anggota DPR RI, DPRD Provinsi dan DPRD Kabupaten/kota ini di pasal 19 ayat j dikatakan persyaratan caleg bagi anggota dewan yang pindah parpol harus dilengkapi surat pernyataan pengunduran diri dari dewan dan surat keputusan pemberhentian sebagao anggota dewan. Kemudian masih pasal 19 ayat k dikatakan apabila surat pemberhentian masih dalam proses, maka batas waktu penyerahan paling lama adalah saat masa perbaikan Daftar Caleg Sementara (DCS). “Jadi surat pemberhentian itu

Anggota SPS No.: 438/2003/02/A/2007

“Mereka sudah ditembak, tapi mengapa malah ditahan?” tanya Edi. Namun, sambung Edi, pihaknya memaklumi bahwa penahanan para tersangka merupakan kewenangan penyidik. “Kapolres dan Kapolda sebaiknya mempertimbangkan penangguhan penahanan untuk para tersangka yang ditembak,” ujar Edi. “Dalam waktu dekat, kami akan menyampaikan hal ini ke Kapolri. Saat ini, masih dalam tahap mempersiapkan dokumen-dokumen tentang kasus tersebut,” lanjut Edi. Sebelumnya, sekitar 200-an warga dari tiga desa; Aek Buaton, Sidondong, dan Hutabargot bentrok dengan aparat Polsek Barumun Tengah, Palas, Sabtu (23/3) sekira pukul 07.00 WIB. Sembilan warga ditembak, satu di antaranya kritis dan lima polisi luka-luka. Bentrokan ini dipicu kedatangan 200 warga ke Polsek

Bina Marga Sumut Usul Rp1,8 T...

Sambungan Halaman 1


tempatkan di sel berbeda,” jelasnya. Ka Bo Reskrim Polres Tapsel Iptu Kusnadi membenarkan telah membawa 13 tahanan tersebut ke Lapas Salambue. Mereka adalah enam korban yang baru saja dibawa dari RSUD Kota Psp dan 7 orang yang telah ditahan sebelumnya. Dia juga menjelaskan tentang Huala Pulungan yang sempat diberitakan diberikan penangguhan penahanan, yang bersangkutan tidak diberikan penangguhan penahanan. Yang bersangkutan tetap ditahan dan dikirim ke Lapas bersama tahanan yang lain. “Informasi semalam salah, kita bawa juga dia (Huala) ke lapas,” kata Kusnadi. Sementara itu, Anggota Kompolnas Edi Hasibuan, menyayangkan penahanan keseluruhan korban penembakan, apalagi di antaranya ada perempuan. Dan, penahanan mereka dinilainya sangat tidak manusiawi.

Departemen Redaksi METRO TABAGSEL Dewan Redaksi Group : Marganas Nainggolan (Ketua), Maranatha Tobing, Pandapotan MT Siallagan, Muhiddin Hasibuan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Nasa Putramaylanda, Hermanto Sipayung, Nurjannah. Redaktur Pelaksana: Nurjannah, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Hezbi Rangkuty, Edi Saragih Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Parningotan Aritonang. METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba Kordinator Liputan: Pala MD Silaban, Reporter: Tonggo Sibarani, Imelda Purba, Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Raymound Sitanggang, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat) Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi : Ita Butar-butar METRO TAPANULI Pjs Redaktur Pelaksana: Nasa Putra Maylanda, Kordinator Liputan: -, Ass.Korlip : Horden Silalahi (Taput) Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Hermanto Turnip (Tobasa)

adalah SK Gubsu, artinya PAW terjadi sebelum DCS diumumkan. Maka kalau yang bersangkutan tidak dapat SK pemberhentian dari Gubsu maka tidak bisa tampil di DCS atau batal jadi caleg. Ini terkhusus bagi anggota dewan yang partainya tidak lolos menjadi peserta pemilu, tapi ingin menjadi caleg dari partai lain,” jelasnya. Untuk itu, Baun meminta dengan tegas kepada KPU, Panwas, DPRD dan Walikota Psp harus tegas dan jangan ada permainan, karena aturannya tegas. “Terkhusus bagi KPU untuk aktif mensosialisasikan ini,” katanya. Sementara itu, menurut jadwal, pada 9-22 April 2013 adalah waktu penyerahan DCS ke KPU. Untuk Kota Psp, akan banyak anggota dewan asal partai yang tidak masuk peserta pemilu 2014 yang harus mundur dari jabatan sebagai anggota

DPRD, jika masih ingin maju menggunakan partai politik lain yang masuk dalam 12 partai peserta Pemilu 2014. Adapun anggota DPRD Psp yang partainya tidak lolos di pemilu 2014 ini antara lain, Sopian Harahap dari Partai Republikan, Soritaon Siregar dari PSI, Siti Hawani Harahap dari PKPB, Ashari Harahap dari PDP, Hamdani Nasution dari PBR, Marataman Siregar dari Buruh, Indar Sakti Tanjung dari PKNU, Mahmuddin Nasution dari Merdeka, Frans Mico Copian Lubis dari PDS dan Samiun Siregar dari Patriot. Berdasarkan keputusan KPU Pusat, sebanyak 11 partai lolos verifikasi menjadi peserta Pemilu Legislatif 2014. Partai tersebut adalah Partai Amanat Nasional (PAN), Partai Demokrasi Indonesia Perjuangan (PDIP), Partai Demokrat, Partai Gerakan Indonesia Raya (Gerindra), Partai Gololongan Karya (Golkar), Hati

METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter:, Irvan Nasution (Kisaran), Susilowady (Kisaran), Jekson Siahaan (Batubara), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Mounting: Samuel Sihotang (Koordinator), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi, Maintenance & IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan : Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan : Tio Maria, Annisa (Medan) Staf Desaign:Reliston Purba, Togap Sinaga.

Nurani Rakyat (Hanura), Partai Keadilan Sejahtera (PKS), Partai Kebangkitan Bangsa (PKB), Partai Nasional Demokrat (Nasdem), Partai Persatuan Pembangunan (PPP), Partai Bulan Bintang (PBB) dan PKPI. Sementara Ketua KPU Kota Psp Muzakkir Khotib Siregar mengatakan, sosialisasi aturan pencalegan telah mereka sampaikan kepada partai-partai politik yang akan mengikuti Pemilu Legislatif 2014 mendatang. Pemberitahuan tertulis tentang aturan pencalegan juga telah diantar langsung ke sekretariat atau pimpinan partai yang akan ikut Pemilu 2014. “Sebenarnya, aturan-aturan pencalegan sudah kita sosialisasikan ke partai politik. Kalau Peraturan KPU Nomor13 tahun 2013 itu baru kami terima, kemarin. Inilah mau kami sosialisasikan lagi ke partaipartai,” jelasnya. (phn)

Perwakilan Metro Tapanuli Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koordinator Pengembangan: Zulfiandi, Staf Pengembangan: Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 April 2013

Apa Kata Mereka

Sikap Kami

Wakil Ketua DPR RI Priyo Budi Santoso Panja akan melaporkan RUU Ormas untuk disahkan pada paripurna. Tapi kalau masih ada yang krusial yang menjadi perdebatan, saya kira Panja harus lapang dada untuk mendengarkan dari semua elemen. Kalau itu tidak dimungkinkan, saya anjurkan kita tunda sampai persidangan berikut,”

Anggota Komisi I DPR Tjahjo Kumolo “Pada awalnya pendapat saya membela korps elite Kopassus, sangat tidaklah mungkin, sebagai pasukan elite TNI yang tugas utamanya membela bangsa negara. Ternyata, ada oknum Kopassus yang belum mampu menahan emosi,”

Kasus Cebongan, Pintu Masuk Revisi Peradilan Militer

Mendengar Koreksi RUU Ormas POLEMIK mengenai rancangan undang-undang organisasi kemasyarakatan (RUU ormas) terus menggelinding. Hal itu tampak dari pernyataan sikap sejumlah ormas dalam keputusan resmi organisasi, diskusi publik, dan demonstrasi. Desakan agar pasalpasal kontroversial segera direvisi begitu kuat. Bila tidak, begitu disahkan jadi UU ormas, ormas-ormas itu telah berancang- ancang mengajukan judicial review ke Mahkamah Konstitusi (MK). Pemerintah dan legislatif selayaknya mendengar suara kritis in

kekuasaan. RUU ormas juga dirancang untuk mengatur keberadaan lembaga swadaya masyarakat (LSM), baik yang didirikan WNI maupun warga asing. Dalam penilaian pemerintah, keberadaan LSM harus diatur agar kiprahnya dapat diselaraskan dengan tujuan pembangunan nasional. LSM yang dikelola orang asing pun harus Oleh : Biyanto menunjukkan komitmen untuk uhammadiyah ter menjamin kebebasan berkepentingan nasional dan turut Ketua Badan Standar masuk yang telah serikat, sementara pemerintah menjaga keutuhan NKRI. ReguNasional Pendidikan bersikap tegas me berkepentingan mengendalilasi ini dinilai penting, karena M Aman Wirakartakusumah nolak RUU ormas. kan ormas. diduga kuat banyak LSM yang bekerja tidak untuk kepentingan Sikap itu diambil karena menuDalam perspektif pemerintah, “Sekarang setiap kursi nasional, melainkan untuk fundrut hasil telaah Muhammadiyah, UU No 8/1985 tentang Ormas akan mendapat setting ing agency asing. RUU ormas yang dibahas di DPR dianggap tidak lagi mampu soal berbeda, sehingga Jika dicermati secara mendapat membatasi kebebasan mengikuti perkembangan. Itu di satu ruang ada 20 dalam dari RUU ormas, paling berserikat dan berkumpul serta karena perkembangan ormas, setting (soal),” tidak ada tiga poin yang penting berpotensi menimbulkan kegterutama pada masa reformasi, diperhatikan. Pertama, RUU oraduhan dan instabilitas politik terasa sangat dinamis dan merimas berpotensi menggeneral(Jawa Pos, 29 Maret). ah. Alasan lain yang dimajukan isasi semua lembaga sosial keDalam pertemuan di Kantor pemerintah adalah keberadaan masyarakatan. Itu berarti posisi Pimpinan Pusat Muhammadormas anarkistis yang sering ormas yang telah berkontribusi iyah, setidaknya ada 96 ormas mengganggu masyarakat dan luar biasa bagi perjuangan kemerlain yang juga menolak. Semenmerongrong kewibawaan pedekaan dan berpartisipasi dalam tara, PB NU mengusulkan pemmerintah. Dalam aksinya ormas pembangunan nasional, seperti bahasan RUU ditunda terlebih anarkistis telah memanfaatkan Muhammadiyah dan NU, tak dulu hingga ada titik temu, terusimbol-simbol agama atau simberbeda dengan LSM baru. tama terkait pasal-pasal yang bol negara. Padahal, Jalaluddin Berkaitan dengan persoalan masih diperdebatkan. al-Suyuthi, ulama besar dan Ketua Pansus Revisi UU Ormas ini, RUU ormas harus membedaSikap beberapa ormas tersemujadid Islam, menyatakan Abdul Malik Haramain kan secara tegas peraturan untuk but dapat dipahami karena bahwa tidak semua orang dapat ormas dan LSM, apalagi ormas mereka ingin memastikan bahmelaksanakan tugas tersebut. “Asas tunggal sudah tidak asing. Poin ini penting diperhawa RUU ormas tidak menjadi Menurut al-Suyuthi, hanya ada, kita hapus. Kita ingin tikan karena Muhammadiyah pemasung. Apalagi, ormas ulama dan penguasa yang dapredaksi di revisi UU Nomor 8 dan NU dengan ribuan amal ussekelas Muhammadiyah dan at bertugas amar ma’ruf nahi tahun 1985 tentang Ormas aha di bidang pendidikan, keseNU yang telah banyak berkiprah munkar. Ulama mengembang memang asas yang sama hatan, ekonomi, dan pelayanan dan, berusia jauh lebih tua dari tugas itu karena memiliki ilmu, dengan UU Parpol,” sosial lainnya memiliki jaringan negeri ini. Ormas ingin RUU itu sedangkan penguasa memiliki y a n g luas mulai pusat, provinsi, PENJUALAN,PERAWATAN,PENYEWAAN & KLAIM ASURANSI KENDERAAN kabupatJl. Suprapto No 33 Padangsidimpuan en/kota, CASH & KREDIT HP. 0812 6317 2276 kecamaJUAL BELI MOBIL BARU – BEKAS tan, dan Pemasangan Depot Air kelurahCASH & CREDIT Berkualitas Tinggi TUKAR TAMBAH SEGALA MEREK MOBIL Air Pengunungan (Meneral) an/desa. INNOVA G HITAM 2010 F Sistem RO Oxsygen Dan Grosir Peralatan Itu berINNOVA G SILVER 2008 BB Dan CAT OVEN BERGARANSI INNOVA G SILVER 2007 BB b e d a Depot Air Minum Grace Water LGX 2.0 CC SILVER 2001 F Hubungi Kami Segera Dialamat Ini: Jl. Cengkeh Raya P. Simalingkar No. 18A dengan LGX 2.0 CC BIRU 2003 BK HP. 0813 7010 7352 Jl. Sudirman No. 111 Pal IV Maria KM 6 Padangsidimpuan-Hutaimbaru L S M Melayani dalam dan luar kota LGX 2.0 CC SILVER 2002 F




Telp. 0634 - 25439 HP 0813 9755 5808; 0813 7092 4480



Dibutuhkan gadis/janda untuk dipekerjakan di Medan, yaitu PRT, gaji 800rb/bln bersih, jaga anak baru lahir, gaji 1,2Jt/bln bersih, jaga orang tua gaji 1,1Jt/bln bersih. Hubungi:


Jl. Setia Baru No. 19 C Medan Telp. 0812 6553 5559 Gajian setiap bulannya

Jl. DI Panjaitan No. 32 Kampung Marancar Padangsidimpuan

Yayasan Bersinar I


PANDAPOTAN HARAHAP (Direktur Utama) HP 08116642109; 081260685141


STIKES AUFA ROYHAN Sk Mendiknas No 270/E/0/2011 Tanggal 1 Desember 2011

Menerima Mahasiswa/i Baru TA 2013-2014 Pendaftaran Mulai Februari 2013

Program Studi:

• D III Kebidanan (Akbid) • S-1 Keperawatan Informasi dan Pendaftaran: Jln. Batunadua Ujung Gurap Baruas PADANGSIDIMPUAN Telp. 0634 - 7009557; HP 081375959898




2001 2003 2002 2003 2003 2000 1994 1995 1996 1989 1993 2007 1997 2012 2002



yang hanya menekankan pekerjaan di satu bidang dan bersifat elitis. Karena itu, penyamaan ormas dan LSM jelas sebuah kesalahan yang mendasar. Kedua, RUU ormas membuka peluang munculnya otoritarianisme baru. Apalagi, dalam RUU itu ada ketentuan bahwa Direktorat Jenderal Kesatuan Bangsa dan Politik (Ditjen Kesbangpol) dapat mencabut izin ormas. Jika itu yang terjadi, akan muncul budaya represif atas nama undangundang. Padahal, kebebasan berserikat dan berkumpul jelas diatur dalam konstitusi. Apalagi, konteks pembuatan UU No 8/ 1985 dan RUU Ormas jauh berbeda. UU No 8/1985 dibuat suasana rezim otoritarian Orde Baru. Sementara RUU ormas kini disusun dalam suasana demokratis. Karena itu, RUU ormas seharusnya menjamin ormas untuk menampilkan kekhasan asal tidak bertabrakan dengan nilainilai Pancasila dan kepentingan nasional NKRI. Ketiga, RUU ormas mewajiban pencantuman Pancasila sebagai asas bagi setiap ormas. Eloknya, RUU ormas memberikan kelonggaran bagi ormas yang ingin menggunakan asas lain, dengan syarat tidak bertentangan dengan Pancasila. Jika itu yang dilakukan, ormas berbasis agama tidak harus mengganti asasnya dengan Pancasila. Jangan korek lagi trauma sosial dan politik asas tunggal era Orde baru yang justru menyempitkan keterbukaan ideologi Pancasila. Tak perlu ada tafsir tunggal atas Pancasila dengan mena-fikan indahnya pelangi keragaman yang membentuk Indonesia tercinta. Jika beberapa hal yang berpotensimemicupertentanganitukembali didialogkan, rasanya masing pihak, yakni pemerintah, legislatif, dan ormas yang menjadi sasaran RUU, pasti menemukan jalan keluar. Aamin. (*) Penulis adalah Dosen IAIN Sunan Ampel

Indonesia kaya akan sumber daya hayati dan merupakan salah satu n e g a r a megabiodiversity terbesar di dunia. Selain itu, Indonesia juga dikenal sebagai gudangnya tumbuhan obat (herbal) sehingga mendapat julukan live laboratory. Salah salah hasil alam Indonesia yang terbukti bermanfaat bagi kesehatan adalah Gula Aren. Kini, hadir Gentong Mas yang salah satu bahan dasarnya adalah Gula Aren. Saat ini, telah banyak orang yang telah membuktikan manfaatnya, salah satunya adalah Suwarno (60 thn), "Mungkin karena pola makan dan faktor usia, sudah 6 bulan saya menderita penyakit berbahaya ini. Kadar gula darah saya mencapai 600 mg/ dL." Ujar pria yang berprofesi sebagai Wiraswasta tersebut. Ia menambahkan, ketika kadar gula darahnya tinggi, badannya sering terasa lemas, dan kepalanya sering pusing. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme pengaturan gula normal.

TERUNGKAPNYA penyerangan yang menewaskan empat tahanan di Lembaga Pemasyarakatan (Lapas) IIB Cebongan, Sleman, Yogyakarta, 23 Maret 2013 lalu, oleh 11 oknum Grup 2 Kopassus Kandang Menjangan, Kartasura, Solo, Jawa Tengah, membuka celah bagi DPR untuk merevisi Undang-Undang Nomor 31 Tahun 1997 tentang Peradilan Militer. Upaya ini sebagai bentuk reformasi di sektor keamanan. Sehingga kejadian demi kejadian yang melibatkan anggota TNI terhadap sipil sebagai korbannya, tidak terus terjadi. TNI mencatat, selama 2012, kasus demi kasus kriminal yang dilakukan oleh anggotanya cukup mencolok. Penganiayaan yang melibatkan prajurit TNI mencapai 355 kasus, terlibat narkoba sebanyak 161 kasus, serta penyalahgunaan senjata api sebanyak 49 kasus. TNI juga mencatat sebanyak 3.634 prajurit terlibat pelanggaran hukum dan sedang diproses. Dari jumlah tersebut, TNI telah menyelesaikan perkara sebanyak 3.298 kasus. Narapidana dan tahanan militer, sisa tahanan tahun 2012 sebanyak 414 orang. Tahanan masuk 1.812 orang, tahanan bebas 1.795 orang. Jumlah tersebut tentu bukan angka kecil, dan akan terus bertambah setiap tahunnya bila penegakan hukum dikalangan militer tidak segera ditertibkan. Karena itu, perlunya DPR merevisi RUU Peradilan Militer, apakah perlu prajurit TNI yang terbukti melakukan tindak kejahatan dapat disidangkan di pengadilan umum. Dengan begitu, masyarakat perlu tahu, dan bagi mereka keterbukaan, transparansi dan juga keseriusan dari aparatur negara, khusus militer tidak lagi jadi barang yang tabu. Selama ini, tindakan para tersangka masuk kategori pidana umum, mereka akan ditangani oleh pengadilan militer. UU Peradilan Militer memang secara tegas menyebutkan, setiap anggota TNI yang melakukan tindak pidana, termasuk pidana umum, diadili di pengadilan militer. Apabila para tersangka tersebut dibawa ke pengadilan militer, dikhawatirkan proses di pengadilan militer tersebut tidak bisa berlangsung secara transparan, terbuka, dan akuntabel. Para pelaku tidak mendapat hukuman yang setimpal. Sehingga, akan muncul impunitasimpunitas baru yang kemudian jadi pijakan bagi mereka untuk membuka kemungkinan terjadinya hal yang sama di masa mendatang. Padahal, seharusnya adalah dapat memberikan efek jera terhadap pelakunya. Dalam kasus Cebongan ini, diharapkan proses hukum ini tuntas dalam waktu singkat dan juga transparan. Terlebih, korban dari aksi brutal pasukan baret merah ini menyangkut korban sipil. Bila sudah demikian, akan semakin jelas bahwa reformasi TNI yang sudah berjalan maju, betul-betul berjalan, tidak jalan ditempat atau tidak tuntas sama sekali, seperti yang sering di gaung-gaungkan oleh para petinggi TNI pascareformasi. Lalu, akankan kasus Cebongan ini, dengan 11 tersangka oknum anggota Kopassus dapat diadili dan disidangkan secara terbuka dan transparan, pelaku yang bersalah harus dilakukan pemecatan atau hanya sekedar hukum disiplin saja? Kita tunggu saja. (*)

Tapi sekarang, kakek 5 orang cucu dapat bernafas dengan lega karena telah menemukan solusi yang tepat untuk mengatasi keluhannya, "Setelah minum Gentong Mas secara teratur selama 2 bulan, kadar gula darah saya sekarang sudah turun, badan pun terasa lebih segar." Ungkap ayah 4 orang anak itu. Setelah merasakan manfaat mengkonsumsi Gentong Mas, ia pun merasa terpanggil untuk membagi pengalamannya itu dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain." Harap warga Bandar Klippa, Kec. Percut Sei Tuan, Deli Serdang, Medan tersebut. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas. Selain itu, indeks glisemik

dalam Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787 Dolok Sanggul : 082129284752 T. Tinggi/Siantar : 081322099495 Binjai/pakam : 081398666166 Langkat/karo : 082167538828 Kisaran : 06237014362 Tanjung Balai : 081263495563 Labura : 081370590972 Labuhan batu : 082365222011 Sibolga :081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114



6 April 2013


4 TSK & 5 Kreta Diamankan SIMALUNGUN– Polisi berhasil membongkar sindikat pencurian sepedamotor (curanmor) di wilayah Simalungun. Sebanyak empat tersangka dan lima kreta diamankan. Keempat tersangka yakni Yusuf Sinaga (41), warga Jalan Baja Purba, Kecamatan Siantar, Sandu Syaputra Lubis (22), warga Jalan Naga Huta, Nagori Bosar, Kecamatan Panomban Pane. Kemudian Isban (19), warga Kecamatan Sei Suka, Kabupaten Batu Bara, selaku penadah dan yang terakhir Rijal Lubis (26), warga Jalan Diponegoro, Pematangsiantar. “Tiga pelaku ini diringkus pada Pebruari dan Maret lalu. Kecuali Rijal Lubis, ditangkap tiga hari lalu dari rumahnya,” ungkap Kasat Reskrim AKP Roni Sidabutar, kepada METRO, Jumat (5/4). Roni mengatakan, butuh waktu relatif lama untuk membongkar sindikat para pelaku. Dia mencontohkan kasus pencurian sepedamotor yang dialami Sahala Lingga (41), warga Kecamatan Raya. Sahala kehilangan sepedamotor Yamaha Scorpio dari halaman rumahnya pada 16 Oktober 2012. Setelah dilakukan penyelidikan terus menerus, akhirnya pelaku Yusuf Sinaga berhasil ditangkap pada Maret. Dari tangan tersangka, polisi berhasil mengamankan sepedamotor korban. Demikian halnya dialami Septi Suryando (22), warga Nagori Bosar, Kecamatan Pane, pada 25 Okotober 2012, kemarin, sepedamotor Yamaha Xeon miliknya juga diembat maling. Dari hasil penyelidikan kepolisian akhirnya pelakunya berhasil

diringkus pada Rabu (3/4), yakni Rijal Lubis (26), warga Jalan Diponegoro. Kemudian aksi pencurian sepedamotor kembali terulang pada 25 Maret kemarin, yakni yang dialami korban Romy Siregar (24), warga Tanah Jawa. Ketika itu sepedamotor Yamaha Vixion, miliknya diparkirkan di Huta Timuran, Nagori Mariah Jambi, Kecamatan Jawa Maraja Bah Jambi, dicuri maling. Setelah dilaporkan kepada petugas kepolisian, Polres Simalungun kembali membentuk tim hingga akhirnya menciduk Sandy Syaputra Lubis (22), warga Panombean Pane pada akhir Maret kemarin. Setelah dilakukan pemeriksaan, Sandy mengakui menjual sepedamotor tersebut kepada salahseorang rekannya bernama Isban (19) di Kabupaten Batubara. Ketika itu, petugas pun kemudian menjemput Isban, serta barang buktinya ke Kabupaten Batubara. Roni menyebutkan, untuk Isban dikenakan pasal 480 KUHPidana yang berperan sebagai penadah. Sementara ketiga tersangka lainnya dijerat pasal 363 KUHPidana tentang pencurian. “Dari hasil pemeriksaan, dalam melakukan aksinya pelaku menggunakan kunci palsu. Kunci itu untuk menghidupkan sepedamotor targetnya. Saat ini, kita masih melakukan pemeriksaan untuk dilakukan pengembangan,” ujar Roni. (pra/ dro)

Operasi Palm

3 Pencuri Diamankan SIMALUNGUN– Dalam rangka pelaksanaan opreasi Palm Toba 2013 yang dilaksanakan sejak 1 April Polres Simalungun, telah menangani 3 kasus dengan tiga pelaku atas kasus pencurian terhadap buah sawit milik PTPN III dan IV. Ketiga pelaku serta barang bukti saat ini diamankan di Polres Simalungun. “Operasi Palm ini adalah operasi khusus tindak pidana pencurian tanaman kelapa sawit serta CPO. dan hasilnya telah ditangkap 3 pelaku dengan aksi pencurian dilokasi berbeda,” terang Kasat Reskrim AKP Roni Sidabutar, Jumat (5/4). Pelaku pertama ialah Boy Sumandar (19), warga Tanah Jawa melakukan aksi pencurian di PTPN III Bah Jambi. Pelaku melakukan pencurian dengan menggunakan sepeda motornya

dan mengambil 10 Buah Sawit. Sedangkan Irpan (46), warga Nagori Sei Merbau, Kecamatan Ujung Padang turut juga tidak lepas jangkauan petugas saat melakukan aksinya di PTPN IV Tinjowan Senin (1/4). Pelaku mengambil 8 buah sawit dan membawanya dengan sebuah beko. Sedangkan Rikki Manullang (23) warga Kecamatan Bandar juga melakukan aksi pencurian di kebun hingga akhirnya diringkus petugas. Ketiga pelaku ini saat ini masih dalam pemeriksaan petugas kepolisian untuk dilakukan pengembangan. “yang pasti pihak kepolisian untuk tetap melakukan penindakan terhadap aksi pencurian di kebun pemerintah termasuk kebun rakyat,” ujar AKP Roni Sidabutar. (pra)


DIAMANKAN- 4 tersangka pencurian sepedamotor berikut dengan 5 unit kreta curian diamankan di Mapolres Simalungun, Jumat (5/4).

SISWA SMK CURI HP TNI SIANTAR- Seorang siswa SMK berinisial BG(19), salahsatu sekolah di Kota Pematangsiantar, nekat mencuri handphone (Hp) milik TNI. Keterangan dihimpun, saat beraksi ada seorang tersangka baru yakni berinisial HM (16) di Jalan Renville, Lorong 22, BDB. Benet menyempat diri mencuri Hp milik anggota TNI Serka L Sinaga (46) yang berada di samping rumah kost yang bakal mereka tuju. Ceritanya, Jumat (5/4), sepulang sekolah, Benat yang selama ini kost di Jalan Bali mengajak Holmes mencari tempat kost baru. Ajakan pelaku diiyakan HM karena kebetulan si HM juga mau pindah dari tempat kost lamanya di Lorong I, BDB dengan alasan kurang bebas. Sementara di luar jam belajar, dia banyak kegiatan ekstra kulikuler seperti latihan bela diri. Karena sudah cocok, mereka pergi ke lorong 22. Sampai di sana, warga mengaku samping rumah nomor 167 tempat kediaman L Sinaga TNI yang bertugas di Kodim 0207/Simalungun menerima anak kost. Selanjutnya mereka langsung menuju rumah tersebut sekaligus ingin melobi harga sewa kost. Di sana, L Sinaga tetangga samping rumah kost sedang asik menyusun beberapa pot bunga. Sore itu sekira pukul 14.30 WIB, korban menaruh Hp merek cina bersama satu gelas air putih di atas kursi teras. Tiba-tiba selesai menyusun pot bunga, korban merasa lapar kemudian pergi ke dapur guna mengambil makanan ringan berupa roti. Keluar dari dapur, korban sontak kaget melihat Hp yang awalnya ditaruh di atas kursi sudah tidak ada. Korban sempat tidak percaya kalau Hp-nya hilang. Tak berapa lama, si korban menanyakan kepada istri. Si istri mengaku tidak tahu dan tidak melihat ada orang yang mengambil DIJUAL CEPAT RUMAH : 2 kamar tidur, air PDAM, luas tanah 74,75 M, ukuran bangunan 5 x 9 M, pusat kota: Jl. DI Pamjaitan Gg.Melati Kel. Bincar Padangsidimpuan Utara, Harga 100jt (nego) Serius Hub : 0852 9686 2762 (Raja Ponsel).


S U Z U K I BARU 100% •Carry1.5L FD Pick Up (bonus Tape CD) DP17,86Jt-an; Angs 2,43Jt-an •Mega Carry APV Pick Up DP22,26Jt-an;Angs2,478Jt-an •Ertiga DP39,62Jt-an; Angs 4,101Jt-an •Carry Real Van GX DP 36,489Jt-an; Angs 3,614Jt-an •APV GL DP 36,79Jt-an; Angs 3,325Jt-an Proses Cepat Data di Jemput HUB: ARDI 0812 6582 0292 PROMO MOBIL SUZUKI 2013: Ertiga, Carry Pick Up, APV, Swift, Vitara, Dp dan Angsuran super ringan. Hadiah menarik + Undian/bln. Proses cepat, data dijemput dalam dan luar kota. Hub: AS Sianturi, 0812 6489 8086

RIZKY PONSEL: Menerima HP Bekas harga tinggi : Blackberry, Samsung, Nokia, Sony, dll, Dengan syarat lengkap dan baik, Menerima tukar tambah HP Baru & Bekas Jl. Sudirman ex Merdeka No.46 hotel Istana III PSP Hub: 0813 6215 1119 Bp.Irwanto

DICARI: Agen/Pangkalan LPG 12 kg dan 3 kg untuk Wilayah Tapanuli Selatan, Palas, Paluta, Madina. Melayani pembelian eceran LPG 12 kg dan 3 kg, juga untuk Rumah Makan , Hotel, Akper/Akbid, Pondok Pesanteren. Kami antar ditempat. Hub: (0634) 21673, HP: 0813 7716 3667, 0853 7165 5559, Jl. WR. Supratman No.17, Kota P. Sidimpuan. Mitsubishi Truck Center "PT.Sumatera Berlian Motor" Authorized Dealer di Medan Ready Stock : • Colt Diesel Canter • L300 PU/MB • T120 SS • Fuso • Pajero Sport • Outlander & New Mirage Hub. Sales : KARIM HP 0812 6581 0211

DIJUAL: Bahan & Peralatan Chrom yang masih berjalan diberikan pelatihan & alamat Suplier bahan baku, Peminat serius Hub:0617870503 (Jam Kerja)

SUZUKI MOBIL -Ertiga DP.25Jt-an Ang. 5Jt-an -APV Arena DP.19Jt-an Ang. 3Jt-an -Carry PickUp DP.18Jt-an Ang. 2Jt-an -Mega Carry DP.19Jt-an Ang. 3Jt-an -Swift ST DP.36Jt-an Ang. 4Jt-an -Splash DP.46Jt-an Ang. 3,6Jt-an *Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028 DIJUAL / DIKONTRAKKAN RUMAH : 4 (Empat) kamar tidur, 2 (Dua) kamar mandi, pekarangan luas, pinggir jalan. Lokasi: Jl.Bhakti ABRI / Kampung Sawah Padangmatinggi. P. Sidimpuan, serius Hub. 0852 1 888 0051 Gunakan FACEBOOK-mu untuk menghasilkan uang.Join oriflame-dBCN. Info. : www. manfaatbareng. com. Atauu add FB saya: INVESTASI: Perhari dapat 5% selama 88 hari (Tanpa Rekrut) KLIK? / ID.8880044 /SMS “BERMINAT” HP 087801710444; 081379285333; Telp. 02141013414

„ BG, tersangka pencuri Hp milik TNI atau mencuri Hp. Merasa tak habis akal, korban kemudian menghubungi nomor kontak Hp yang hilang memakai Hp istri. Begitu dihubungi, suara nada panggil terdengar jelas dari samping rumah. Setelah didekati, ternyata Hp itu sudah berada dalam tas milik Benet. Walau sudah ketahuan mencuri, Benet sempat berdalih dan mengatakan bukan mencuri melainkan dapat. Setelah dipaksa mengaku, pelaku bersih keras mengatakan bukan mencuri melainkan mendapat. Takut pelaku di amuk massa. Korban menghubungi petugas kepolisian Polsek Siantar Timur. Tak berapa lama, personil polsek terjun ke TKP untuk mengamankan pelaku. Kepada Metro Benet mengaku, nekad mencuri karena sudah tidak punya uang untuk bayar rumah kost di Jalan Bali. Sementara uang kiriman yang diberi orangtua setiap bulan

habis di judikan. “Aku mencuri untuk bayar uang kost Bang, karena sudah banyak hutang ku di rumah kost di Jalan Bali. Makanya aku niat pindah kost baru Bang,” kata pelaku di Polsek. Tak berapa lama Guru jurusan otomotif SMK GKPS Jalan Ahmad Yani marga Marpaung datang ke Polsek. Ketika diwawancara Metro, dia mengatakan pelaku pencuri Hp itu sudah enam bulan tidak membayar uang sekolah. Jika di totalkan sekitar Rp900 ribu. Selainkan itu pelaku juga dikenal sering bolos dari sekolah. “Pernah sewaktu saya menyuruh Benet pulang ke kampung untuk mengambil uang sekolah. Saya malah ditelepon seorang pemuda yang mengaku abangnya. Waktu itu Saya sempat curiga, karena sewaktu Saya meminta bicara langsung dengan orangtua Hp-nya langsung di matikan,” kata guru pelaku sewaktu ditanya soal latar belakang Benet. Masih di Mapolsek. Korban belum sempat membuat laporan pengaduan, Kapolsek Siantar Timur AKP Altur Pasaribu datang. Kepada Kapolsek korban mengaku tidak keberatan dengan kejadian tersebut. Karena setelah mengetahui latar belakang keluarga pelaku yang baru saja berduka atas meninggalnya orangtua laki-laki. Korban merasa iba dan kasihan, lagi pula pelaku juga masih butuh sekolah. “Mendengar pengakuan Benet kalau orangtuanya baru saja meninggal dunia, Saya turut berduka. Atas kejadian ini Saya tidak keberatan,” aku korban kepada Kapolsek. Konfirmasi Metro dengan AKP Altur Pasaribu mengatakan korban tidak jadi membuat laporan pengaduan. Sekarang ini pelaku sudah dibawa pulang olah guru tempat dimana pelaku bersekolah. (eko)

Kreta Gadai Digelapkan SIANTAR- Naas dialami A Siringoringo (30), warga Jalan DI Panjaitan, Kecamatan Siantar Selatan. Dia terpaksa mendatangi Polres Siantar guna membuat laporan penggelapan. Sebab kabarnya, sepedamotor Honda Revo (lupa plat BK) digelapkan oleh tukang gadai, Jumat (5/4) sekira pukul 11.00 WIB. Ceritanya, selama ini, Revo itu sering dipakai kakaknya I br Siringoringo. Beberapa waktu juga Revo pernah digadai dengan uang sebesar Rp3 juta. Setelah lunas, si kakak kembali menggadaikan kepada orang lain dengan nilai Rp1,5 juta. Begitu korban ingin menebus, ternyata penggadai sudah kabur. Setelah di tunggu beberapa hari, pelaku tak kunjung timbul di kampung. “Aku tidak kenal sama siapa kreta itu digadaikan kakak Ku Bang. Tapi yang pasti, kreta sudah tidak kelihatan lagi. Dugaan Ku sudah dibawa kabur sama tukang gadai,” kata korban sewaktu di Polres Siantar. Tak berapa lama masuk ke ruang SPKT, korban kembali keluar. Karena kasus yang dilaporkan si korban butuh saksi. Terutama orang yang menggadaikan kreta. Kebetulan memang siang itu, korban datang seorang diri tanpa ditemani kakaknya. “Kata polisinya. Kalau mau melapor harus ikut kakak Ku Bang. Karena kakak Ku yang menggadaikan,” kata korban berlalu pergi. Informasi dari pihak SPKT membenarkan kedatangan calon pelapor ke Polres Siantar. Karena tak cukup bukti, calon pelapor terpaksa di minta menghadirkan kakaknya untuk menjelaskan kronologis soal gadai tersebut. (eko)

Diduga Stres, Warga Sipahutar Mengamuk di RS Pirngadi MEDAN- Paulus Edi Susanto (25), warga Desa Siabalabal II, Sipahutar, Kabupaten Tapanuli Utara, mengamuk di ruang terpadu E RSUD dr Pirngadi, Medan, Jumat (5/4). Aksi Paulus itu membuat pasien lain ketakutan dan berhamburan lari keluar ruangan. Paulus memecahkan kaca jendela ruangan yang bersebelahan dengan tempat pasien rawat inap. Informasi di rumah sakit plat merah ini, Paulus sedang dalam masa perawatan di ruang 18 karena mengidap penyakit paru sejak enam hari lalu. Diduga stres, tibatiba dia berlari ke ruang E terpadu dan membolak-balikkan meja serta tempat tidur yang ada di situ. Tak hanya itu, seperti kesurupan, Paulus juga memecahkan sejumlah kaca nako. Pasien lain yang dalam perawatan pun panik dan berlari keluar ruangan walaupun sedang diinfus. “Tak tahu kenapa, tiba-tiba dia mengamuk dan memecahkan kaca ruangan,” kata Davidson, salah seorang sekuriti rumah sakit. Khawatir tindakan Paulus mengancam keselamatan pasien lain, petugas keamanan rumah sakit mengamankan Paulus dan membawanya ke ruang Instalasi Gawat Darurat (IGD) dengan diikat di kursi roda. “Terpaksa diikat, soalnya dia ngamuk terus, bahkan ibunya sendiri pun pergi entah kemana karena mau dipukulnya,” kata David. Kabag Hukum dan Humas RSUD dr Pirngadi Medan, Edison Perangin-angin ketika di konfirmasi mengatakan akan menyelidiki kasus pasien tersebut. “Masalah ini akan kita selidiki terlebih dahulu, kabarnya pasien itu mengalami stres, walaupun dia telah merusak barangbarang milik negara,” pungkasnya.(int)




TOLAK RUU ORMAS : Hizbut Tahrir Indonesia, melakukan unjuk rasa di depan gedung DPR RI, Jumat (5/4) di Jakarta. Dalam aksinya mereka menolak Rancangan UndangUndang (RUU) Organisasi Masyarakat, yang dianggap jauh dari semangat reformasi.

Baku Tembak Tewaskan 13 Tentara Myanmar MYANMAR-Baku tembak dengan kelompok bersenjata tak dikenal di dekat perbatasan Thailand menewaskan 13 tentara Myanmar. Juru Bicara Angkatan Darat (AD) Thailand Kolonel Sansern Kaewkamnerd pada Jumat (5/4) mengatakan otoritas Myanmar sudah mengontak otoritas Thailand berkenaan dengan hal itu. Sementara, menurut warta AP, insiden kekerasan itu terjadi di wilayah Myanmar sekitar 6 kilometer dari perbatasan Thailand. Wilayah perbatasan Thailand yang terletak paling dekat dengan lokasi kejadian adalah Provinsi Ranong. Sementara itu, pihak Thailand sudah menggelar investigasi menyangkut masalah itu. Thailand berupaya untuk mencari tahu apakah kelompok bersenjata itu adalah warga Thailand yang masuk secara ilegal ke Myanmar. Catatan dari laman Bangkok Post menunjukkan baku tembak pernah terjadi pada Agustus setahun silam. Kala itu, kelompok bersenjata saling tembak dengan tentara Myanmar yang tengah berpatroli di perbatasan. Dalam kesempatan itu, 92 warga Thailand ditangkap lantaran tuduhan memasuki Myanmar secara tidak sah. (kcm/int)

Asas Tunggal Pancasila Dicabut RUU ORMAS AKAN DISAHKAN 12 APRIL

JAKARTA - Asas tunggal Pancasila yang ditolak oleh Fraksi PKS DPR telah dicabut. RUU Ormas dijadwalkan disahkan 12 April 2013 mendatang. “Asas tunggal sudah tidak ada, kita hapus. Kita ingin redaksi di revisi UU Nomor 8 tahun 1985

Dua Lagi Pasien H7N9 Terkonfirmasi CINA- Sampai dengan Jumat (5/4), ada tambahan dua pasien penderita flu burung H7N9 di China yang terkonfirmasi. Menurut Xinhua, tambahan tersebut membuat total penderita menjadi 16 orang di seantero China. Kedua pasien terbaru itu berasal dari Provinsi Jiangsu di Timur China. Satu pasien bermarga Yin berjenis kelamin perempuan. Pasien berusia 61 tahun itu dilarikan ke rumah sakit lantaran kondisinya memburuk pada Selasa (2/4). Pasien berikutnya adalah seorang pria berusia 79 tahun. Pasien itu bermarga Lu. Ia dirawat di rumah sakit sejak Kamis (21/3). Pihak otoritas kesehatan setempat mengatakan ada 65 orang yang berkontak langsung dengan kedua pasien tersebut. Namun, tak ada tanda-tanda mereka tertular. Otoritas China memerinci 16 pasien H7N9 yakni 6 di Shanghai, 6 di Jiangsu, 3 di Zhejiang, dan 1 di Anhui. Sejauh ini, H7N9 sudah menewaskan enam orang di Shanghai dan Zhejiang. (kcm/int)

tentang Ormas memang asas yang sama dengan UU Parpol,” kata Ketua Pansus Revisi UU Ormas,

Abdul Malik Haramain, saat berbincang, Jumat (5/4). Malik menuturkan, UU Parpol mengatur asas dasar Pancasila dan UUD 1945 dan diperbolehkan memasukkan asas lain yang tidak bertentangan dengan Pancasila

Polri Belum Temukan Unsur Pidana Kasus Sprindik Anas JAKARTA-Penyidik Badan Reserse Kriminal Polri belum menemukan dugaan pelanggaran pidana dari kasus bocornya draf surat perintah penyidikan (sprindik) atas nama Anas Urbaningrum. Untuk itu, kepolisian belum dapat mengusut kasus yang sempat dilaporkan mantan Ketua DPC Cilacap Partai Demokrat Tri Dianto. “Jadi kita belum melihat apakah ini berkaitan dengan adanya pelanggaran hukum pidana yang menjadi ranah dari kepolisian,” kata Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar di Mabes Polri, Jakarta Selatan, Jumat (5/4). Sebelumnya, Tri Dianto berulang kali mendatangi Gedung Bareskrim Polri untuk melaporkan kasus tersebut, baik sebelum maupun sesudah Komite Etik KPK mengumumkan hasil penyelidikan. Menurut Tri, Komite Etik belum mengungkap dalang pembocor draf sprindik


„ Komite Etik KPK saat menyampaikan keputusan penyelidikan terkait bocornya sprindik Anas Urbaningrum. yang beredar sebelum Anas resmi ditetapkan menjadi tersangka oleh KPK. Tri meminta kasus itu ditangani oleh kepolisian. Komite Etik KPK sebelumnya juga memutuskan bahwa pelaku utama pembocoran dokumen sprindik Anas adalah Sekretaris Ketua KPK Abraham Samad, Wiwin Suwandi. Wiwin yang tinggal satu rumah dengan Abraham itu menghubungi media untuk memberikan fotokopi draf sprindik Anas. Hal ini merupakan keputusan Komite Etik dalam jumpa pers di Gedung KPK, Rabu (3/4). Wiwin akhirnya dipecat sebagai sekretaris Abraham.

Adapun Abraham dianggap lalai dalam mengawasi sekretarisnya sehingga terjadi pembocoran dokumen sprindik tersebut. Menurut Komite Etik, Abraham tidak terlibat secara langsung dalam proses pembocoran sprindik. Atas pelanggaran ini, Komite Etik menjatuhkan sanksi berupa peringatan tertulis kepada Abraham. Komite Etik juga meminta Abraham memperbaiki sikap dan perilakunya serta memegang teguh kode etik pimpinan KPK. Komite Etik dipimpin Anis Baswedan dan beranggotakan Wakil Ketua KPK Bambang Widjojanto, penasihat KPK Abdullah Hehamahua, mantan pimpinan KPK Tumpak Hatongaran Panggabean, serta mantan hakim Mahkamah Konstitusi Abdul Mukti Fadjar. (kcm/int)

dan UUD 1945. Jadi tidak ada lagi klausul asas tunggal Pancasila. “Kalau semua bisa segera disepakati kita jadwalkan minggu depan tanggal 12 April masuk Paripurna DPR,” tegasnya. Asas ormas diatur di Bab II tentang asas, ciri, dan sifat ormas. Aturan tersebut diatur di pasal 2 RUU Ormas. “Asas ormas adalah Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 serta dapat mencantumkan asas lainnya yang tidak bertentangan dengan Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945,” demikian bunyi pasal 2 RUU Ormas. Fraksi PAN Minta Tunda Pengesahan Badan Musyawarah (Bamus) DPR telah mengagendakan pengesahan revisi UU Ormas pada Sidang Paripurna DPR 12 April mendatang. Menyambut penolakan berbagai LSM dan Ormas, Fraksi Partai Amanat Nasionalo (F-PAN) dengan tegas meminta agar pengesahan RUU Ormas ditunda. “Kami secara resmi sudah

mengirimkan surat ke pimpinan DPR agar pengesahan RUU Ormas ditunda,” kata Ketua F-PAN, Tjatur Sapto Edy, kepada wartawan di gedung DPR, sesaat lalu (Jumat, 5/ 4). Menurut dia, pembahasan RUU tersebut telah menyita perhatian publik yang cukup besar. Terjadi penolakan dari ormas dan komponen masyarakat sipil. DPR, kata Tjatur, perlu menyerap aspirasi masyarakat yang berkembang dalam merespons RUU Ormas tersebut. Selain itu, fraksi PAN memahami respons masyarakat dan meminta pimpinan DPR untuk menerima aspirasi masyarakat yang berkembang dan menjadikan itu sebagai bahan masukan yang penting terkait pembahasan RUU Ormas. Selain meminta ditundanya pengesahan RUU Ormas, F-PAN meminta agar di waktu mendatang dilakukan uji publik serta forum sosialisasi yang lebih intensif kepada seluruh pemangku kepentingan agar produk hukum yang dilahirkan DPR, terutama yang menyangkut hidup orang banyak, dapat disepakati dan dipahami bersama. (kcm/rml/int)

Selasa, KPK Periksa Andi Mallarangeng JAKARTA-Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemanggilan mantan Menteri Pemuda dan Olahraga, Andi Mallarangeng untuk diperiksa sebagai tersangka kasus dugaan korupsi pengadaan sarana dan prasarana olahraga di Hambalang pada Selasa (9/4) mendatang. “KPK menjadwalkan pemanggilan AAM (Andi Alfian Mallarangeng) sebagai tersangka,” kata Juru Bicara KPK Johan Budi di Jakarta, Jumat (5/4).

Belum diketahui apakah Andi akan ditahan seusai diperiksa KPK atau tidak. Selama ini, lembaga antikorupsi itu kerap menahan seseorang seusai pemeriksaan yang bersangkutan sebagai tersangka. Sebut saja, anggota Dewan Perwakilan Rakyat Angelina Sondakh, mantan Deputi Gubernur Senior Bank Indonesia Miranda S Goeltom, dan mantan anggota Dewan Pembina Partai Demokrat, Hartati Murdaya Poo yang ditahan seusai diperiksa sebagai tersangka. Secara terpisah, salah satu pengacara Andi, Harry Pontoh mengaku sudah mendapatkan surat panggilan pemeriksaan KPK untuk Selasa pekan depan. KPK menetapkan Andi sebagai tersangka atas dugaan bersama-sama melakukan perbuatan melawan hukum dan penyalahgunaan wewenang yang menguntungkan diri sendiri atau pihak lain sehingga merugikan keuangan negara. Ancaman hukumannya, paling lama 20 tahun penjara dan denda maksimal Rp 1 miliar. Perbuatan pidana itu diduga dilakukan Andi bersama-sama dengan anak buahnya, Kepala Biro Keuangan dan Rumah Tangga Kemenpora Deddy Kusdinar, serta petinggi PT Adhi Karya Teuku Bagus Muhammad Noer. Kedua orang ini pun ditetapkan sebagai tersangka. Selain itu, KPK menetapkan mantan Ketua Umum Partai Demokrat, Anas Urbaningrum sebagai tersangka atas dugaan menerima hadiah atau janji terkait proyek Hambalang dan proyek lainnya. Sejauh ini, belum ada tersangka Hambalang yang ditahan KPK. (kcm/int)



6 April 2013

Pengganti Ketua KPU Harus Berpengalaman MEDAN - Komisi Pemilihan Umum Sumatera Utara (KPU Sumut) berharap agar segera menentukan pengganti Irham Buana Nasution yang telah mengundurkan diri sebagai Ketua KPU. Sebab, selama kekosongan tersebut, KPU kesulitan untuk mengambil keputusan karena hanya memiliki tiga anggota komisioner. Salah seorang komisioner KPU Sumut Rajin Sitepu, Jumat (5/4) mengatakan, pengganti Irham haruslah orang berpengalaman yang berasal dari KPU Sumut atau dari kabupaten/ kota, “Sebaiknya penggantinya berasal dari tubuh KPU itu sendiri. Sehingga dalam pelaksanaan tugas selanjutnya, tidak ada lagi kesulitan dan memang sudah memahami tugas tersebut,” ujarnya. Dia mengungkapakan, pengalaman sangatlah perlu. Sebab jika penggantinya datang dari lembaga luar, pasti membutuhkan proses lagi untuk mempelajari tugas-tugas pokok KPU. “Bayangkan jika orang luar yang ditunjuk sebagai pengganti Irham, itu bakal menjadi masalah. Sementara KPU Sumut saat ini sedang dihadapkan dengan Pemilihan Legislatif (Pileg) yang sudah ada di depan mata,” tegasnya. Dia mengatakan, dengan surat pengunduran Irham dan Turunan Gulo, kini KPU hanya memiliki tiga anggota komisioner. Itu sangat sulit dalam mengambil sebuah keputusan. “Kendala yang kami hadapi dengan pengunduran diri ini, kami akan sulit dalam mengambil keputusan. Dengan tiga anggota, rapat pleno yang kami lakukan tidak memenuhi kuorum. Minimal itu empat orang, baru bisa mengambil keputusan,” sebutnya. Menurut Rajin, seyogiyanya pengganti Irham nantinya adalah anggota yang berada dibawahnya. Yang menentukannya pengganti Irham, bukan dari wewenang KPU Pusat, melainkan KPU Sumut. Nantinya akan dilakukan rapat pleno untuk memilih ketua KPU yang baru. “Nanti jika ada dua komisioner yang baru untuk mengisi kekosongan Irham dan Gulo, baru dilakukan rapat pleno. Suara terbesar dari lima anggota komisioner yang menentukan siapa yang akan duduk sebagai ketua, menggantikan Irham Buana,” ujarnya.(ial/smg)

Pungli di Jembatan Timbang

Rentan Libatkan Banyak Pihak MEDAN- Ketua Komisi A DPRD Sumut Oloan Simbolon memberi apresiasi positif dan sangat setuju pengusutan dugaan pungli yang terjadi di jembatan timbang oleh oknum petugas di Dinas Perhubungan Sumut. Pasalnya, Oloan berkeyakinan, tidak tertutup kemungkinan kasus pelanggaran hukum tersebut melibatkan banyak pihak, baik dari internal Dishub Sumut maupun di luar instansi tersebut. “Pungli di jembatan timbang jangan justru menjadi alat kongkalikong berbagai pihak, karena praktik itu merupakan kejahatan yang sangat merugikan keuangan daerah dan masyarakat,” kata Oloan, Jumat (5/4) Menurut dia, disinyalir praktik pungli di jembatan timbang ini diperkirakan sudah lama berlangsung. Bahkan, ada juga pihak-pihak yang menginginkan perbuatan yang merugikan masyarakat dan keuangan negara ini berlangsung terus. Padahal, tindak kejahatan tersebut, kata politisi Partai Persatuan Daerah (PPD), sering dikeluhkan masyarakat tanpa ada upaya dan tindakan tegas dari penegak hukum. Karena itu, Komisi A yang salah satunya membidangi persoalan hukum, sangat mendukung langkah tegas Kejaksaan Tinggi Sumut, untuk mengungkap kasus pungli tersebut hingga tuntas. “Baru-baru ini, tim penyidik Kejatisu telah memanggil dan memeriksa beberapa staf dan pejabat Dishub Sumut terkait dugaan pungli di jembatan timbang. Salah seorang pejabat yang telah memenuhi panggilan Kejatisu yakni Plt Sekretaris Dishub Sumut Ali Amas,” ujarnya. Menurut Oloan, pemeriksaan terhadap jajaran staf dan pejabat Dishub Sumut tersebut dilakukan bergantian selama dua pekan terakhir Sejalan dengan upaya kejaksaan tersebut, Gubsu Gatot Pujo Nugroho juga perlu mengambil sikap tegas terhadap oknum-oknum pejabat dan staf di jajaran Dishub yang terbukti secara hukum ikut dalam kasus kejahatan tersebut “Tanpa tindakan dan sanksi tegas, praktik pungli di jembatan timbang sulit diberantas hingga tuntas. sehingga Gubsu harus benarbenar serius menuntaskan persoalan ini. Karena masyarakat khususnya para supir sangat dirugikan,” terangnya. Sementara itu, anggota Komisi A DPRD Sumut Syamsul Hilal juga berharap Kejatisu serius mengungkap dugaan pungli tersebut. Bahkan, segera meningkatkan proses pemeriksaan oknum-oknum yang terlibat dari tahap verifikasi, menjadi penyelidikan, penyidikan hingga ada yang ditetapkan sebagai tersangka. “Jangan ada kesan Dishub Sumut seperti instansi yang kebal hukum. Padahal soal indikasi pungli di jembatan timbang itu bukan rahasia umum lagi,” tegas politisi PDIP ini. Sedangkan anggota Komisi A lainnya Syahrial Harahap dari Fraksi PAN juga mensinyalir kontribusi dari jembatan timbang, yang diperoleh dari truk-truk kelebihan tonase tidak sebanding dengan kerusakan infrastruktur jalan yang diakibatkannya. “Yang kita takutkan, pendapatan dari jembatan timbang itu bahkan lebih banyak diambil oknum-oknum untuk kepentingan pribadi daripada masuk ke kas negara,” ucapnya.(adz/smg)


GELAP- Seorang anak memasang lilin untuk menerangi ruangan. Di Sumut masih banyak kepala keluarga yang masih belum menikmati aliran listrik.

421.660 KK Sumut Belum Nikmati Listrik

MEDAN- Hingga Maret 2013, sebanyak 421.660 Kepala Keluarga (KK) di Sumatera Utara (Sumut) masih belum menikmati aliran listrik. Umumnya, mereka berasal dari desa ataupun dusun yang daerahnya masih tergolong sulit dijangkau. Sekretaris Dinas Pertambangan dan Energi Sumut Indra Ginting, Jumat (5/4) mengatakan, pemenuhan kebutuhan engeri listrik untuk KK di Sumut belum mencapat 100 persen. “Saat ini ada 2.611.977 pelanggan KK PLN di Sumut. Namun, rumahnya yang belum dialiri listrik sebanyak 421.660 pelanggan,” sebutnya. Kata dia, rasio elektrifikasi di Sumut hingga Maret 2013 masih sebesar 86,45%. Sementara jumlah KK yang belum

menikmati listrik itu, semuanya tersebar di 1.154 desa dari 5.779 desa yang ada. 165 desa atau dusun berasal dari Kabupaten Tapanuli Utara. “Itulah jumlah KK di Sumut yang belum dialiri listrik baik oleh PLN maupun non PLN,” ujarnya dihadapan peserta Musrenbang 2013 Pemprovsu di Santika Hotel Medan. Ia memprediksi, jumlah KK yang belum dialiri listrik itu akan terus bertambah di masa depan. Sebab, prediksi itu mengacu

kepada rasio pertumbuhan kebutuhan listrik di Sumut yang rata-rata mencapai 7 persen per tahun. Sementara menurut data Bank Indonesia pada triwulan II-2012, Sumut mencatat pertumbuhan ekonomi sebesar 6,29 persen. “Kalau mengacu pada data tersebut, maka kebutuhan listrik pada tahun 2013 mengalami kenaikan 101,08 MW (mega watt) atau menjadi 1.545,08 MW dari 1.444 MW pada Waktu Beban Puncak (WBP) di tahun 2012, dengan daya mampu system sebesar 1.539 MW,” lanjutnya. Indra menjelaskan, berdasarkan daya mampu sistem pembangkitan Sumut pada

Jembatan Layang Simpang Pos Selesai Akhir 2014


IKANNelayan tengah menjaring ikan di tengah laut.

Ikan Habis Dipukat , Nelayan Terjepit MEDAN- Peringatan Hari Nelayan Nasionalkaliinimasihmengidentikkan kawasan pesisir Indonesia sebagai kantong kemiskinan. Begitu juga dengan Sumatera Utara (Sumut), kesejahteraan nelayan tradisional jauh dari harapan. Salah satu penyebabnya karena ikan semakinhabis,lingkunganrusak,illegal fishing semakin merajalela dan banyak persoalan lain. “Nasib nelayan tradisional dari dulu sampai sekarang tak berubah, begini-gini saja,” kata Jamaludin, Ketua Pelaut Rakyat Penunggu Indonesia di Desa Paluh Sibaji, Kecamatan Pantai Labu, Kabupaten Deli Serdang, Jumat (5/4). Menurut Jamal, 20 tahun lalu, nelayan dengan mudah mendapatkan ikan dengan memancing di pinggiran pantai. Ibu-ibu sebagai nelayan perempuan bisa mencari kepah dan kerang di pinggiran pantai dan berpenghasilanlebihdariRp75ribuper hari. Penghasilaninimembantuekonomi keluarga. Selain pendapatan suami yang saat itu lebih besar, karena tangkapan banyak dan harga bagus. Hanya dengan peralatan sederhana,

2012, maka cadangan listrik ideal yang dimiliki harus sebesar 461,7 MW. Namun, akibat kondisi mesin pembangkitan yang sudah uzur dan adanya komponen yang tidak diproduksi lagi, menyebabkan kelebihan daya listrik dari daya mampu hanya sebesar 95 MW. “Sehingga, apabila terjadi kerusakan di salah satu pembangkit utama di PLTGU Sicanang, Belawan atau Paya Pasir, maka pasokan listrik pasti akan terganggu. Kondisi inilah yang dialami KK Kota Medan dalam beberapa pekan terakhir,” tutut Indra.(ram/smg)

hasiltangkapannelayanterbilangbesar, meski lokasi tak sampai 10 mil dari garis pantai. ”Dulu mudah sekali menangkap ikan, istilahnya, dengan memancing sambil menghanyut, bisa dapat ikan karena jumlah melimpah,” kata Jamal lagi. Menurut dia, seiring pergeseran waktu terjadi perubahan drastis. Ikan semakin sulit didapat karena lingkungan rusak. Terumbu karang yang menjadi tempat pemijahan ikan hancur dengan beroperasinya pukat trawl di wilayah tangkap nelayan tradisional. Padahal, menurut Jamal, tidak ada satu pun regulasi yang membenarkan operasional pukat dengan jenis apapun di perairan Sumut. “Mau pukat teri, pukat grandong sampai pukat harimau, tidak boleh beroperasi,” kata Jamal. Kenyataannya, nelayan tradisional kerap kesulitan lantaran jaring yang di pasang habis di angkut pukat trawl yang beroperasi di lokasi sama. Pukat menyapu habis semuanya. “Kalau pukat sudah main, ikan kecil, ikan besar, sampai terumbu karang dan apa

pun yang ada di dalam laut bisa habis di sapu,” ujarnya. Akibatnya, nelayan terpaksa mencari ikan di wilayah yang semakin jauh ke laut lepas bahkan sering ke perbatasan perairan Indonesia dan Malaysia. Di sini, para nelayan berhadapan dengan kapal-kapal besar pencari ikan dengan kapasitas ribuan ton. Mereka pun terpaksa mengambil risiko ditangkap patroli Malaysia. Jika tertangkap, seluruh hasil tangkapan berikut peralatan tangkap dirampas dan disuruh kembali ke darat dengan minyak yang tersisa. ”Itu masih untung, kalau tidak dipukuli, atau di penjara di Malaysia,” ucapnya sedih. Jamal menilai, seharusnya ada perlindungan terhadap nelayan tradisional. Misalnya dengan jaminan 12 mil dari garis pantai bebas dari operasional kapal penangkap ikan yang peralatannya modern. “Jangan sampai bercampur di lokasi yang sama dan saling berhadapan, nelayan tradisional pasti kalah,” kata Jamal.(kps/int)

MEDAN- Pembangunan jembatan layang atau (fly over) di Simpang Pos, Kota Medan, diperkirakan selesai pada akhir 2014, karena saat ini pembangunannya telah berjalan. “Jika tidak ada arah melintang, pembangunan fly over Simpang Pos ini akan selesai pada Desember 2014. Untuk itu, kita akan terus bekerja keras merealisasikannya,” kata Kepala Satuan Kerja Pelaksanaan Jalan Nasional Metropolitan Medan Mula Tua Sinaga di Medan, Kamis kemarin. Menurut dia, saat ini pihaknya fokus pada penyelesaian pembangunan fly over Simpang Pos. Setelah itu akan fokus dua fly over lagi yakni fly over Pinang Baris dan fly over Jalan Gatot Subroto. Kemudian underpass Titi Kuning di Jalan Brigjen Katamso. “Untuk pembangunan underpass Titi Kuning, kini dalam tahap studi. Pembangunan fly over Pinang Baris sudah dalam tahap desain. Sedangkan satu lagi, kita sekarang sedang berjuang untuk membangun fly over Jalan Gatot Subroto. Sehingga dapat menjadi bagian fly over yang ada di Kota Medan,” katanya. Wali Kota Medan Rahudman Harahap juga menyempatkan meninjau pembangunan jalan fly over Simpang Pos tersebut. Kedatangannya untuk mengetahui sejauh mana proses pem-

bangunan yang sudah dilakukan. “Wali Kota juga ingin mengetahui apa yang menjadi kendala, sehingga mengganggu kelancaran pembangunan jembatan layang kedua di ibukota provinsi Sumut ini setelah fly over Pulo Brayan tersebut,” paparnya. Menurut Mula Tua, dari hasil peninjauan yang dilakukan, ia menilai proses pengerjaan jembatan fly over Simpang Pos yang dilakukan saat ini termasuk cepat. Rencananya, bulan ini, kiri kanan jalan sudah bisa dipergunakan supaya full pembuatan tiang tengah. Sebab, titik fokus pembangunan fly over adalah tiang tengah ini. “Karena itu saya berharap jangan ada lagi kendala-kendala sehingga mengganggu kelancaran pembangunan fly over,” ujarnya. Berdasarkan informasi yang diperoleh, kata dia, salah satu kendala yang mengganggu kelancaran pembangunan fly over terkait terjadinya kemacetan arus lalu lintas. Ternyata yang menjadi penyebabnya adalah kehadiran sejumlah stasiun-stasiun liar. “Untuk itu saya minta Satlantas Polresta Medan dan Dinas Perhubungan Kota Medan berkoordinasi untuk mengatasinya. Saya minta secepatnya harus ditertibkan agar pengerjaan fly over dapat berjalan dengan baik dan lancar,” katanya.(ant/int)

Semua KA Sumut Pakai AC MEDAN- Kereta Api (KA) di Sumut semua dilengkapi pendingin udara (AC). Itu salah satu upaya manajemen PT Kereta Api Indonesia (KAI) untuk meningkatkan pelayanan secara nasional. “Jurusan Medan-Tanjung Balai, MedanRantau Prapat dan Medan-Siantar, semuanya sejak akhir Februari 2013 sudah pakai AC. Di Jawa, masih ada KA yang belum memakai faslitas itu,” kata Humas PT KAI Divre I Sumut-Aceh Rapino Situmoroang, Kamis kemarin. Menurut dia, penggunaan AC itu dilakukan sejalan dengan pembenahan stasiun dan perubahan jadwal keberangkatan kereta api yang diberlakukan mulai 1 April. Perubahan jadwal keberangkatan KA dilakukan untuk memenuhi keinginan pasar. Mereka meminta agar jadwalnya bersinergi dengan transportasi lainnya. Sekaligus untuk

menyesesuaikan dengan jam penerbangan di Bandara Kualanamu pengganti Polonia, Medan. “Dengan tambahan fasilitas AC dan layanan yang lebih maksimal, tarifnya juga naik. Tetapi dewasa ini untuk promosi, manajemen masih menjual tiket dengan harga lebih murah,” katanya. Kata Rapino, untuk Medan-Tanjung Balai misalnya, harusnya Rp45 ribu per orang menjadi Rp30 ribu per orang. kemudian Medan-Siantar dari harga Rp40 ribu per orang menjadi Rp30 ribu per orang. Anggota DPD RI utusan Sumut Parlindungan Purba mengaku, upaya manajemen KAI membenahi fasilitas dan layanan memang sangat diharapkan. “Penggunaan yang tinggi pada KA akan (FOTO:INT) sangat membantu pemerintah menekan kemacatan lalulintas di jalan lintas Sumut,” FASILITAS- Para penumpang dengan nyaman menikmati fasilitas yang ada di kereta api. terangnya.(ant/int)

SABTU 6 April 2013

Petani Mamuro... Sambungan Halaman 8

dan malam. Mamuro rata-rata dilakukan sekira 30 hari, yakni sejak tanam mengeluarkan bunga (bulir) padi hingga waktu panen tiba. Menurut salah seorang warga Nur Aisyah (21), sejak bulir padi keluar, dirinya harus menjaga dan mengusir burung dari pagi hingga sore. Malamnya, suaminya akan berganti menjaga untuk mengusir babi yang kerap menyerang tanaman saat tengah malam hingga menjalang pagi. “Dari jam 6 pagi hingga jam 6 sore, harus diawasi agar jangan sampai dihabiskan burung,” katanya. Namun malam juga harus dijaga dari gangguan babi. Kalau tidak, habislah dirusaknya,” sebutnya. Melihat areal persawahan yang berada di tengah hutan dengan dikelilingi semak belukar, tentunya tidak bisa aman dari gangguan binatang. Gangguan terhadap tanaman padi akan mulai dirasakan ketika kondisi padi sedang bunting. Sedangkan jenis binatang yang kerap menganggu, adalah tikus, kera, beruk

dan babi. Jika tidak di jaga, tanaman akan dirusak dan diacak-acak. Sementara ketika bulir padi telah keluar, penjagaan harus semakin ditingkatkan, guna menjaga tanaman yang diambang panen itu dari gangguan burung dan babi. Sekalipun perjuangan mereka begitu berat untuk mendapatkan bahan makanan pokok, namun kebutuhan mereka masih belum terpenuhi. “Sekalipun hasilnya normal dan panen dua kali dalam setahun, namun itu belum mencukupi kebutuhan pangan. Tetap saja kami membutuhkannya dari luar (pasar),” kata warga lainnnya, Sorta Ritonga (50) dan Pangaloan Siregar (50). Dengan ketersediaan air, warga telah menerapkan pola tanam dua kali setahun. Pemupukan juga sudah diterapkan secara teratur, sekalipun harganya cukup tinggi akibat ongkos pengangkutan. “Ongkos pengangkutan dari Sipagimbar ke sini Rp2 ribu per kilogram,” kata mereka sembari menjelaskan mereka belum pernah mendapatkan bantuan penyuluhan untuk meningkatkan produktifitas pertaniannya. (ran)

Lapas Sibolga Over Kapasitas Sambungan Halaman 8

lapas mayoritas dihuni oleh tahanan kasus narkoba atau sebesar 45 persen. “Sejak peredaran narkoba meningkat, penghuni lapas mengalami over kapasitas. Seharusnya kapasitas lapas hanya 332 orang atau lima orang untuk satu ruang tahanan. Tapi saat ini kita menampung 480-500 orang tahanan atau sembilan orang per ruangan,” ujar Kepala Lapas Sibolga Marasidin Siregar kepada METRO, saat ditemui di ruang kerjanya, Jumat (5/4). Marasidin mengakui optimalisasi kerja mereka menjadi kurang karena tidak sesuai lagi jumlah pegawai dengan jumlah tahanan yang ada. “Saat ini kita hanya punya 42 pegawai, terdiri dari 25 orang regu pengamanan yang dibagi dalam empat shift, pagi, siang, malam dan waktu istirahat. Seharusnya untuk regu pengamanan idealnya 15 orang setiap shift-nya. Selain kekurangan pegawai, kita juga sangat kekurangan alat pengamanan,” ungkapnya. Mantan Kalapas Narkotika Jogja ini menuturkan, untuk ruang kunjung, Lapas Sibolga juga sangat membutuhkan renovasi. Sebab tak jarang pihak lapas mempergunakan teras kantor sebagai tempat penerimaan tamu tahanan. “Saat ini ruang kunjung kita hanya berukuran 4x6 meter untuk jumlah tahanan 500 orang. Kadang kita ambil alternatif dengan memanfaatkan teras kantor untuk bertamu. Karena kalau tidak kita lakukan seperti itu, maka antrean di luar lapas akan sangat panjang,” terangnya. Pria yang baru satu tahun menjabat Kalapas Sibolga ini juga menceritakan, saat ini lapas sudah membina beberapa orang tahanan dengan berbagai keterampilan seperti bagian pertukangan dan menjahit pakaian. “Kalau dilihat hasil yang mereka

buat itu tak kalah dengan yang ada di luar sana. Bahkan, sekarang pakaian saya dijahit oleh tahanan. Saya bangga dengan kemajuan yang mereka alami. Saat ini hanya itu keterampilan yang kita bina, karena kekurangan tenaga pekerja. Saat melakukan pelatihan kita membutuhkan perhatian dan pengawasan yang ketat, jadi harus membutuhkan pengawas yang sesuai jumlah yang diawasi,” katanya. Oleh sebab itu Marasidin sangat mengharapkan bantuan dari pemerintah untuk penyesuaian pegawai dengan jumlah tahanan yang ada, serta perluasan daerah agar dapat menampung semua penghuni lapas dengan jumlah yang ideal untuk per ruangan tahanan. Karena di Sibolga belum mempunyai lapas khusus narkotika, sehingga harus digabung dengan tahanan pelaku kejahatan lain. “Sebenarnya kita sudah sering ajukan permohonan ke pemerintah pusat untuk penambahan anggota dan perluasan wilayah. Agar jumlah pegawai dengan jumlah tahanan sesuai untuk mengoptimalisasi pekerjaan kita. Juga untuk jumlah ruang tahanan yang tak lagi memadai, kita sudah ajukan agar dilakukan penambahan ruangan sehingga per ruangan dapat diisi lima orang, tidak seperti sekarang sampai sembilan orang per ruangan,” tandasnya. “Kami selalu menunggu realisasi dari pemerintah untuk permohonan yang telah kita ajukan. Mudah-mudahan pemerintah memenuhi permohonan kami agar kegiatan di lapas ini bisa lebih dioptimalkan lagi,” pungkasnya. Pantauan METRO, akibat jumlah tahanan yang membludak serta ruang tamu tahanan yang tidak memadai, membuat antrean panjang para pengunjung lapas yang hendak menjenguk tahanan sering terjadi. (samuel)

Warga Harapkan Perbaikan Sambungan Halaman 8

kanan untuk menghindari bibir jurang. Kondisi ini tentunya mengundang bahaya jika secara tiba tiba datang kendaraan lain dari arah berlawanan. Sehingga pengguna jalan harus hati-hati saat melintas. Warga sekitar yang merasa peduli, membuat gundukan tanah sebagai

aba-aba agar penmgguna jalan lebih berhati-hati. Menurut R Ritonga (47) dan Binsar (34), keduanya warga setempat, longsor di lokasi sudah terjadi sejak 2 bulan lalu. “Memang awalnya di sini dijadikan tempat pembuangan sampah. Sekira 2 bulan lalu, kampung ini diguyur hujan deras. Saat itulah tebing di

pinggir jalan lintas ini mengalami longsor. Tapi sampai sekarang belum diperbaiki. Padahal sering kenderaan yang nyaris tabrakan karena posisinya berada di tikungan dan menurun,” terangnya. Salah seorang pengendara Janes Hutabarat (22) yang sempat diwawancarai METRO mengatakan, ia sangat was-was jika melintas di

30 Tahun Tak Diaspal Sambungan Halaman 8

dialiri lumpur yang mengalir dari jalan, yang berjarak 100 meter dari persimpanganmenujuSMKN1Sipiroktersebut. Menurut warga Hj Nurlela Hutasuhut atau Ompu Desi (66), mereka sangat berharap jalan tersebut segera diaspal, agar suasana pemandian menjadi bersih dan warga yang datang dari berbagai penjuru merasa nyaman. “Panjangnya hanya 100 meter. Memang petugas dari Pemkab Tapsel sudah beberapa kali meninjau dan mengukur.

Namun pembangunannya tak kunjung ada,” ucapnya. Dikatakannya,jikahujanturun,kondisi jalan tidak saja berlumpur, tetapi terkikis air sisa hujan. Untuk mengantisipasi terkikisnya badan jalan, secara swadaya OmpuDesiyangjugamemilikikedaikopi di dekat pemandian tersebut, mengupayakan penimbunan 3 kali dalam 2 tahun. “Sebanyak 3 kali dalam 2 tahun secara rutin harus ditimbun dengan volume 3 truk sirtu. Kalau tidak, kendaraan tak bisa masuk. Kiranya pemerintah melakukan

pengaspalan jalan ini,” harapnya. Diamenuturkan,jalantersebutterakhir kali mendapat pembangunan pada tahun1980-an.Namunakibatkurangnya perawatan dan perhatian, kondisinya semakin rusak. “Terakhir jalan itu dibatu saja (telford). Saya yakin kalau pemerintah tak turun tangan, apapun upaya pembangunan akan sulit diwujudkan,” ujarnya seraya berharap di tahun 2013 jalan diaspal. Amatan METRO, Jumat (5/4), lokasi Pemandian Aek Milas yang ada di Desa Paran Dolok tersebut selalu ramai di-

Sambungan Halaman 8

DR Ir Erwin Masrul Harahap MS yang merupakan rektor lama, kembali mendaftar bersama Dra Sulhana Lely Lubis Ak MM. Demikian disampaikan Ketua Panitia Penjaringan Pemilihan Rektor UGN Ir H Darmadi E Harahap SPd MM MP didampingi Sekretaris Drs Yuswin Harputra MPd dan Anggota Siti Nurbaya Harianja Map kepada METRO, Jumat (5/4). Dikatakan Darmadi, pendaftaran resmi ditutup tanggal 5 April, jika telah memenuhi kuota sebanyak dua orang.

Dimana pendaftar terakhir yang mendaftar sebelum perpanjangan pendaftaran merupakan rektor lama. “Karena jumlah pendaftar telah memenuhi kuota, maka hari ini resmi kita tutup pendaftaran. Namun sekiranya hanya satu orang saja yang mendaftar, kita akan memperpanjangnya hingga 8 April,” sebut Darmadi. Sementara Profesor Erwin datang mendaftar sebelum pendaftaran ditutup sekira pukul 16.30 WIB. Di sana, ia menyerahkan berkas pendaftaran didampingi Dekan Fisipol Drs Yusril Harputra MAp dan Dekan Teknik Ir Marzuki Harahap ME kepada panitia

penjaringan pemilihan rektor UGN di Kampus II Fakultas Pertanian Tor Simarsayang. Di tempat yang sama, sekretaris panitia penjaringan pemilihan rektor Yuswin Harputra mengatakan, sesuai hasil rapat senat UGN bahwa setiap bakal calon rektor harus memenuhi persyaratan persetujuan dari Yayasan Darma Bakti Pendidikan Indonesia (YADPI). Dua calon pendaftar tersebut tidak dapat diterima tanpa ada persetujuan dari pihak YADPI sesuai aturan yang telah ditetapkan. Dimana yang mengangkat dan melantik Rektor UGN

pengunjung dihibur sajian musik dari grup band Grasshoper yang cukup dikenal di ibu kota. Sepasang vokalis pria dan perempuan saling bersahutan menyanyikan lagu-lagu hit masa kini. Di belakang mereka, pemain gitar, bas, dan drum sibuk dengan alat musik masing-masing. Tak ada yang aneh pada penampilan grup tersebut. Baru ketika acara usai pukul 23.00, terlihat perbedaan di antara mereka. Drumer yang duduk di depan simbal harus dipapah seseorang untuk turun dari panggung dan menuju kursi sofa paling depan. Segelas lemon tea dingin langsung dia seruput sambil tetap memegang dua stik drum di tangan kanan. Ya, itulah penampilan Permas Alamsyah atau yang biasa dipanggil Alam, anggota grup band Grasshoper yang tunanetra. “Capek, mulai pukul delapan (20.00 WIB) nge-drum terus,” ujarnya sambil masih mengatur napas. Beberapa tamu kafe yang sudah lama mengenal Alam menuju meja sang drumer untuk berpamitan. Mereka harus mencari telapak tangan Alam di bawah meja untuk menyalaminya. Lalu, satu per satu personel Grasshoper juga pamit. Dengan kebutaan yang dialami sejak lahir itu, Alam tidak pernah merasa rendah diri. “Alhamdulillah, teman-teman percaya saya bisa nge-drum dengan baik,” ungkapnya. Keahliannya menggebuk drum juga pernah diapresiasi

adalah YADPI. “Untuk memenuhi persyaratan, pendaftar harus menyertakan persetujuan dari pihak Yayasan (YADPI) sebagai salah satu persyaratan mutlak,” ujar Yuswin. Selain itu, setiap balon berpendidikan serendah-rendahnya S-2, juga pernah menjabat sebagai Pimpinan Fakultas atau Universitas. Itu dibuktikan dengan SK pengangkatan. Kemudian mempunyai keahlian dan integritas ilmiah, serta pernah mengikuti pendidikan kursus, lokakarya dan seminar tentang kepemimpinan yang dibuktikan dengan sertifikat dan lainnya, sesuai tatib dan statuta yang ditetapkan. (tan)

DPD PKS Tapsel Gelar Rihlah Sambungan Halaman 8

rapkan tercipta kebersamaan hubungan silaturahmi yang tinggi. Selain itu dapat menghilangkan kepenatan setelah bekerja keras pada Pigubsu 7 Maret lalu,” ucap Ketua DPD PKS Tapel Edi Hasan Lc kepada METRO, Jumat (5/4). Disamping itu, sebut Ustad Edi, melalui kegiatan bernuansa islami

tersebut, diharapkan dapat meningkatkan kekompakan dan kesolidan seluruh kader dalam menyongsong pemilu 2014 mendatang. “Satukan langkah dalam indahnya ukuwah. Semoga dapat memberikan taujih kepada seluruh peserta tentang pentingnya kekompakan keluarga kader menyongsong pemenangan dakwah di 2014,” sebutnya.

Disebutkannnya, selain ceramah, kegiatan diisi dengan berbagai lomba dan permainan, dizkir dan Salat Tahujjud bersama. Sehingga diharapkan dapat menimbulkan semangat dalam diri untuk lebih menamankan keyakinan yang mantap terhadap Allah dan perjuangan dalam partai dakwah. “Semua kader diharapkan mampu menanamkan bahwa berjuang di partai

dakwah adalah bagian dari jihad untuk menunjukkan peran menyelamatkan bangsa dari keterpurukan. Kemenangan mutlah milik Allah dan akan diberikannya pada siap saja yang dikehenadakinya,” terangnya. Adapun peserta rihlah tersebut adalah 150 orang yang merupakan kader, pengurus Pimpinan cabang beserta keluarga. (ran)

PNS Tapteng Belajar Bahasa Inggris Sambungan Halaman 8

di Tapteng dalam mewujudkan program Negeri Wisata Sejuta Pesona. Sebagai daerah wisata, maka PNS di Tapteng juga dituntut mampu berkomunikasi dalam bahasa internasional,” ungkap Kabag Humasy Pemkab Tapteng Iwan RM Sinaga, Jumat (5/4). Bahkan, sambung Iwan, belajar bahasa Inggir tersebut dicanangkan langsung oleh Bupati Tapteng Raja Bonaran Situmeang. “Bapak Bupati juga ikut private atau kursus bahasa Inggris. Beliau juga instruksikan ke seluruh jajaran dinas/

instansi pemerintah. Bahkan, wajib,” ungkap Iwan. Sementara itu, Kadis Kehutanan dan Perkebunan Tapteng Darmi Siahaan mengatakan, pegawai di dinasnya mulai private awal April ini. Menurutnya, bahasa Inggris merupakan bahasa komunikasi internasional. Dalam tugas sebagai abdi negara, PNS juga berhubungan dengan dunia internasional. Karena itu, PNS dituntut mengusai bahasa Inggris, baik tulisan maupun lisan. “Di zaman sekarang, penguasaan bahasa Inggris dituntut pada hampir semua bidang. Kami sendiri mulai private April nanti. Gurunya sudah

oke, sudah ada dan jadwalnya dua kali dalam seminggu pada jam kerja. Targetnya sampai mahir. Seluruh pegawai harus ikut,” ujar Darmi. Evi Marini Simanjuntak, guru English private yang akan mengajar PNS di Dinas Kehutanan dan Perkebunan Tapteng mengatakan, ada empat keahlian kunci dalam mempelajari sebuah bahasa, termasuk bahasa Inggris. Di antaranya listening (mendengarkan), speaking (berbicara), reading (membaca) dan writing (menulis). Tapi yang memiliki tantangan dan keunikan tersendiri tentu speaking. Speaking, kata Evi berbeda dari listening, reading dan writing (me-


Museum Rekor Dunia Indonesia (Muri). Alam masuk dalam catatan museum bikinan budayawan Jaya Suprana itu sebagai pemain drum tunanetra profesional pertama di Indonesia pada 2008. Kiprahnya di dunia musik tanah air juga diakui para musisi. Tak terhitung penyanyi terkenal pernah diiringinya. “Banyak sekali ya, hampir semua penyanyi terkenal di Indonesia pernah saya iringi,” ucapnya bangga. Dia menyebut beberapa nama seperti Ari Lasso, Yuni Shara, Krisdayanti, Agnes Monica, Titi Puspa, Dewi Yull, Once, Glen Fredly, dan banyak lagi. Mereka diiringi grup band Grashoper dalam acara yang berbeda-beda. Alam juga pernah mengiringi empat presiden RI bernyanyi. “Bu Mega (Megawati Soekarnoputri), Pak SBY (Susilo Bambang Yudhoyono), dan Gus Dur (KH Abdurrahman Wahid) pernah saya iringi. Zaman Pak Habibie (B.J. Habibie) juga pernah di istana,” lanjutnya. Melihat kemampuannya memainkan drum yang di atas rata-rata, orang mungkin tidak mengira bahwa Alam adalah seorang tunanetra. “Secara kasatmata, orang nggak tahu bahwa saya tunanetra. Apalagi, dulu rambut saya panjang. Sekarang saja agak botak,” ujarnya lalu tertawa lebar. Dengan keahliannya ngedrum, grup-grup band pun berebut untuk menggaetnya. Saat ini Alam bergabung dengan empat grup band sekaligus. Selain Grasshoper, dia main untuk Milky Way, Old Crack, dan

kunjungiwargadariluardaerah,terutama pada hari libur. Sayangnya kondisi jalan sepanjang 100 meter dari persimpangan menujuSMKN1Sipirokitu,masihberupa jalan tanah. Sama halnya dengan areal parkir yang ada. Tentunya melalui sentuhan pemerintah dalam mengalokasikan pengaspalan jalan tersebut, ke depan warga yang berkunjung akan merasa nyaman dan membuatpeluangpeningkatanekonomi warga setempat. Selain itu, lokasi diharapkan menjadi sumber PAD melalui perparkiran dan retribusi lainnya. (ran)

Pendaftaran Balon Rektor UGN Ditutup

Punya Empat Grup Band, P ernah Iringi Empat Pr esiden Pernah Presiden Sambungan Halaman 1

jalan tersebut. “Saya takut jika tiba-tiba datang kendaraan dari arah bawah,” sebutnya. Untuk itu ia berharap, pemerintah melalui instansi terkait segera mengambil tindakan untuk menghindari kejadian yang tidak diinginkan dan menimpa masyarakat pengguna jalan. (ran)

Yeah-Yeah Boys. Uniknya lagi, empat band itu memiliki aliran musik berbeda-beda. “Soal lagu-lagunya, bergantung permintaan penonton. Lagu lama atau lagu mutakhir kami layani. Mau pop, rock, bahkan dangdut, bisa diatur,” tegasnya. Agar empat grup band tersebut bisa memanfaatkan tenaganya, Alam membagi jadwal bermain untuk masing-masing grup. Untuk Minggu malam, dia tampil bersama Grasshoper di Prestige Dining Kemang dan Senin malam di Lagoon, Hotel Sultan. Lalu, Selasa malam, Alam ganti bergabung dengan Milky Way di XXI Lounge Plaza Senayan. Jadwal manggung Rabu malam kembali bersama Grasshoper di Space Cafe Kemang. Kamis, Jumat, dan Sabtu, dia manggung bersama Old Crack atau Yeah-Yeah Boys. “Kadang nggak tentu, bergantung panggilan teman yang dapat job. Yang rutin ya sama Grasshoper dan Milky Way,” terangnya. Alam menjelaskan, Milky Way adalah grup band milik Chappy Hakim, mantan kepala Staf Angkatan Udara. Alam mengaku kenal dekat dengan sang jenderal itu. Seusai pensiun dari TNI, Chappy memang mengisi hariharinya dengan bermain musik dan membentuk grup band yang berpersonel Alam itu. Sesekali Chappy ikut naik ke panggung memainkan alat musik seperti gitar atau saksofon. “Terkadang Pak Chappy nyanyi. Suaranya enak,” tuturnya. Meski keahliannya menggebuk drum sudah sangat mum-

puni, Alam tetap rajin berlatih dengan grup-grup bandnya, minimal seminggu sekali. Apalagi, bila mendapat job besar, dia bersama bandnya perlu berlatih dua jam sebelum pentas. “Kami harus menghargai orang yang mengundang. Kami harus tampil maksimal agar tidak mengecewakan,” imbuh Alam. Begitu larisnya Alam, tak heran bila pundi-pundi uangnya terus mengalir deras. “Sekali tampil, minimal Rp 500 ribu di kantong. Bahkan bisa lebih besar. Bergantung acaranya,” ungkapnya. Dari penghasilannya itu, Alam mampu menghidupi lima anaknya “dua di antaranya tunanetra” yang mulai besar-besar. Istrinya yang juga tunanetra bekerja sebagai customer service di Hotel Grand Melia Jakarta. Selain manggung, Alam menerima order sebagai drumer pendukung dalam pembuatan album beberapa artis. “Album country-nya Tantowi Yahya dan Mbah Surip itu, saya yang ngisi drumnya,” tambahnya. Lantas, bagaimana Alam menjalani aktivitasnya seharihari yang cukup sibuk dan mobile dengan kondisi tidak bisa melihat” Pria kelahiran 3 November 1965 itu mengaku, handphone-nya sudah diinstal software yang bisa mengubah tulisan menjadi suara. “Jadi, kalau ada SMS masuk, saya bisa langsung mendengarkan. Itu juga bisa untuk tulis status atau menjawab komentar teman di Facebook,” ungkapnya. HP Alam sekilas memang tidak berbeda dengan HP pada

umumnya. Hanya, bagi Alam, penggunaannya agak lain. Dia mesti menempelkan HP-nya ke kuping jika ingin mengetahui pesan (SMS) yang masuk. Setelah itu, ganti jari-jari tangannya yang sudah terampil menghafalkan semua tombol huruf memencetmencet membuat tulisan. “Teman saya yang pasang software ini. Bisa dipasang di HP apa saja,” ujarnya. Pria yang sekarang tinggal di Jalan Jatibarang Raya, Rawamangun, Jakarta Timur, tersebut memiliki kesibukan seabrek. Selain nge-band saat malam dan berlatih waktu siang, Alam dipercaya menjadi wakil bendahara Pertuni (Persatuan Tunanetra Indonesia) dan menjabat bendahara umum PPDI (Persatuan Penyandang Disabilitas Indonesia). “Saya ke mana-mana sendirian naik taksi, tinggal minta jemput dan antar ke tujuan,” tambahnya. Dia bersyukur hingga saat ini tidak pernah mendapat sopir taksi yang nakal, yang memutarmutarkan jalan atau menaikkan tarif yang harus dibayar. Menurut dia, yang mengkhawatirkan bagi penyandang tunanetra seperti dirinya justru pelayanan yang diberikan maskapai penerbangan. “Untung, saya kalau terbang selalu bareng teman-teman. Kalau pergi sendirian, suka diminta mengisi surat pernyataan macam-macam,” jelasnya. (*/ c5/ari)

nulis). Ketiganya mungkin bisa dilakukan sorang diri, sesuai keinginan. Tanpa memerlukan bantuan orang lain. Misalnya, bisa mendengar radio, baca buku, menulis surat sendiri. “Tapi kita tidak bisa berbicara sendiri. Coba saja bicara sendiri, nanti malah kita yang dianggap gila. Nah, program belajar English yang dicanangkan Pemkab Tapteng bagi para PNS setidaknya agar mampu untuk speaking. Dalam era globalisasi, apalagi Tapteng sebagai daerah wisata, tentu menuntut aparatur pemerintahnya bisa berbahasa Inggris. Itu sebuah pemikiran yang maju,” ucapnya. (mora)

Dihadiahi Lagu Romantis Sambungan Halaman 1 menyambut pernikahannya yang sudah semakin dekat. “Lagunya galau melulu, nanti malah kebawa sedih. (Makanya) aku minta ciptain lagu romantis untuk pertama kalinya,” ujar Duma Riris saat ditemui bersama Judika, di restoran KFC, di kawasan Gunawarman, Jakarta Selatan. “Ini lagu melewati masa galau, buat mereka yang saling mencintai satu sama lain,” imbuh Judika yang sempat mendapat penolakan dari orangtua Duma. Berbagai persiapan lainnya pun telah dilakukan oleh pasangan ini jelang hari bahagia. Judika pun mengaku makin rajin kejar setoran jelang

pernikahannya. Pernikahan mereka kabarkan akan dihelat November 2013 mendatang. “Semakin sering kerja, cari duit untuk biaya. Beli rumah buat tempat kita nanti. Buat aku dan dia satu hal prioritas bersama ya kerja dulu yang rajin,” ungkapnya. Meski yakin akan menikah pada November ini, Judika masih sedikit harap-harap cemas karena belum menemukan lokasi pernikahan. “Karena kita tanya semua full, gedung masalah utama, full sampai Desember. Kita mau bulan 8-10. Spesial buat kita ya itu. Mudah-mudahan dalam waktu dekat sudah fix,” harapnya. (int)

Arti Kasih Sayang Ibu Sambungan Halaman 1 semua kasih sayang dan cinta yang ibu miliki dengan tulus. Dan sampai detik ini pun kasih sayang dan cinta itu tidak berkurang. Nak, Ibu tidak ingin kamu nanti pulang tersesat dan mendapat celaka di jalan. Makanya ibu tadi mematahkan ranting-ranting pohon, agar bisa kamu jadikan petunjuk jalan”. Demi mendengar kata-kata ibunya tadi, hancurlah hati si anak. Dia peluk ibunya erat-erat sambil menangis. Dia membawa kembali ibunya pulang, dan ,merawatnya dengan baik sampai ibunya meninggal dunia. Mungkin cerita diatas hanya dongeng. Tapi di jaman sekarang, tak sedikit kita jumpai

kejadian yang mirip cerita diatas. Banyak manula yang terabaikan, entah karena anak-anaknya sibuk bisnis dll. Orang tua terpinggirkan, dan hidup kesepian hingga ajal tiba. kadang hanya dimasukkan panti jompo, dan ditengok jkalau ada waktu saja. Kiranya cerita diatas bisa membuka mata hati kita, untuk bisa mencintai orang tua dan manula. Mereka justru butuh perhatian lebih dari kita, disaat mereka menunggu waktu dipanggil Tuhan yang maha kuasa. Ingatlah perjuangan mereka pada waktu mereka muda, membesarkan kita dengan penuh kasih sayang, membekali kita hingga menjadi seperti sekarang ini. (int)


SABTU 6 April 2013


Warga Harapkan Perbaikan (FOTO AMRAN POHAN)

„ Seorang warga menunjukkan longsor di Pasar Simangambat yang dikhawatirkan bisa mengundang bahaya.

TAPSEL- Pemerintah melalui Dinas Pekerjaan Umum yang membidangi jalan dan jembatan, diharapkan peka terhadap keluhan masyarakat dan pengguna jalan terkait kondisi fasilitas yang bisa membahayakan.

Seperti yang terjadi di jalan provinsi Sipirok-SimangambatSipagimbar, dimana ada beberapa titik kerusakan jalan. Sampai saat ini belum ada penanganan maupun perbaikan yang dilakukan, padahal jika dibiarkan, bisa membahayakan pengguna jalan. Pantauan METRO pada longsor di sekitar Pasar Simangambat, Kelurahan Aek Simotung, Saipar Dolok Hole (SDH), Tapsel, posisinya berada di jalan menurun dan di tikungan. Hal itu dianggap sangat membahayakan pengguna jalan. Sekitar 10 meter sisi kiri jalan terlihat mengalami longsor dengan kedalaman 4 meter. Beberapa kendaraan yang melintas tampak mengambil jalur

„) Baca Warga ....Hal 7


MAMURO- Nuraisyah bersama adiknya sedang mamuro (menjaga tanaman padi dari serangan binatang) di sawah mereka.


„ Kondisi jalan menuju Aek Milas Paran Dolok, berjarak 100 meter dari persimpangan menuju SMKN 1 Sipirok yang butuh pengaspalan.


30 Tahun Tak Diaspal SIPIROK- Jalan menuju Pemandian Aek Milas Paran Dolok, yang berbatasan dengan Desa Padang Bujur, Kecamatan Sipirok, Tapanuli Selatan, sudah selayaknya disentuh pembangunan. Sejak dibangun pada 1980-an (lebih dari 30 tahun lalu), jalan sepanjang 100 meter itu hanya berupa timbunan sirtu (campuran pasir, tanah dan batu).

Kini, saat hujan mengguyur, lokasi akan berlumpur. Sedangkan ketika kemarau tiba, jalan ini akan berdebu. Hal itu mengganggu kenyamanan warga yang hendak mandi, juga mengurangi kebersihan lokasi pemandian. Sebab warga setempat tampak kesulitan membersihkan pemandian yang

Petani Mamuro Siang-Malam TAPSEL- Untuk mendapatkan hasil maksimal dari tanaman padi di sawah, warga Kampung Sigiringgiring, Desa Sunge Siring giring, Saipar Dolok Hole (SDH), Tapsel, melakukan mamuro (menjaga tanaman padi)

siang maupun malam. Bagi warga setempat, budaya mamuro ini sudah biasa dilakukan. Siang hari, tanaman padi dijaga kaum ibu dan malam hari oleh kaum bapak. Hal itu dilakukan agar tanaman bisa mendatang-

kan hasil yang maksimal untuk kebutuhan dan terjaga dari serangan binatang seperti babi dan burung. Alhasil, jika musim mamuro telah tiba, warga akan sulit ditemukan di perkampungan. Pasalnya mereka

lebih memilih berdiam di areal pertanian untuk menjaga tanaman dari gangguan binatang. Bahkan tak jarang warga yang menetap sementara di areal pertanian siang

„) Baca Petani...Hal 7

Pendaftaran Balon Rektor UGN Ditutup

„) Baca 30 Tahun...Hal 7

SIDIMPUAN- Pendaftaran Rektor Universitas Graha Nusantara (UGN), hari ini (5/4) resmi ditutup. Berdasarkan hasil rapat senat, pendafataran

ditutup jika telah memenuhi kuota, yakni minimal dua orang. Dan hingga kemarin, Prof

„) Baca Pendaftaran...Hal 7


„ Marasidin Siregar.


„ Kegiatan rihlah DPD PKS Tapsel yang bertujuan meningkatkan kesolidan menuju dakwah 2014.

Lapas Sibolga Over Kapasitas SIBOLGA- Lembaga pemasyarakatan Sibolga over kapasitas. Lapas yang mestinya dihuni 332 orang, saat ini dihuni 500 tahanan Peningkatan jumlah tahanan di Lapas Sibolga diakibatkan maraknya peredaran narkoba di Sibolga dan Tapteng. Saat ini

„) Baca Lapas ...Hal 7

Tingkatkan Solidaritas Kader

DPD PKS Tapsel Gelar Rihlah


„ Prof DR Ir Erwin Masrul Harahap MS menyerahkan berkas pendaftaran kepada Ketua Panitia Ir H Darmadi Harahap, Jumat (5/4).

TAPSEL- Untuk meningkatkan rasa solidaritas, pengurus dan kader DPD PKS Kabupaten Tapsel menyelenggarakan rihlah di Brastagi, Tanah Karo dan Parapat, Simalungun, Jumat (29/3) sampai Sabtu (30/3) lalu. Kegiatan itu merupakan salah satu sarana membina kader dalam rangka menjalin rasa

solidaritas antara sesama kader PKS, guna meningkatkan kebersamaan, kekompakan menyongsong dakwah 2014. Kegiatan juga sekaligus menambah ilmu keislaman tentang alam. “Melalui kegiatan ini, diha-

„) Baca DPD...Hal 7

PNS Tapteng Belajar Bahasa Inggris PANDAN- Semangat Pemkab Tapteng dalam mewujudkan program Negeri Wisata Sejuta Pesona diwujudkan dengan meningkatkan kualitas para PNS-nya. Salah satu strateginya, PNS di kabupaten tersebut diwajibkan belajar Bahasa Inggris. “Ya, program belajar bahasa Inggris ide Bupati Tapteng tersebut mulai tahun ini. Itu merupakan salah satu cara meningkatkan kualitas SDM PNS

„) Baca PNS...Hal 7

a 0


6 April 2013

Kejatisu Diminta Turun

USUT DUGAAN PENYIMPANGAN DANA BOS PALAS-Kejaksaan Tinggi Sumatera Utara (Kejatisu) diminta turun ke Palas, untuk mengusut dugaan penyimpangan Dana bantuan operasional sekolah (BOS) tahun anggaran 2012 dan 2013. (FOTO:/IST)

„ Salahsatu gambaran sarana gedung pendidikan SD di Indonesia yang sangat membutuhkan perhatian pemerintah. Melalui kebijakan dana BOS, permasalahan ini diharapkan dapat terselesaikan.

Ada sekitar Rp6,9 miliar setiap triwulannya anggaran dana BOS untuk Palas. Kenyataannya di lapangan, banyak

sekolah ditemukan kondisi ATK-nya tidak pernah diganti, tapi setiap tahun menerima dana BOS. Permintaan ini disampaikan Aktivis Gerakan Rakyat Berjuang, karena dugaan korupsi dana BOS Palas sudah menggurita, dan sangat mudah untuk membutikannya. Aktivis Gerakan Rakyat Berjuang Mardan Hanafi Hasibuan SH kepada METRO,

‹ ‹Baca Kejatisu ...Hal 10

Pendaftaran Balon Bupati Palas

Golkar dan PKS Masih Kosong PALAS- Pendaftar balon bupati yang dibuka DPD Golkar Palas beberapa waktu lalu, hingga Jumat (5/4) sore masih kosong atau belum ada kandidat yang mendaftarkan diri. Hal yang sama juga terjadi di Partai PKS. Namun telah banyak yang telah menghubungi panitia. Panitia penjaringan DPD Golkar Palas Miftah Harahap, Jumat (5/4) mengatakan, hingga saat ini belum ada

yang mendaftar secara resmi, mengambil formulir pendaftaran untuk diusung Golkar dalam pemilukada Palas. “Hanya saja, kalau untuk mengenai persyaratan dan informasi mekanisme pendaftaran sudah ada tim H Syahrin Daulay datang kemarin,” jelasnya.

Ditanya,apakah para kandidat balon Bupati Palas lainnya tidak percaya diri mendaftar ke Partai Golkar, karena Ketua DPD Partai Golkar Palas H Ali Sutan Harahap (TSO) juga berniat maju dalam Pemilukada Palas mendatang, Miftah tidak berani


„ Rapat Dengar Pendapat (RDP) antara Muspida Plus dengan masyarakat Kecamatan Nagajuang, beberapa waktu lalu.

RDP Muspida Plus dengan Warga Batal

DPRD Dituding Tak Becus Urus Rakyat MADINA-Rapat Dengar Pendapat (RDP) antara Muspida Plus dengan masyarakat Kecamatan Nagajuang, Mandailing Natal (Madina) di gedung DPRD Madina, Jumat (5/4) untuk menyelesaikan konflik warga Nagajuang dengan PT SM batal. Padahal jadwal RDP sesuai dengan hasil rapat pertama dengan masyarakat pada Senin (1/4) kemarin. Atas pembatalan itu, warga mengaku

kecewa dan menuding DPRD melakukan pembatalan sepihak. Mereka juga menilai anggota DPRD tidak becus mengurusi rakyat. Salah seorang warga Nagajuang bermarga Simbolon kepada METRO di gedung DPRD, Jumat siang (5/4) menyampaikan, dia bersama warga lainnya datang ke gedung DPRD untuk

‹ ‹Baca DPRD ...Hal 10

memastikannya. “Namun bisa saja ada factor feeling itu dari balon Bupati Palas lainnya, tidak berani mendaftar ke Golkar. Padahal, kita membuka seluas-luasnya, karena Partai Golkar akan mengusung figur yang dicintai rakyat, sesuai semboyan ‘Suara Golkar Suara Golkar,” tukasnya. Sedangkan Ketua DPD PKS Palas Puli

‹ ‹Baca Golkar ...Hal 10 FOTO:SISWANTO

Kepala BKD Madina Mangkir Komisi 1 akan Panggil Kembali

„ Sampah yang berserakan di parit di Pasar Inpres Tanjung Tiram Batubara tidak diangkut. Padahal setiap hari petugas dari Dinas Pasar dan Kebersihan mengutip uang kebersihan kepada pedagang.

MADINA-Komisi 1 DPRD Kabupaten Mandailing Natal (Madina) akan memanggil kembali Badan Kepegawaian Daerah (BKD) Madina untuk dimintai keterangan seputar data honor kategori II (K-II). Alasan pemanggilan, agenda rapat kerja pada hari Kamis (4/4) kemarin ditunda, karena tidak dihadiri Kepala BKD Madina Syahdan Lubis AP. “Kita sudah jadwalkan hari Kamis kemarin, namun yang hadir hanya staf BKD saja. Kita menginginkan keterangan dari Kepala BKD, dan informasi dari stafnya diketahui kepala BKD lagi di luar kota. Untuk itulah, kita akan memanggil kembali Kepala BKD pada Selasa (9/4) mendatang,” ucap Ketua Komisi 1 DPRD Madina Abdul Kholil,

Pedagang Tiap Hari Dikutip Retribusi

Jumat (5/4). Dia juga menjelaskan pihaknya ingin mengetahui berapa jumlah honor K.II di lingkungan Pemkab Madina yang diumumkan oleh BKN, dan apakah sudah disampaikan kepada masyarakat khusus bagi tenaga honor itu sendiri. “Dan sampai sekarang kami belum tahu pasti mengenai data itu, kami tidak ingin ada permainan dan persoalan dalam hal honor K.II ini, dan akan memantau maksimal di lapangan,” tambahnya. Untuk itulah, Kholil juga berharap BKD mengumumkan data honor K-II itu secara transparan supaya masyarakat luas tahu itu.

Sampah di Pasar Inpres Tak Diangkut

BATUBARA- Para pedagang di Pajak Inpres Tanjung Tiram Batubara setuju dengan usulan warga agar pasar tersebut di tata. Tujuannya agar pasar itu rapi dan tidak kumuh. Selain itu, pedagang juga meminta kepada Pemkab Batubara untuk melakukan pembangunan bak sampah dan mengangkut

sampah setiap hari. Karena setiap hari para pedagang dikutip retribusi kebersihan oleh Pegawai Dinas Pasar dan Kebersihan. Itu dikatakan Ida (38) warga Dusun I, Desa Gambus Laut, Kecamatan Limapuluh salah

‹ ‹Baca Pedagang ...Hal 10

‹ ‹Baca Kepala ...Hal 10

Kasus Penganiayaan Butuh Perhatian Khusus SIANTAR- Seorang pengacara asal Bekasi, Jawa Barat, Mangisi Sianturi sewaktu datang ke Siantar Kamis (4/4) menegaskan, aparat harus bersikap lebih sigap menangani kasus penganiayaan. Jika tidak cepat ditangani, dikawatirkan kasus serupa bakal terjadilagi. “Masyarakat sekarang ini sudah memahami tugas-tugas penegak hukum. Hanya saja penegak hukumnya yang belum bekerja optimal,” katanya. Sekarang ini katanya, banyak contoh kasus penganiayaaan yang kurang

ditangani dengan serius dan berlanjut menjadi perkelahian. Akibatnya, kedua belah pihak saling lapor. Seharusnya, jika ada laporan awal segara ditangani aparat hukum dengan serius dan kecil kemungkinan akan terjadi lapoaran timbal balik. “Kalau dia penegak hukum, harus sigap menanggapi kasus penganiayaan. Besar kemungkinan antara dua belah pihak melakukan perdamaian,” kata Mangisi.

‹ ‹Baca Kasus ...Hal 10

„ Bibit Ikan di Diskanla.

Pengadaan Bibit Ikan Diduga Di-Mark up TANJUNGBALAI- Ada indiItu dikatakan mantan Kadis kasi penggelembungan dana Perikanan dan Kelautan Tanproyek pengadaan 25 ribu bibit jungbalai Ahmad Safii. Menuikan gurami di keramba apung rutnya, seharusnya bibit ikan yang dikelola Dinas Perikanan yang didatangkan rekanan CV dan Kelautan Tanjungbalai. Tiga Sekawan terlebih dahulu Selain itu, pelepasan ikan ke dimasukan ke dalam kolam dalam kramba apung juga ti‹Baca Pengadaan ...Hal 10 dak sesuai prosedur. ‹


6 April 2013

Jembatan Pinang Ratu Putus Dihantam Banjir Besar SIMALUNGUN-Hingga saat ini Pekab Simalungun belum memperbaiki jembatan yang putus dihantam banjir besar bulan lalu di Nagori Pinang Ratua, Kecamatan Jorlang Hataran, Simalungun. Akibatnya, masyarakat terganggu beraktifitas. Camat Jorlang Hataran Drs Williamer Saragih mengatakan, Pemkab Simalungun bekerjasama dengan Kebun Bah Birong Ulu, akan segera melakukan upaya

perbaikan, apakah sifatnya sementara atau langsung bangunan permanen. Runtuhnya jembatan tersebut akibat curah hujan deras yang cukup lama berlangsung. Saat hujan, sejumlah sungai dan anak sungai di Tiga Balata meluap. Jembatan permamen roboh dihantam arus sungai karena tidak tahan dengan derasnya arus suangi dan mengakibatkan transportasi putus. ”Kejadiannya terjadi pekan lalu. Hujan

deras yang berlangsung cukup lama membuat air sungai meluap hebat. Meskipun tidak mengakibatkan pemukiman banjir, namun jembatan utama menuju Nagori Pinang Ratus yang putus total ini menyebabkan permasalahan baru bagi masyarakat,” kata Hendra (22) warga setempat. Saat ini kata Hendra, masyarakat Nagori Pinang Ratus khususnya yang mengendarai mobil terpaksa memutar

dari Tiga Balata melalui jalan-jalan tikus di tengah perkebunan. Warga yang mengendarai sepedamotor, terpaksa melalui jembatan alternatif dengan perasaan was-was. ”Jembatan di Jalan Suka Mulia tersebut merupakan sarana fital bagi masyarakat Nagori Pinang Ratu. Dengan putusnya jembatan itu, otomatis akses jalan menuju ibu kota kecamatan dan Kebun Bah Birong Ulu terputus, dan aktifitas masyarakat

Kejatisu Diminta Turun Sambungan Halaman 9 Jumat (5/4) mengatakan, modus yang dilakukan oknum kepala sekolah dalam dugaan penyimpangan tersebut terjadi dalam beberapa kebijakan, misalnya dalam pengadaan alat tulis kantor (ATK) dan buku sekolah. Di mana, pihak sekolah tidak mengganti buku lama, tapi dalam laporannya telah membeli buku baru. Kecurigaan lainnya, penyaluran dana BOS yang tidak sesuai Petunjuk Teknis (Juknis) pelaksanaannya di lapangan, sehingga perlu dievaluasi dan dilakukan pengawasan di lapangan. “Pihak pengelola dana BOS jangan

asal mencairkan saja, tapi juga melakukan monitoring dengan baik di lapangan,” tegas Mardan. Katanya, selain indikasi korupsi, mark up dana BOS juga diduga terjadi pada jumlah siswa penerima BOS, baik tingkat SD dan SMP. Karena datadatanya disinyalir tidak akurat. Pasalnya, pada tahun anggaran sebelumnya, jumlah siswa penerima dana BOS-nya tidak jauh berbeda. Karena dugaan-dugaan tersebut, Mardan Hanafi meminta aparat penegak hukum dari Kajatisu dan aparat hukum di Palas untuk aktif mengawasi penyaluran dana BOS. Apalagi program pendidikan secara nasional sudah gratis,

namun masih tetap saja dilakukan pungutan liar oleh sekolah. Bahkan, ada dalihnya untuk biaya ATK, padahal dana BOS ada. “Kejatisu harus turun, sebab kinerja kejaksaan di wilayah Kabupaten Palas, sepertinya mandul dalam mengusut penyimpangan dana BOS di Palas. Padahal permainan ini ang sudah lama terjadi,” terangnya. Penggiat Pendidikan Palas Alek Sabar Nasution SPd juga menyetujui agar Kajatisu sejatinya harus jemput bola, bukan menunggu delik aduan. “Kejaksaan harus mengusutnya, karena sangat membahaykan pendidikan di Palas,” ucapnya. Dimana sesuai data yang dimiliki

pihaknya, untuk TA 2012 data penerima dana BOS, jumlah siswa SD penerima dana BOS sebanyak 37.311 siswa, di mana setiap siswa mendapat Rp145.000 setiap triwulannya. Kemudian, untuk SMP jumlahnya 6.387 siswa, dengan dana setiap siswa Rp177.500 per triwulan. Sekretaris Dinas Pendidikan Palas Aslamiah Harahap saat dikonfirmasi mengenai terkait masalah dugaan penyimpangan Dana BOS Kabupaten Palas untuk TA 2012 dan TA 2013, tidak memberikan jawaban. “Nanti saya akan evaluasi ya, karena ada yang membidangi masalah BOS,” katanya singkat. (amr/mer)

Pedagang Tiap Hari Dikutip Retribusi Sambungan Halaman 9 satu pedagang di Pasar Inpres Tanjung Tiram. Menurutnya, kebersiah pasar itu masih kurang diperhatikan. Selama ini keadaan pasar itu masih cukup kumuh dengan banyaknya sampah yang tidak di angkut. “Di pasar ini masih banyak sampah yang berserakan, terutama di parit-

parit pasar di Jalan Nelayan ini. Akibat banyaknya sampah membuat aroma yang tidak sedap di pasar ini, sedangkan kami setiap hari juga sudah dikutip retribusi,” katanya. Senada dikatakan Junaidi (31) warga Dusun I, Desa Suka Jaya, Kecamatan Tanjung Tiram. Menurutnya, pasar tempat mereka berjualan itu masih perlu banyak perhatian serta pena-

nganan yang serius untuk membuat pasar itu menjadi tempat perdagangan yang baik. “Pasar ini masih perlu banyak perhatian serta penataan, seperti penanganan sampah yang masih banyak menumpuk, terutama di parit-parit pasar yang sudah sekitar sebulan lebih tak pernah dibersihkan. Kondisi ini membuat pasar jadi bau serta kumuh,” katanya.

Sementara Ahmad Dol, Humas Persatuan pedagang Inpres (P3I) Tanjung Tiram, menjelaskan, masih banyak hal yang perlu dibenahi serta ditambahkan di pasar itu. “Masih banyak yang perlu dibenahi, seperti masih minimnya penjaga keamanan malam di sini. Di sini rawan terjadi pencurian. Selain itu perlu pembangunan pagar,” katanya. (mag-09)

DPRD Dituding Tak Becus Urus Rakyat Sambungan Halaman 9 menanyakan alasan pembatalan RDP yang telah dijadwalkan sebelumnya. Menurut Simbolon, surat pembatalan ini baru mereka diterima

Golkar dan PKS Masih Kosong Sambungan Halaman 9 Farisan Lubis LC mengatakan, saat ini sudah banyak balon Bupati Palas yang berminat mendaftar untuk menghubunginya, termasuk komunikasi melalui telepon seluler H Syahrin Daulae, Sarmadan Hasibuan, Sende Tua Hasibuan dan Rahmat P Hasibuan. “Namun sesuai hasil komunikasi dengan Tondi Roni Tua, Jumat (5/4) sore mungkin beliau akan mendaftar ke PKS,” tukasnya. (amr/mer)

Jumat (5/4) pagi, dan menurut warga pembatalan ini sepihak tanpa ada kordinasi yang jelas dengan masyarakat. Mereka menilai anggota DPRD tidak becus mengurusi rakyat. “Kami ke sini untuk menanyakan alasan pembatalan itu. Pasalnya, di dalam surat tidak ada penjelasan. Kami nilai anggota DPRD tidak serius menanggapi dan menyelesaikan persoalan warga. Kami kecewa atas pembatalan ini,” ucapnya. Ditunggu hingga selama dua jam, namun warga tidak berhasil memeroleh jawaban dari anggota dewan, dan akhirnya mereka membubarkan diri. Sementara Wakil Ketua DPRD

Madina Safaruddin Ansyari Nasution yang disapa Todong saat dikonfirmasi menjelaskan, surat pembatalan itu bukan tidak ada alasan. Katanya, sebelumnya pihaknya telah berkordinasi dengan salah seorang tokoh masyarakat Nagajuang atas pembatalan itu. “Bukan tidak ada alasan, dan sudah kami jelaskan kepada masyarakat. Alasannya adalah, karena hari Kamis kemarin, Muspida plus sudah mengadakan rapat bersama perwakilan masyarakat dipimpin Bupati Madina dan rapat itu sudah melahirkan butirbutir keputusan yang akan dikerjakan oleh tim dibentuk oleh Pemkab Madina dan sudah jelas akan mem-

perjuangkan semua tuntutan masyarakat, yakni akan berupaya agar PT SM meninggalkan wilayah Sambung, dan meminta Kementerian ESDM meninjau langsung wilayah itu,” jelasnya. Katanya juga, masyarakat yang datang ke DPRD Madina Jumat (5/4) juga hadir pada rapat hari Kamis (4/4) kemarin di Aula kantor Bupati Madina. “Kami menilai keputusan pada rapat Muspida kemarin itu untuk sementara merupakan keputusan bijaksana dan objektif serta sudah menampung aspirasi masyarakat. Atas dasar itulah kami menunda RDP bukan membatalkan, perlu digarisbawahi,” jelas Todong. (wan/mer)

Kepala BKD Madina Mangkir Komisi 1 akan Panggil Kembali Sambungan Halaman 9 Seperti diberitakan sebelumnya, Ketua Pekerja Sosial Masyarakat (PSM) Kabupaten Madina Ahmad Suheri Nasution Ssos menyebutkan, pengumuman honor K-II ini harus disampaikan secara transparan dan terbuka untuk seluruh masyarakat luas,

agar tidak ada dugaan permainan di dalamnya, sebab Suheri khawatir akan terjadi manipulasi data jika tidak diumumkan dengan transparan. Begitu juga disampaikan Ketua DPC Perhimpunan Advokat Indonesia Padang sidempuan mewilayahiTabagsel, H Ridwan Rangkuti SH MH. “Demi terwujudnya pemerintahan

yang bersih dan transparan, khususnya mengenai data tenaga Honorer K-II ini, saya minta kepada Kepala BKD Madina dan BKD se Tabagsel agar mengumumkan nama-nama tenaga Honorer K-II melalui media cetak lokal. Bukan hanya ditempel di papan pengumuman saja,” sebutnya. (wan/mer)

KOMISI PEMILIHAN UMUM KABUPATEN PADANG LAWAS UTARA Jl. Bangau No. 92 Lk. IV Gunung Tua Telp. 0635 - 510850 (Kode Pos : 22753)


Nomor : 62/KPU-Kab/002.964953/2013

PENDAFTARAN CALON ANGGOTA DPRD KABUPATEN PADANG LAWAS UTARA TAHUN 2014 1. Dalam rangka melaksanakan ketentuan pasal 59 ayat (3) dan pasal 67 ayat (3) Undang-Undang nomor 8 tahun 2012 tentang Pemilihan Umum Anggota DPR, DPD, DPRD Provinsi dan DPRD Kabupaten/Kota, KPU Kabupaten Padang Lawas Utara membuka pendaftaran Calon Anggota DPRD Kabupaten Padang Lawas Utara. 2. Dokumen pendaftaran dan Cakram Digital (CD) diantar langsung oleh 2 (dua) orang penghubung sesuai mandat yang diserahkan oleh masingmasing Partai Politik ke Sekreatriat KPU Kabupaten Padang Lawas Utara Jalan Bangau No. 92 Lk.IV Gunungtua 3. Persyaratan Calon Anggota DPRD Kabupaten Padang Lawas Utara sesuai dengan UU Nomor 8 Tahun 2012 Bab VII Pasal 51 ayat (1) tentang Pencalonan Anggota DPR, DPD, DPRD Provinsi, DPRD Kabupaten/Kota dan sesuai dengan Peraturan Komisi Pemilihan Umum No 7 Tahun 2013 Bab II Pasal 4 tentang Persyaratan Bakal Calon dan Pengajuan Bakal Calon Anggota DPR, DPRD Provinsi, DPRD Kabupaten/ Kota 4. Formulir kelengkapan administrasi persyaratan calon anggota DPRD Kabupaten Padang Lawas Utara dan keterangan lebih lanjut dapat diperoleh di Sekretariat KPU Kabupaten Padang Lawas Utara Jalan Bangau No. 92 Gunungtua Kode Pos. 22753 Telp/Fax. 0635 – 510850 5. Waktu penerimaan dokumen pendafatran Calon Anggota DPRD Kabupaten Padang Lawas Utara mulai tanggal 9 April 2013 dan ditutup tanggal 22 April 2013 Waktu Penerimaan pukul 08.00 – 16.00 WIB. KETUA dto MUHAMMAD ALI ANSOR SAg


Rp 185.000

Keymethink Club Wakil Ketua PDI-P Madina Hamba Allah Ridwan Lubis Ikrar Amin Lubis

Rp500.000 Rp500.000 Rp100.000 Rp 50.000 Rp 50.000



Mari ringankan tangan untuk membantu saudara-saudara kita yang menjadi korban banjir bandang di Madina. Yang ingin menyumbang, bersangkutan bisa langsung mengantar ke kantor Metro Tabagsel, Jalan Diponegoro/Sitombol No 21 Padangsidimpuan. Dan untuk wilayah Madina, warga dapat menyerahkannya kepada saudara Ridwan Lubis (Reporter wilayah Madina) nomor HP 085276406359

Dp. 40 Jtan Angs 3Jtan

untuk menjual hasil pertaniannya terganggu,” tambah Hendra. Sementara itu Camat Jorlang Drs Hataran Williamer Saragih ketika dikonfirmasi METRO melalui telepon selulernya menyebutkan, usai kejadian pihaknya telah turun ke lokasi guna melakukan peninjauan. ”Sewaktu kejadian putusnya jembatan tersebut. Kami langsung turun ke lokasi dan kita juga tengah membuat lintasan altrnatif. Yang jelas, masalah ini

sudah kita laporkan kepada Bupati Simalungun meskipun masih secara lisan dan sekarang kita sedang siapkan laporan resminya,” ujar Williamer. Untuk sementara menurut William, karena jalan itu juga merupakan lintasan menuju Kebun Bah Birong Ulu, Pemkab Simalungun bekerjasama dengan PTPN IV akan berupaya sesegera mungkin melakukan perbaikan. Tinggal menunggu waktu saja. (eko/mer)

Kasus Penganiayaan Butuh Perhatian Khusus Sambungan Halaman 9 Karena banyaknya kasus aniaya yang tak kunjung selesai, seharusnya menjadi perhatian aparat hukum. Masyarakatpun makin cemas dengan tindak kriminal yang semakin marak. Kecemasan itu bukan tanpa alasan, karena hari masyarakat di hadapkan dengan kasus aniaya dan kekesaran dalam rumah tangga. Belum lagi dengan banyaknya kasus pencurian sepedamotor dan kasus jambret. “Masyarakat saat ini butuh pemimpin kepolisian yang berani bertindak dengan tegas,” pungkasnya. Saat ini, masyarakat sudah sangat cerdas. Mereka tidak butuh penghargaan dan sanjungan, tapi sangat membutuhkan

ketegasan dan tindakan nyata dari aparat kepolisian. “Harusnya, tingginya angka kasus-kasus penganiayaan terhadap sesama warga sudah menjadi skala prioritas bagi polisi. Karena ini menyentuh langsung kepada masyarakat. Apalagi bisa menimbulkan rasa cemas bahkan konflik horizontal,” tandasnya. Sementara komentar warga terkait pengupasan kasus penganiyaaan ini mendapat respon baik. Beberapa nara sumber yang diwawancara Metro mengaku, jika aparat polisi kurang tanggap menangani kasus penganiayaan sama siapa lagi mereka harus mengadu. “Bagi kami polisi adalah teman masyarakat yang dapat mengayomi setiap waktu,” kata Santi (24) seorang gadis berambut pirang. (eko/mer)

Pengadaan Bibit Ikan Diduga Di-Mark up Sambungan Halaman 9 buatan sebelum dilepas ke keramba terapung di sungai Pulau Besusen. Setelah dilakukan pembesaran di kolam buatan, dan jika ikan mulai besar baru dilepas ke dalam kolam keramba apung. Itu harus dilakukan karena airnya di lokasi keramba apung deras. Pakan ikan juga perlu diatur dan diawasi karena pakan ikan mudah tenggelam dan hanyut membuat ikan tidak bisa makanmakanan yang disedikan dan tidak ada alasan pihak rekanan mengatakan air banjir penyebab matinya 25.000 ekor ikan. Sementara Direktur CV Tiga Sekawan Umar Ali mengaku jika proyek pengadaan keramba jaring apung senilai Rp1,4 miliar di Diskanla itu dibelinya dari seseorang. Namun saat ditanya proyek itu dibeli dari siapa, Ali enggan untuk menjawabnya. Ali menjelaskan, untuk mengerjakan proyek tersebut dirinya bekerja sama dengan dua orang rekannya yang tergabung didalam CV Tiga Sekawan. Kendatipun dalam pencairan anggaran yang sudah dicairkan sebesar 100 persen, Ali mengaku soal yang bertanggung jawab atas matinya ribuan ekor bibit ikan gurami itu ialah kelompok yang menerimanya. “Ada sebanyak 5 kelompok sebagai penerima bibit ikan gurami itu. Anggaran sebesar Rp70 juta untuk pengadaan bibit ikan gurami itu jika saya yang menggantinya itu bukanlah tanggung jawab saya. Semuanya sudah sesuai dengan prosedur,” katanya. Ditanya soal masa perawatan, Ali mengaku, sesuai kontrak perjanjian antara CV Tiga Sekawan dengan Diskanla tidak ada perjanjian seperti itu. “Tidak ada dalam kontrak masa perawatan,” katanya. Seperti diberitakan sebelumnya, matinya ribuan bibit ikan gurami yang masuk dalam program pengadaan keramba jaring apung di Dinas Perikanan dan Kelautan Tanjungbalai dibenarkan Direktur CV Tiga Sekawan Umar Ali, Minggu (23/ 3) selaku rekanan. Namun pihak rekanan menolak bertanggung jawab atas matinya bibit ikan itu. Alasanya, yang bertanggung jawab atas kematian bibit ikan adalah Dinas Perikanan dan Kelautan Tanjungbalai. Dikatakannya, bibit ikan gurami yang diadakannya itu berjumlah 25 ribu ekor, namun saat ditanya berapa jumlah bibit ikan yang mati itu dirinya menolak dengan alasan tidak mengetahui secara pasti. Namun Umar mengatakan, matinya bibit itu bukanlah tanggung jawabnya melainkan dikembalikannya pada Dinas Perikanaan dan Kelautan Kota Tanjungbalai. Sebab sebelum bibit ikan itu dimasukkan ke dalam keramba terlebih dahulu dirinya telah melakukan serah terima dengan pihak Dinas Perikanan dan Kelautan Kota Tanjungbalai.

“Saya juga ikut pada hari itu memasukkan bibit ikan gurami itu ke dalam keramba bersama pihak Dinas Perikanan dan Kelautan. Namun sebelum bibit ikan yang saya beli itu dimasukkan, terlebih dahulu saya melakukan berita acara penyerahannya dengan PPTK nya,” katanya. Bersamaan itu, Direktur CV Tiga Sekawan menjelaskan, untuk mencapai lokasi keramba ikan yang terdapat di pulau Bususen itu dirinya harus menggunakan transportasi air yang biasanya digunakan sebagai alat mengangkut nelayan untuk menyebarang ke kapal yang terapung di seberang sungai. “Terpaksa saya carter boat itu untuk mengangkut bibit ikan gurami yang telah saya beli dari seorang kenalan saya di Medan. Bibit ikan itu sebelum sampai dari Bandung terlebih dahulu dikarantinakan,” katanya. Sebelumnya, Dinas Perikanan dan Kelautan Tanjungbalai diminta secepatnya mengganti ratusan benih ikan gurami, yang mati dalam penangkaran di keramba jarring apung Kecamatan Sei Tualang Raso beberapa waktu lalu. Permintaan ini disampaikan Harun, Ketua kelompok Berdikari Bersama, dari Kelurahan Muara Sentosa, melalui rekannya, H.Ganti Panjaitan. Menurut H.Ganti, proyek pembuat keramba beserta bibit dan pakan ikan diperkirakan biayanya mencapai Rp 1 miliar lebih. Proyek tersebut, dimenangkan CV Tiga Sekawan, dengan anggaran yang diperoleh dari dana Bantuan Daerah Bawah(DBD) tahun anggaran 2012. Menurut H Ganti, dalam praktiknya di lapangan, setiap kelompok penerima bantuan tersebut, terdiri dari 10, dengan total kelompok sebanyak 5, yang sama artinya, jumlah warga yang harusnya dapat menikmati manfaat dari bantuan itu berjumlah 50 orang. Namun, harapan itu kini sirna, menyusul matinya benih ikan yang baru ditabur di keramba yang dinilai tidak laik mutu tersebut. Dipihak lain, Umar Ali selaku rekanan proyek keramba dan ternak ikan kepada METRO menyebutkan matinya ikan dalam keramba yang ditempatkan di pinggiran Sungai Pulau Simardan akibat banjir besar melanda kawasan itu, sehingga membuat kandungan air menjadi terganggu, dan berujung pada matinya benih ikan tersebut. “Kita akan bertanggungjawab tentang ikan-ikan yang mati itu. Tapi yang jelas, persoalan ini juga tidak terlepas dari tanggungjawab instansi terkait,” tegasnya. Sedangkan Kepala Dinas Perikanan Tanjungbalai.Ir Nefri yang dihubungi mengaku, matinya ikan dalam keramba paktor banjir. Dia juga memastikan, karena masih dalam masa perawatan, pihaknya memastikan seluruh benih itu akan diganti. (ilu)


Fakta dan Mitos Kesehatan Reproduksi

Para ahli kesehatan sudah memperingatkan bahwa merokok meningkatkan risiko berbagai jenis kanker. Dan, risikonya akan semakin tinggi tergantung waktu perokok menghisap rokoknya.

Banyak mitos beredar seputar kesehatan reproduksi. AGAR tidak tersesat informasi yang salah, berikut fakta sebenarnya tentang fungsi dan sistem reproduksi yang perlu Anda cermati. MITOS: Perempuan yang lebih cepat mendapat haid pertama (menarche) = perempuan nakal FAKTA: Tidak ada hubungannya antara menarche dengan perilaku nakal. Menarche pada usia 10-15 tahun dipengaruhi faktor gizi dan keturunan. Semakin muda usia menarche, semakin tua usia menopause. MITOS: Perawan akan berdarah pada hubungan seks pertama atau malam pertama. FAKTA: Keperawanan punya aspek fisik yang mengacu pada selaput dara dan aspek sosial yang mengacu pada seorang yang pernah berhubungan seksual. Selaput dara memiliki bentuk elastis. Perempuan akan mengeluarkan cairan vagina jika terangsang sehingga tidak semua perempuan mengalami pendarahan saat berhubungan seks untuk pertama kalinya. MITOS: Masturbasi atau onani hanya dilakukan pria dan menyebabkan dengkul kopong FAKTA: Masturbasi bisa dilakukan baik perempuan ataupun laki-laki. Dan perilaku ini bisa menyebabkan luka, keletihan, dan kelelahan jika berlebihan, merasa berdosa, tidak

konsentrasi, ketergantungan, dan tidak merasa butuh pasangan. MITOS: Orang hiperseks, jalan mengangkang dan bentuk bokong rata. FAKTA: Ini tidak berhubungan dan hanya pasangannya yang tahu bahwa ia hiperseks. MITOS: Payudara bisa diperbesar dengan meremasnya. FAKTA: Besar kecilnya payudara disebabkan faktor keturunan. Meremas hanya memperbesar sementara karena rangsangan. Sementara itu, payudara besar tidak mempengaruhi jumlah produksi ASI. MITOS: Hubungan seks sekali tidak menyebabkan hamil. FAKTA:Pertemuanspermadanseltelur dapatmenyebabkankehamilanwalaupun hanya berhubungan seks sekali. MITOS: Makan nanas menyebabkan keguguran. FAKTA:Apapun yang dimakan secara berlebihan akan menyebabkan gangguan. Pengaruh makanan akan berdampak pada lambung dan usus, bukan pada alat reproduksi.(int)

PARA ilmuwan dari Penn State College of Medicine di Pennsylvania menegaskan untuk tidak merokok di pagi hari. Pasalnya, perokok yang selalu merokok setelah bangun tidur lebih mungkin terkena kanker paru-paru. Dalam Journal of Cancer mencatat bahwa nikotin yang dihisap sekitar 30 menit setelah bangun memberikan efek dua kali lipat lebih berbahaya pada paruparu. “Para perokok ini lebih mungkin memiliki tingkat nikotin dan racun lainnya lebih tinggi dalam darah tubuh mereka dan membuat

Bakar Kalori di Kantor

APABILA Anda t e r m a s u k karyawan yang bekerja di dalam ruangan, tentunya sebagian besar dari aktivitas Anda duduk di depan komputer, menulis laporan, menghadirirapat,menggandakandokumendan aktivitas ringan lainnya. Nah, pelajari berapa banyak kalori yangAnda bakar lewat aktivitas ringan Anda dan lakukan alternatif-alternatif tertentu untuk memperbesar angkanya. Naik Tangga ke Kantor Bersyukurlah bila ruang kantorAnda berada di lantai 19 sebuah gedung pencakar langit. Pilihannya: Anda bisa berhenti menggunakan lift atau turun di lantai 5 dan melanjutkannya dengan naik tangga. Naiktanggaselama30menitakanmembakar kalori sebesar 122,5 kcal. Itu setara dengan kandungan kalori dalam sekaleng minuman soda non-diet.

Duduk di Cubicle Jumlah kalori yang dibakar relatif kecil, hanya 10ckcalperjam.Andabisamemperbesarjumlah kalori yang dibakar bila Anda melakukan peregangan ringan setiap sejamAnda duduk, itu akan membakar 126 kcal per jam. Atau selingi dengan berdiri dan berjalan untuk mengambil air minum atau alasan apapun yang bisaAnda temukan. Mau lebih lagi? Ganti kursi kerja Anda dengan gym ball. Menghadiri Rapat Melakukan presentasi Daripada duduk diam dan menahan kantuk, hanya membakar 105 kcal per jam- tingkatkan metabolisme Anda hingga membakar 126 kcal per jam dengan mengambil posisi aktif. Meningkatkan partisipasi aktifAnda di ruang rapat bukan hanya membuatAnda membakar lebih banyak kalori, tetapi bisa juga memuluskan karier Anda. (int)

mereka jauh lebih kecanduan,� ungkap pemimpin penelitian Dr Joshua Muscat, dilansir dari BBC News (1/4).(int)



6 April 2013



(21 Desember -19 Januari)

Karier: Kalau memungkinkan, selesaikan pekerjaan yang tertunda. Asmara: Harus lebih percaya sama dia, bukan sama temanny


(20 Januari - 18 Februari)

Karier: Tim kerja membutuhkan seseorang yang bisa menjadi perencana yang baik. Asmara: Cinta tidak bisa dipaksakan.


19 Februari - 20 Maret

Karier: Jangan terlalu membayangkan hal-hal sempurna. Asmara: Salah satu rencana bersama dia akan terlaksana.


(21 Maret - 20 April)

Karier: Jangan habiskan hari-hari hanya untuk memikirkan pekerjaan. Bisa jenuh. Asmara: Aman-aman saja.


(21 April - 20 Mei)


(21 Mei - 20 Juni)

Karier: Mainkan kartu dengan tepat, kamu pasti bisa maju. Asmara: Cinta mulai merasuki hidup Anda.

Karier: Awas stres karena sedang tak ada kesibukan atau pekerjaan. Lakukan sesuatu. Asmara: Yang namanya hubungan cinta memang tidak selalu mulus.


(21 Juni- 20 Juli)

Karier: Gunakan sejumlah pemikiran rasional. Hadapi hari esok dengan tenang dan percaya diri. Asmara: Semakin lengket.


(21 Juli-21 Agustus)

Karier: Anda tidak mempunyai rencana yang baik dalam menjalani pekerjaan. Sikap ini membuat Anda cepat merasa bosan. Segeralah susun rencana dan target.


(23 September - 22 Oktober)

Karier: Bakal ketemu orang yang akan mengubah hidup kamu. Tetapi semua butuh proses. Asmara: Jangan kecewakan si dia.


(23 Agustus-22 September)

.Karier: Akan ada keberuntungan di kantor Anda Asmara: Bagaimanapun juga hati Anda masih untuk si dia.


(23 Oktober – 22 November)

Karier: Curahkan kreativitas Anda. Percaya diri sajalah. Asmara: Anda diminta si dia untuk bersabar.


( 23 November - 20 Desember)

Karier: Jangan menumpuk pekerjaan, jika memang bisa Anda selesaikan hari ini. Asmara: Makin akrab, makin asyik.

PASUKAN khusus kepolisian (SWAT) Los Angeles menyerbu rumah Rihanna, Kamis (4/4) malam. Langkah tersebut dilakukan setelah seorang pria tak dikenal menghubungi hotline darurat 911. Disebutkan pemilik hit "Umbrella" itu dalam bahaya besar. Dua pria bersenjata berhasil memaksa masuk rumah serta seorang diantaranya berulangkali melepas tembakan. Kepolsiain dan pasukan SWAT dengan kendaraan lapis baja langsung diturunkan. Hasilnya, dua orang bersenjata tadi ternyata tak ada. Rihanna yang dalam laporan per telepon disebut berada dalam rumah, malah baru muncul beberapa jam setelah penyergapan berlangsung. Pejabat kepolisian Los Angeles (LAPD) khawatir kasus serupa akan terus berlangsung. Laporan palsu yang memaksa SWAT turun atau biasa disebut SWATED ini, dikhawatirkan meminta korban orang tak bersalah. Bisa saja kepolisian menembak penghuni rumah sendiri yang kesal rumahnya diserbu pihak berwajib. Belum lagi properti rumah rusak akibat penyerbuan polisi yang terpaksa harus menerobos. Swated kini seperti jadi epidemi yang sulit diberantas kepolisian Ameika Serikat. Selebriti lain seperti Justin Bieber, Clint Eastwood, Miley Cyrus, dan Tom Cruise sempat jadi korban. Kasus ini sempat membuat seorang bocah berumur 12 tahun ditahan karena diduga membuat laporan palsu lewat 911. (jpnn)

ATIQAH Hasiholan belum menentukan bagaimana konsep pernikahannya bersama sang kekasih, Rio Dewanto. Namun, ia ingin pernikahannya nanti berlangsung sederhana, intim, dan indah. "Yang pasti sederhana, kan dasarnya simpel, aku mau kelihatan elegan tapi juga simpel. Simpel yang elegan," ucapnya ditemui di Hotel Ritz Carlton, Pacific Place, Jakarta. Namun, wanita kelahiran Jakarta, 3 Januari 1982 itu, masih merahasiakan jadwal pernikahannya. Ia berkilah tanggal pernikahannya memang belum ditentukan. Makanya, ia belum bisa membeberkan. "Kan saya sudah lamaran ya, terus kalau tanggalnya ada berita di bulan Agustus, tapi sebenarnya kami belum tahu tanggalnya kapan. Yang jelas, karena sudah lamaran pasti tujuannya ke sana," ucapnya. Pokoknya, lanjut dia, secepat mungkin. Tapi, pernikahan itu nampaknya tidak akan dilangsungkan Agustus 2013. Mengingat kesibukannya yang padat. Demikian pula Rio. "Yang pasti setelah Agustus, karena kan ya kesibukan masing-masing," ucapnya. Setelah Lebaran? "Insya Allah," tandasnya. (tr/int)


AKTRIS dan bintang sinetron Risty Tagor mulai mengurangi aktivitasnya di depan layar kaca sejak memiliki anak, Arsen Raffa Balweel yang sudah menginjak dua tahun. "Semua kegiatanku bisa di-manage dan suami syuting sinetron, jadi quality time saat bangun tidur, ngurus sarapan dia dan diatur sedemikian rupa dan cari nyamannya. Karena aku nggak mau ninggalin anak kalau nggak ada suami atau keluarga," ujarnya di kawasan Kebayoran Baru, Jakarta Selatan, Jumat (5/ 4). Dengan membatasi aktivitas, bintang film Bestfriend tersebut kini

bisa lebih memaksimalkan waktu bersama anak semata wayangnya. "Kami lebih sering kumpul bareng-bareng kalau Rifky libur kami berenang. Kalau ada event ultah kami usahain ngumpul dan biasanya keluarga besar aku juga akhir minggu selalu kumpul," papar dara berusia 23 tahun tersebut. Risty pun menikmati menjadi ibu muda dengan satu anak. Namun, belum ingin tambah anak. "Kalau di mulut sih, pingin, tapi di hati Allah tahu yang terbaik dan anak aku masih butuh banyak didampingi," tuturnya. (idc/int)


6 April 2013

Korban Salah Tangkap HIDUP 42 TAHUN DALAM PENJARA ARIZONA – Pria di Negara Bagian Arizona, Amerika Serikat (AS) akhirnya menghirup udara bebas setelah dipenjara selama 42 tahun. Louis Taylor dilepaskan setelah pengadilan menyatakan tidak ada bukti cukup yang menunjukkan dia bersalah. Taylor ditahan polisi pada tahun 1970 silam saat dia masih berusia 16 tahun. Dia dituduh menjadi dalang peristiwa kebakaran Hotel

Pioneer yang menewaskan 28 orang. Taylor diberikan dua pilihan oleh pengadilan. Menerima putusan itu dan

„ Louis Taylor

bebas secepatnya atau menjalani proses persidangan selama dua tahun lagi agar dapat membersihkan namanya. Taylor merasa masa hidupnya di dalam penjara sudah terlalu lama dan memutuskan untuk tidak meneruskan kasus tersebut. Taylor menyebut hakim

yang mengadilinya 42 tahun silam menjalankan persidangan dengan tidak adil. Saat itu sang hakim memutuskan dia bersalah walaupun tidak memiliki bukti yang cukup. “Ada dua tragedi dalam hidup saya, peristiwa kebakaran itu dan masa hukuman yang saya terima,” ujar Taylor. (oz/nik)


EKSPRESI UNIK-Foto wajah manusia dengan ekspresi unik bagian tubuh yang dipotong dari majalah fashion.

Foto Unik dari Potongan Tubuh Tampil Majalah PARIS – Salah satu karya seni yang aneh muncul di Paris, Perancis. Karya seni ini dibuat dengan menggabungkan wajah seseorang dengan bagian tubuh manusia yang diambil dari majalah untuk membuat ekspresi wajah yang aneh. Seniman Bruno Metra dan Laurence Jeanson membuat seni ekspresi wajah dengan menggunakan foto bagian tubuh yang dipotong dari majalah fashion. Kedua seniman Perancis ini membuat proyek unik yang disebut ID, dimana mereka menunjukkan gambaran keindahan yang tidak alami, seperti seseorang yang menjalani operasi plastik.

Dalam karya seni yang dibuat oleh Metra dan Jeanson ini menggunakan cara menempelkan potongan-potongan foto bagian tubuh seperti mata, hidung, bibir dari majalah ke wajah seseorang model untuk difoto dan menampilkan ekspresi yang aneh. Metra mengatakan bahwa media seperti majalah fashion dapat mempengaruhi orang-orang dalam berdandan dan bersikap. “Majalah dan televisi terus menciptakan hal baru yang menjadi referensi sosial. Kekuatan media juga dapat mempengaruhi identitas seseorang,” kata Metra, Jumat (5/4). (oz/nik)


AKSI-Jumpy dengan aksi nekatnya di tengah jalan.

ajah Anda Wuih, Ada Tarantula Sebesar WWajah SRILANKA - Kebanyakan orang pasti akan merasa takut melihat laba-laba. Yang kecil saja bisa membuat bergidik, apalagi yang besar. Kini telah ditemukan spesies laba-laba baru berjenis tarantula sebesar wajah Anda. Wow! Tarantula tersebut

ditemukan penduduk desa di Srilanka. Sebelumnya pada 2009, warga sempat membawa laba-laba itu kepada ahlinya setelah membunuh spesies reptil berbahaya tersebut. Para ilmuwan menduga laba-laba jenis arachnid ini adalah spesies yang tidak

pernah ditemukan sebelumnya. Tetapi kini para ahli, mengonfirmasikan jika masih ada turunan laba-laba tersebut, Jumat (5/4). ”Kami mencari di setiap lubang pohon dan batang kulit pohon, ini juga untuk kepuasan pencarian kami juga,” tutur sang peneliti

Ranil Nanayakkara. Tarantula itu, menjadi bagian dari gen laba-laba harimau, mempunyai tanda khusus termasuk dafodil yang memiliki warna kuning di kakinya dan berwarna pink di bagian perutnya. Berdasarkan penelitian dari Biodiversity Education

and Research Organization Srilanka, reptil ini ditemukan hidup di sekitar rumah sakit di daerah Mankulam. Mereka dinamakan Poecilotheria, sebagai lambang kehormatan terhadap inspektur polisi Michael Rajakumar Purajah, yang memimpin penelitian tersebut. (oz/nik)

Mabuk, Tentara Rusia Bawa Tank

HANTAM TIANG LISTRIK RYAZAN - Seorang tentara Rusia harus menghadapi pengadilan militer setelah menambrakan kendaraan tempur lapis baja atau tank ke tiang listrik. Tentara itu diduga sedang mabuk berat. Aksi tentara rusia itu tertangkap kamera video milik pengendara mobil yang tidak sengaja merekam saat

tank itu menabrak tiang lampu di Ryazan, Rusia. Sebuah video dari kecelakaan itu ditembak dengan cam mobil di mana kendaraan tempur udara (BMD) menabrak tiang lampu Ryazan di Rusia kini telah muncul di internet. Video milik pengemudi mobil, Ivan Ivanov ini

diposting pada 30 Maret ke internet. Menurut keterangan kejadian itu terjadi pada 28 Maret dan pukul 15.39 waktu setempat. Jumat (5/4) kejadian ini bukanlah kecelakaan lalu lintas karena hanya melibatkan satu kendaraan tempur saja dan tidak ada korban jiwa akibat kejadian ini. (oz/nik)

„ Dalam kondisi mabuk, tank tentara Rusia menabrak tiang listrik di pinggiran jalan.


DITEMUKAN-Simbol yang aneh yang ditemukan pada makanan instan di Goldfish.

Simbol Ikan

Ditemukan di Makanan Instan MELBOURNE – Seorang perempuan bernama Patti Burke di Australia menemukan sebuah simbol ikan terdapat dalam sebuah makanan instan, Goldfish. Burke, menemukan sebuah tanda mahkota dan tanda silang yang tercetak pada makanan instan berbentuk ikan itu. Jumat (5/4), pihak Goldfis mengatakan bahwa tidak ada cetakan seperti itu di pabrik mereka dan kemungkinan itu adalah keajaiban. Burke menemukan simbol sakral itu sepekan. Simbol ikan memang memegang peranan dalam alkitab, dimana ada firman tuhan yang mengatakan bahwa

Kristus memberi makan 5.000 orang pengikutnya dengan menu dua ekor ikan dan lima buah roti kemudian murid-muridnya disebut sebagai “penjala manusia”. Seperti diketahui penampakan simbol sakral yang dialami Burke telah muncul dalam berbagai bentuk. Seorang pria dari Ohio mengatakan bahwa dirinya melihat gambar Kristus muncul pada kaca depan mobil yang disebabkan oleh kotoran burung pada Februari silam. Seorang pria lain asal Texas juga pernah melihat wajah Yesus pada Taco yang dibakar saat sarapan pagi. (oz/nik)


Jumpy, Si Anjing Ajaib Penantang Maut CANBERRA - Sebuah video tentang seekor anjing yang telah melakukan 20 aksi menantang dalam film menghebohkan internet. Anjing bernama Jumpy ini mendadak menjadi terkenal. Video menakjubkan itu diposting ke YouTube dengan judul ‘Bad Ass Dog’. Video ini dipercaya menggunakan banyak trik sehingga aksi menakjubkan Jumpy terlihat tidak nyata. Namun, sang pemilik Omar Von Muller membantahnya dan menyatakan, kalau semua aksi yang dilakukan anjing peliharaannya itu adalah asli tanpa rekayasa. Dalam video yang berdurasi satu menit sembilan detik ini memperlihatkan keahlian Jumpy seperti, melompat, memanjat dinding,

berenang, bahkan bermain skuter. Omar mengatakan bahwa rahasia kesuksesan melatih Jumpy adalah konsisten saat melatihnya. Video menakjubkan ini mendapat banyak komentar dari pengguna YouTube seperti yang ditulis oleh akun MissMichSan. “Aweee video yang mengagumkan. Kamu bisa melakukan apapun jika kamu yakin mampu melakukannya.” tulisnya, Kamis (4/4). Komentar lain juga ditulis oleh akun Brenda Ryan, yang mengatakan, video Jumpy ini sangat menakjubkan dan dia menyarankan Jumpy bisa main film. ”Menakjubkan. Benarbenar menakjubkan!! Jumpy seharusnya bisa main di film!!! Anda adalah pelatih paling luar biasa, Omar,” tulis Brenda. (oz/nik)



6 April 2013

Bukan Hari TERBAIK Pedrosa DANI PEDROSA secara mengejutkan hanya mampu finis kedelapan pada free practice atau sesi latihan bebas perdana MotoGP Qatar. Pembalap Repsol Honda itu mengaku, ”Ini bukan hari saya.” Penampilan mengecewakan diperlihatkan Pedrosa. Pebalap yang sedang dalam kondisi terbaik selama tes itu hanya mampu mencatat waktu 1 menit 57.749 detik. Pedrosa tertinggal jauh 1.064 detik dari Jorge Lorenzo yang menjadi pembalap tercepat. Motor pebalap yang tahun lalu menjadi runner up itu ternyata harus melebar sebanyak dua kali dalam tes itu. Pedrosa mengatakan motornya memiliki masalah saat hendak memasuki tikungan di Sirkuit Losail. “Hari ini bukan terbaik buat kami. Kami tidak mampu mengendarai motor dengan baik karena saya memiliki sedikit masalah saat hendak memasuki tikungan,” jelas pebalap asal Spanyol itu, diberitakan Crash. Dalam sesi pembuka itu, Pedrosa memang terlihat tidak mampu bersaing dengan

Jorge Lorenzo mengawali kiprahnya di MotoGP Qatar dengan baik. Pebalap andalan Yamaha itu mencatat waktu tercepat dalam sesi latihan bebas pertama, di depan Cal Crutchlow dan Valentino Rossi. LORENZO, Crutchlow, dan Rossi bersaing ketat dalam sesi di Sirkuit Losail. Namun, Lorenzo-lah yang akhirnya sukses mengukir waktu tercepat dengan catatan 1 menit 56,685 detik. Crutchlow harus puas menempati posisi kedua. Pebalap Yamaha Tech 3 itu membukukan waktu 1 menit 56,743 detik atau berselisih 0,058 detik dari catatan waktu Lorenzo. 1. Jorge Lorenzo 2. Cal Crutchlow 3. Valentino Rossi 4. Marc Marquez 5. Andrea Dovizioso 6. Alvaro Bautista Gresini 7. Stefan Bradl LCR 8. Dani Pedrosa 9. Aleix Espargaro 10. Nicky Hayden 11. Bradley Smith 12. Andrea Iannone Pramac 13. Ben Spies Pramac 14. Hector Barbera Avintia 15. Randy de Puniet 16. Karel Abraham Cardion 17. Colin Edwards Forward 18. Yonny Hernandez PBM 19. Hiroshi Aoyama Avintia 20. Claudio Corti Forward 21. Danilo Petrucci 22. Bryan Staring Gresini 23. Lukas Pesek 24. Michael Laverty

Rossi yang kembali bernaung di bawah bendera Yamaha juga terlihat sangat kompetitif. Catatan waktunya 1 menit 56,756 detik. Posisi keempat jadi milik pebalap debutan yang membela Repsol Honda, Marc Marquez. Andrea Dovizioso juga meraih hasil cukup bagus bersama Ducati dengan duduk di urutan kelima. Dani Pedrosa hanya menduduki posisi kedelapan,

di belakang Alvaro Bautista dan Stefan Bradl. Aleix Espargaro dan Nicky Hayden melengkapi posisi sepuluh besar. (int)

Hasil Free Practice I MotoGP Qatar Yamaha 1m56.685s Tech 3 Yamaha 1m56.743s + 0.058s Yamaha 1m56.756s + 0.071s Honda 1m57.276s + 0.591s Ducati 1m57.538s + 0.853s Honda 1m57.601s + 0.916s Honda 1m57.670s + 0.985s Honda 1m57.749s + 1.064s Aspar Aprilia 1m57.843s + 1.158s Ducati 1m57.926s + 1.241s Tech 3 Yamaha 1m58.369s + 1.684s Ducati 1m58.559s + 1.874s Ducati 1m58.575s + 1.890s FTR-Kawasaki 1m59.608s + 2.923s Aspar Aprilia 1m59.633s + 2.948s Aprilia 1m59.758s + 3.073s FTR-Kawasaki 2m00.341s + 3.656s Aprilia 2m00.426s + 3.741s FTR-Kawasaki 2m00.563s + 3.878s FTR-Kawasaki 2m01.227s + 4.542s Ioda-Suter-BMW 2m01.438s + 4.753s FTR-Honda 2m01.942s + 5.257s Ioda-Suter-BMW 2m02.079s + 5.394s PBM-Aprilia 2m02.135s + 5.450s

Hasil lengkap babak perempatfinal: Dae Eun Kim/Baek Choel Shin vs Ricky Karanda Suwardi/Md Ulinnuha 13-21 21-17 21-12 Suo Di vs Lindaweni Fanetri 21-13 21-18 Liu Yuchen/Huang Dongping vs Markis Kido/ Pia Zebadiah Bernadet Shin Baek Cheol/Jang Ye Na vs Riky Widianto/Richi Puspita Dili 16-21 21-7 13-21 Kim Dae Eun/Baek Choel Shin vs Ricky Karanda Suwardi/M Ulinnuha 13-21 21-17 21-12 Savitree Amitrapai/Sapsiree Taerattanachai vs Komala Dewi/Jenna Gozali 21-9 21-9 Irfan Fadhilah/Weni Anggraini vs Kim Dae Eun/Kim So Young 21-17 21-12 Angga Pratama/RyanAgung Saputra vs Berry Angriawan/Yohanes Rendy Sugiarto 21-11 21-18 Mohammad Ahsan/Hendra Setiawan vs Kien Keat Koo/Boon Heong Tan 21-18 21-15 Alamsyah Yunus vs Lee Dong Keun 21-12 21-14 Aprilsasi Putri Lejarsar Variella/Vita Marissa vs Vivian Kah Mun Hoo/Khe Wei Woon 21-11 21-19

motor tim Yamaha yang mendominasi pada sesi ini. Selain Lorenzo, pembalap Yamaha Tech 3, Cal Crutchlow juga mampu menempati peringkat kedua dan Valentino Rossi ada di posisi ketiga. “Itu yang membuat kami tidak mampu mencat atkan waktu terbaik. Kami berharap semua membaik pada sesi besok dan kami bisa mencatatkan waktu lebih baik lagi,” tandasnya. (int)

Hasil Free Practice I Moto2 Qatar

Rafid Topan Terpuruk Australia Grand Prix Gold

Indonesia Loloskan 5 Wakil ke Semifinal

INDONESIA hanya meloloskan lima pemain ke babak semifinal Australia Grand Prix Gold 2013. Nomor ganda putra menjadi Wakil yang terbanyak karena meloloskan dua pasangan. Dalam pertandingan di Sydney Convention & Exhibition Centre, Jumat (5/4), ganda putra Mohammad Ahsan/Hendra Setiawan berhasil mendapatkan tiket ke babak empat besar setelah menumbangkan pasangan Malaysia, Kien Keat Koo/ Boon Heong Tan 21-18 21-15. Tiket ke babak semifinal juga berhasil diraih Angga Pratama/Ryan Agung Saputra. Ganda putra unggulan kedua ini mendapatkan satu tiket setelah menyingkirkan rekan

senegaranya Berry Angriawan/ Yohanes Rendy Sugiarto lewat straight game 21-11 21-18. Kejutan kembali berhasil dibuat Alamsyah Yunus. Pemain yang menempati unggulan ke-12 ini menjadi tunggal putra tersisa Indonesia di turnamen ini di babak semifinal. Alamsyah mengalahkan Lee Dong Keun lewat straight game 21-12 21-14. Aprilsasi Putri Lejarsar Variella/Vita Marissa juga berhasil mendapatkan satu jatah tiket ke babak semifinal. Secara mengejutkan pasangan Indonesia menyingkirkan Vivian Kah Mun Hoo/Khe Wei Woon yang menempati unggulan ketiga dengan skor 21-11 2119. (int)

Legenda F1 Jagokan Hamilton Juara LEGENDA Formula One, Jackie Stewart tidak meragukan kemampuan pembalap Mercedes, Lewis Hamilton untuk menjuarai Formula One musim ini. Menurut Stewart, Hamilton memulai musim 2013 dengan baik, meski sebagian pihak sempat meragukan driver asal Inggris itu. Hamilton finis di peringkat kelima pada balapan pembuka musim ini di Grand Prix Australia, dan menyelesaikan balapan di posisi ketiga sepekan kemudian di Grand Prix Malaysia. Stewart percaya Hamilton masih punya peluang untuk sukses, terutama tren positif yang terus ditunjukkan mantan pembalap McLaren. “Ya, mereka (Mercedes) bisa memenangkan balapan. Lewis (Hamilton) akan mengemudkan mobilnya dengan maksimal, tak peduli mobil apa yang dia kendarai,” ujar Stewart, seperti dilansir BBC Sport, Jumat (5/4).

“Mereka bisa menjadi penantang untuk gelar musim ini, tapi mereka butuh lebih berkembang untuk menyamai Red Bull dan Ferrari,” jelasnya. Stewart menyatakan, kendati beberapa tim juga bakal kompetitif, seperti Lotus dan McLaren, pria berusia 73 tahun ini yakin Mercedes memiliki faktor lain yang bisa menjadikan pabrikan asal Jerman menjadi juara. “Lotus sangat kompetitif juga, dan McLaren akan berusaha membuktikan, tapi Ross Brawn (Tim Prinsipal Mercedes) adalah pria bertalenta luar biasa. Mercedes mampu untuk menang, dan mereka punya sumber daya yang memadai,” tandasnya. (int)

DONI Tata Pradita dan Rafid Topan Sucipto tidak berdaya menghadapi free practice I atau sesi latihan bebas Moto2 di Qatar. Kedua pebalap tidak mampu menembus 10 besar dalam sesi pembuka ini. Dalam sesi latihan bebas yang berlangsung di Sirkuit Losail, Jumat

(5/4), Doni yang Hasil Free Practice I Moto2 Qatar memperkuat Federal 1. Takaaki NAKAGAMI, Japan (KALEX), 2:00.924 Oil Gresini tampil 2. Esteve RABAT, Spain (PONS KALEX), 2:01.016 (PONS KALEX), 2:01.110 lebih baik. Pembalap 3. Pol ESPARGARO, Spain (KALEX), 2:01.433 kelahiran Sleman itu 4. Scott REDDING, UK 5. Julian SIMON, Spain (KALEX), 2:01.838 hanya mampu 6. Simone CORSI, Italy (SPEED UP), 2:01.846 menempati 7. Dominique AEGERTER, Swis (SUTER), 2:01.940 peringkat 28 dengan 8. Mika KALLIO, Finland (KALEX), 2:01.981 catatan waktu 2 9. Alex De Angelis, San Marino (SPEED UP), 2:02.051 menit 05.087 detik. 10. Nicolas TEROL, Spain (SUTER), 2:02.121 Sedangkan hasil —lebih buruk didapat 28. Doni Tata PRADITA, Indonesia (SUTER), 2:05.087 oleh Rafid Topan. 32. Rafid Topan SUCIPTO, Indonesia (SPEED UP), 2:07.050 Topan yang Takaaki Nakagami. Pembalap asal merupakan pembalap QMMF Racing Jepang itu melesat di urutan Team, justru berada di posisi paling terdepan dengan catatan waktu buncit dari 32 pebalap yang 2’00.924 detik. Dua pebalap asal mengikuti tes ini.Topan hanya Spanyol Esteve Rabat dan Pol mampu mencatat waktu 2’07.050 Esparago berada tepat di detik. belakangnya. (int) Pebalap paling cepat diraih


DIJADIKAN Nama Jalan di Inggris KUMPULAN istri dan kekasih atau yang lebih dikenal dengan nama WAGs (Wifes and Girlfriends) semakin terkenal saja di Inggris. Istilah WAGs memang muncul di Negeri Ratu Elizabeth II tersebut ketika para istri dan kekasih timnas Inggris berbondong-bondong menyaksikan kekasih mereka di Piala Dunia 2006. Tak heran jika Inggris menamakan jalanan di London dengan nama WAGs. Ya, Kini para WAGs pesepakbola Inggris boleh berbangga hati karena kini ada nama jalan yang bernama “Wagmore Street, W1”. Adalah Danielle O’ Hara (Istri pesepakbola Wolverhampton Wanderers, Jamie O’Hara) Nicola McLean (Istri Tom Williams dari Notts County) dan Bianca Slater (Kekasih Ryan Bertrand dari Chelsea) yang didaulat meresmikan nama jalan yang sebelumnya bernama “Wigmore Street” tersebut. Rupanya ketiga wanita cantik ini merupakan duta besar dari Football Pools, yaitu sebuah badan taruhan resmi di Inggris. “Kami sangat bersemangat untuk menunjukkan ke masyarakat di Inggris jika WAGs juga mengetahui sepakboa,” ujar Danielle seperti dilansir (int)


SABTU 6 April 2013



Bursa METRO WBA ½ : 0 Arsenal Prediksi Skor WBA 1-2 Arsenal

DUO pemain Arsenal Theo Walcott dan Jack Wilshere tengah menepi karena bekapan cedera. Keduanya diprediksi absen saat Arsenal melawat ke kandang West Bromwich Albion (WBA), dan mungkin kembali bermain mulai pekan depan.


ilshere kembali menda patkan cedera pada 12 Maret lalu. Dia diprediksi membutuhkan waktu selama tiga pekan untuk menyembuhkan cedera pergelangan kaki yang membekapnya. Belum juga Wilshere pulih, satu

„ Walcott dan Wilshere

Chelsea 3-1 Rubin Kazan


Ketajaman El Nino DUA gol yang diciptakan Fernando Torres ke gawang Rubin Kazan membuat manajer interim Chelsea, Rafa Benitez, puas. Benitez pun berharap Torres bisa mencetak gol lagi di laga selanjutnya. Torres tampil cemerlang saat Chelsea menjamu Rubin di leg pertama perempatfinal Liga Europa, Jumat (5/4) dinihari. El Nino mencetak dua gol dan membantu The Blues menang dengan skor 3-1. Dengan tambahan dua gol itu, Torres sudah mencetak 19 gol dalam 52 laga di semua kompetisi musim ini. “Ini bagus untuk kepercayaan dirinya. Tapi, kinerjanya di lapangan juga sangat bagus. Jadi, saya sangat senang dengannya,” aku Benitez yang dikutip BBC. Saat ini Torres tak mendapatkan jaminan sebagai starter di lini depan Chelsea. Striker asal Spanyol itu harus menghadapi persaingan dengan Demba Ba. “Dia berlatih dengan sangat baik setiap hari, jadi ini cuma masalah waktu saja. Dia mencetak dua gol hari ini dan semoga akan begitu lagi di pertandingan berikutnya,” kata Benitez. Harusnya Menang Besar Skor 3-1 yang didapat The Blues tak lantas memuaskan Rafael Benitez yang merasa skuatnya layak unggul lebih besar. Di Stamford Bridge, Jumat (5/4) dinihari, dua gol kemenangan Chelsea dibuat Fernando Torres sementara satu lainnya dilesakkan oleh Victor Moses. Gol balasan tim tamu datang dari eksekusi penalti Bebars Natcho. Meski meraih kemenangan, Rafael Benitez tak sepenuhnya puas dengan hasil tersebut. Chelsea disebutnya bisa tampil lebih baik lagi dan mencetak keunggulan dengan skor lebih besar. “Itu bisa saja lebih baik lagi, tapi saya tak bisa mengubah keadaannya sekarang. Penalti itu keputusan yang keras, tapi Anda tak bisa mengubah keputusan itu, jadi Anda harus melanjutkannya dan mencetak gol ketiga. Kami berhasil melakukannya (mencetak gol ketiga) tapi saya mengharapkan gol keempat,” sahut Rafa usai pertandingan seperti diberitakan BBC. Kecolongan satu gol saat bermain di kandang bisa jadi membahayakan peluang Chelsea lolos. Di leg kedua yang dilangsungkan pekan depan, Chelsea bakal terdepak andai wakil Rusia itu bisa menang 2-0. Namun Rafa yakin dengan kemampuan timnya yang punya banyak pemain top dunia. “Akan lebih sulit (di leg kedua) karena mereka akan bermain menyerang dan menyerang, tapi kami punya kualitas di tim kami,” lanjut pelatih berkebangsaan Spanyol itu. Jalan Pertandingan Percobaan Ramires pada menit ke-11 tak terlalu membahayakan gawang Rubin. Sepakan kerasnya dari luar kotak penalti masih melambung tinggi. Lima menit kemudian, Chelsea membuka skor. Umpan panjang David Luiz dari tengah lapangan diterima Torres yang berlari di kotak penalti. Meski dikawal satu bek lawan, Torres masih bisa

kabar kurang menggembirakan didapat oleh Arsenal. Walcott mengalami cedera kunci paha usai memenuhi panggilan membela Inggris di kualifikasi Piala Dunia. Terkait kondisi Walcott dan Wilshere, asisten manajer ‘Gu-

dang Peluru’, Steve Bould, menyampaikan kabar positif. Dia mengungkapkan bahwa kedua pemain itu diprediksi bakal comeback pekan depan. “Kami mempunyai kabar bagus terkait keduanya,” ungkap Bould seperti dilansir situs resmi Arsenal. “Jack (Wilshere) dan Theo (Walcott) sudah bisa berlari di luar latihan tim dan memiliki peluang untuk bisa masuk dalam pertandingan melawan Norwich (City) pada hari Sabtu pekan depan,” tambahnya. (int)

- Arsenal berhasil menaklukkan West Bromwich Albion 2-0 pada pertemuan pertama kedua tim musim ini di Emirates Stadium, berkat dua penalti Mikel Arteta. Ini adalah kemenangan ketiga Arsenal atas West Brom secara beruntun. Arsenal juga berhasil mengalahkan West Brom 3-2 pada pertemuan terakhir kedua tim di Hawthorns musim lalu. West Brom belum pernah lagi mengalahkan Arsenal di Hawthorns sejak Oktober 2005. - West Brom belum beranjak dari peringkat-8 klasemen dengan 44 poin dari 31 pertandingan, terpaut sembilan poin dari Arsenal di zona Eropa. West Brom menyerah 1-3 dari West Ham akhir pekan lalu, dan harus rela kehilangan gelandang

Youssouf Mulumbu yang mendapat kartu merah. - Performa West Brom sedang tidak konsisten, hanya mampu meraih tiga kemenangan dari 12 laga terakhirnya di Premier League dan menelan tujuh kekalahan. - West Brom juga selalu kebobolan dari enam laga kandang terakhirnya di Premier League, dengan tiga kemenangan dan menelan dua kekalahan. Sebanyak 26 dari total 41 kebobolan West Brom tercipta di babak kedua. - Striker West Brom Romelu Lukaku adalah topskor klub dengan 13 gol. - Arsenal belum beranjak dari peringkat-5 klasemen dengan 53 poin dari 30 laga, terpaut hanya dua poin

dari zona Champions. Arsenal berhasil membantai Reading 4-1 akhir pekan lalu di Emirates Stadium. - Arsenal hanya kalah sekali dari delapan laga terakhirnya di Premier League, meraih enam kemenangan dan sekali imbang. Performa tandang Arsenal di Premier League sejauh ini adalah enam kemenangan, lima imbang, dan empat kekalahan. - Arsenal tidak pernah gagal mencetak gol pada sembilan laga terakhirnya di Premier League. Arsenal juga tidak pernah gagal mencetak gol pada delapan laga tandang terakhirnya. - Gelandang Arsenal Santi Cazorla adalah topskor klub dengan 12 gol. Sebanyak 36 dari total 59 gol Arsenal tercipta di babak kedua

PRAKIRAAN PEMAIN: West Bromwich Albion ( 4-3-3 ) : 1.Ben Foster ( Kiper ) , 3.Jonas Olsson ( Bek ) , 6.Liam Ridgewell ( Bek ), 23.Gareth McAuley ( Bek ), 12.Steven Reid ( Bek ), 5.Claudio Yacob (Gelandang ), 7.James Morrison ( Gelandang ) , 21.Youssuf Mulumbu (Gelandang ), 22.Zoltán Gera (Striker), 9.Shane Long ( Striker ),24.Peter Odemwingie (Striker) Arsenal ( 4-4-2 ) : 24.Vito Mannone, ( Kiper ) , 4.Per Mertesacker ( Bek ) , 5.Thomas Vermaelen (Bek ), 11.Andre Santos ( Bek ), 6.Laurent Koscielny ( Bek ), 2.Abou Diaby ( Gelandang ), 8.Mikel Arteta ( Gelandang ) , 19.Santiago Cazorla (Gelandang ), 16.Ramsey ( Gelandang ), 17.Olivier Giroud ( Striker ), 9.Lukas Podolski ( Striker ).

Musim Bale Terancam Habis

„ Torres menceploskan bola ke dalam gawang melewati hadangan kiper Sergei Ryzhikov. Rubin hampir saja menyamakan kedudukan pada menit ke-20. Tendangan Natcho dari luar kotak penalti melaju deras ke gawang Chelsea, tapi Petr Cech mampu mementahkannya. Tim tuan rumah menggandakan keunggulannya pada menit ke-32. Moses yang mendapatkan bola liar di kotak penalti Rubin melepaskan tendangan voli yang tak bisa diantisipasi Ryzhikov. Berselang delapan menit, Rubin mendapatkan hadiah penalti menyusul handball John Terry di area terlarang. Natcho maju sebagai eksekutor dan sukses mengelabui Cech. Chelsea 2, Rubin 1. Rubin nyaris menyamakan skor pada menit ke-45. Sial buat mereka, sepakan keras Cristian Ansaldi masih melenceng tipis. Empat menit setelah babak kedua dimulai, Juan Mata punya kesempatan untuk mencetak gol. Namun, tendangannya bisa digagalkan Ryzhikov. Peluang yang didapat Terry pada menit ke-60 juga tak mengubah keadaan. Sundulannya meneruskan sebuah sepak po-

jok masih melambung. Beberapa saat kemudian, gawang Chelsea diancam Salomon Rondon. Tapi, tembakan Rondon dari depan kotak penalti bisa diamankan Cech. Memasuki menit ke-70, Torres kembali mencatatkan namanya di papan skor. Diawali umpan silang Mata dari sisi kiri, dia mengalahkan Ansaldi dalam duel udara dan menanduk bola ke dalam gawang. Ramires menjajal peruntungannya lagi pada menit ke-90 lewat tendangan voli dari luar kotak penalti. Tapi, arah bola masih melebar. (int) SUSUNAN PEMAIN CHELSEA: Cech, Azpilicueta, Luiz, Terry, Bertrand, Ramires, Lampard, Moses (Hazard 65'), Mata (Oscar 78'), Benayoun (Marin 83'), Torres RUBIN: Ryzhikov, Navas, Kuzmin (Kasaev 82'), Kaleshin, Ansaldi, Orbaiz, Sharonov, Eremenko, Natcho, Karedeniz, Dyadyun (Rondon 46')

LONDON- Gareth Bale terkapar di atas lapangan dan mengerang kesakitan sebelum ditandu keluar lapangan. Terpelintir di bagian pergelangan kaki, Tottenham Hotspur terancam ditinggal pemainnya itu sampai akhir musim. Sempat tertinggal dua gol, Tottenham Hotspur akhirnya bermain imbang 2-2 saat menjamu FC Baseldilegpertamababakdelapan besarLigaEuropa.KubuSpursjelas tak puas dengan hasil tersebut, namunadahallainyangmembuat mereka masih merasakan kegetiran terkait kondisi Gareth Bale. Saat pertandingan memasuki periode injury time babak kedua, Bale terjatuh dalam posisi yang tidak sempurna usai berebut bola dengan pemain Basel. Tayangan ulang memperlihatkan pergelangan kaki pemain Wales itu seperti terpelintir. Kondisi tersebut membuat dia dikhawatirkan mengalami cedera parah di pergelangan kaki dan bisa menyebabkan dirinya absen hingga musim ini tuntas. Bale langsung terkapar di atas rumput usai momen tersebut. Dia terlihat mengerang kesakitan dan langsung dihampiri tim medis The Lillywhites. Pesepakbola yang telah mencetak 22 gol di sepanjang musim 2012/2013 itu kemudian ditandu keluar lapangan. “Pergelangan kakinya terputar, saat ini dia merasakan sakit yang amat, tapi semoga yang terjadi bukanlah yang terburuk,” ungkap Andre Villas Boas pada BBC usai pertandingan.

„ Gareth Bale AbsennyaBaleakanjadipukulan buat Spurs di sisa musim ini. Selain akan ditunggu laga sengit pada leg kedua di kandang Basel, mereka masih bertarung untuk meraih posisi empat besar demi meraih tiket Liga Champions musim depan. Basel tercatat tampil sedikit mendominasi dengan memenangi penguasaan bola hingga 51%. Namun, kedua tim sama-sama mendapatkan shots on target sama banyak, yakni enam. Dengan dua gol di markas Spurs, Basel punya keuntungan sebelum berlaga di kandang sendiri pada leg II pada 11 April mendatang. Newcastle Kalah Sementara itu di Stadion Da Luz, Newcastlekalah1-3melawanBenfica. Keunggulan yang diciptakan PapissCissedimenitke-12menjadi

tidakberarti.Setelamenerimaumpan dari Moussa Sissoko, Cisse dengan mudah melepaskan sontekan kaki kanan. Keunggulan ini hanya bertahan sampai menit ke25. Rodrigo membuat tim tuan rumah menyamakan kedudukan lewat sebuah tendangan dari jarak dekat.Sebelumgolitutercipta,Tim Krul sempat memblok seranngan Oscar Cardozo. Babak pertama berakhir dengan skor 1-1. Namun, Benfica yang tampil relatif lebih dominan, dan melepaskan sebanyak 20 tembakan sepanjang laga, menambah dua gol lagi di babak kedua. Kedua gol itu diciptakan oleh Lima Dos Santos pada menit ke-65 dan penalti Cardozo di menit ke-71 — setelah Steven Taylor handball di dalam kotak penalti.(int)


SABTU 6 April 2013





25 2

3 70-31


2 Man City


18 8

4 55-26


3 Tottenham


17 6

8 53-38


4 Chelsea


16 7

7 59-32


5 Arsenal


15 8

7 59-33


6 Everton



5 47-35


7 Liverpool


13 9

9 59-40


8 West Brom


13 5



9 Swansea City 31




10 Fulham


10 9



11 West Ham


10 6



12 Southampton 31

8 10



13 Stoke City


7 13



14 Norwich City 31

7 13



15 Newcastle






16 Sunderland


7 10



17 Wigan






18 Aston Villa






19 QPR


4 11



20 Reading








24 3

2 90-33


2 Real Madrid


19 5

5 72-28


3 Atlético Madrid 29

19 4

6 51-25


4 Real Sociedad 29

13 9

7 51-37


5 Málaga


13 8

8 41-28


6 Valencia


13 7

9 42-41


7 Real Betis


13 5



8 Getafe


12 7



9 Rayo Vallecano 29

13 2



10 Levante


11 7



11 Sevilla


11 5



12 Espanyol






10 5



13 Athletic Club 29



23 3

1 78-13


2 Dortmund


15 7

5 62-32


3 Leverkusen


14 6

7 50-35


4 Schalke 04


12 6

9 46-43


5 Mainz 05


10 9

8 34-30


6 Frankfurt


11 6

9 39-37


7 Freiburg


10 9

8 35-33


8 M’gladbach


9 11

7 35-37


9 Hamburger SV 27

11 5



10 Hannover 96 27

11 4



11 Nürnberg

8 10

8 29-32



12 Stuttgart






13 Bremen






14 Wolfsburg






15 Düsseldorf






16 Augsburg






17 Hoffenheim






18 Greuther









BARCELONA akan menyambut kembalinya Tito Vilanova di bench pertandingan La Liga. Akankah sang pelatih juga membawa kembali superioritas Barca yang sempat menurun?


arca akan menghadapi Real Mallorca pada Minggu (7/4) dinihari di Camp Nou. Menghadapi peringkat 19 klasemen sementara, tentu bukan perkara yang sulit untuk Los Cules. Namun Xavi Herandez dkk patut waspada, karena statistik menunjukkan mereka selalu kebobolan dalam dua partai terakhir di liga, meski melawan tim yang di atas kertas jauh di bawahnya. Dengan cederanya Lionel Messi dan baru pulangnya mereka dari lawatan ke Paris Saint Germain, peluang lawan agak membesar. Bahkan pelatih Mallorca, Gregorio Manzano, telah menyatakan ketidakhadiran Messi sebagai berkah. Tapi kembalinya Vilanova tentu akan membuat skuad Barca lebih bergairah. Barca yang mendapatkan hasil seri dan kekalahan di dua El Clasico di liga musim ini hanya perlu menghindari terjadinya krisis dan kesalahan seperti yang terjadi beberapa saat lalu agar tidak tersusul Madrid. Meski Messi cedera, namun kehadiran Vilanova di tepi lapangan tentu memberi suntikan moral pada para pemain. Patut diingat bahwa Vilanova berhasil membawa anak-anak asuhnya menembus rekor me-

Prediksi Skor Barcelona 3-1 Mallorca Bursa METRO Barcelona 0 : 1 ½ Mallorca

raih 55 poin dari 57 di paruh pertama musim ini. Tanpa Messi Bertandang ke Camp Nou membuat pelatih-pelatih di Liga Spanyol harus berpikir keras untuk meraih hasil terbaik. Tiadanya Lionel Messi setidaknya membuat pelatih Mallorca berkurang pusingnya. Mallorca akan menjadi tamu berikutnya yang berkunjung ke Camp Nou dalam lanjutan Liga Spanyol akhir pekan ini. Meski The Catalans baru bertarung habis-habisan di Liga Champions, tuan rumah tetap dijagokan bisa meraih hasil maksimal dalam laga yang akan digelar. Sadar laga akan sangat sulit, Mallorca setidaknya dapat sedikit kabar baik karena Lionel Messi dipastikan absen. Pemain terbaik dunia itu mengalami cedera hamstring saat berlaga di Paris. Dan disebut pelatih Gregorio Manzano, ketiadaan Messi mengurangi sakit kepala yang dia rasakan jelang laga tersebut. “Sakit kepala menjadi berkurang satu. Dengan Messi absen kami tak harus menghadapi mimpi buruk sepakbola atau mencoba menghentikan pemain yang mencetak gol lebih banyak dari tim yang jumlahnya

s a y a bahkan tidak tahu di Liga Spanyol ini,” seloroh Manzano di Football Espana. “Saya tidak bermaksud mengatakan kalau tanpa Messi berarti Barcelona bisa dikalahkan, karena masalahnya bukan itu. Kondisi yang sebenarnya adalah mereka kehilangan salah satu sumber golnya, pemain yang dikatakan mampu menentukan hasil pertandingan,” lanjut Manzano. Meski tipis, peluang Mallorca meraih poin dari lawatan ke Barcelona terbuka lebar. Selain karena faktor kelelahan, The Catalans fokusnya akan terbagi ke Liga Champions karena tengah pekan depan mereka akan gantian menjamu PSG. “Ya, hal itu jelas, tapi juga sangat relatif karena mereka tak ingin mengecewakan fansnya sendiri dan mencoba meraih kemenangan di akhir pekan ini,” papar dia lagi. (int)



21 5

4 59-19


2 Napoli


17 8

5 55-29


3 Milan


17 6

7 53-32


4 Fiorentina


15 6

9 54-37


15 5 10 47-39


5 Internazionale 30 6 Lazio


15 5



7 Roma


14 5



8 Catania


13 6



9 Udinese



8 38-38


10 Parma


10 8



11 Cagliari


10 8



12 Sampdoria


10 7



13 Bologna


10 6



14 Torino


8 12



15 Chievo


10 5



16 Atalanta


10 6



17 Genoa






18 Siena






19 Palermo


4 12



20 Pescara






AGENDA METRO SABTU (6/4) 15.30 WIB :Persija 21.45 WIB :Rennes 22.00 WIB :WBA 23.45 WIB :Juventus 23.45 WIB :Real Madrid

vs vs vs vs vs

Persiram (ISL) : PSG (Ligue 1 Prancis) : Arsenal (Liga Inggris) : Pescara (Serie A Italia) : Levante (Liga Spanyol) :

MINGGU (7/4) 00.45 WIB :Montpellier 03.40 WIB :Barcelona 15.30 WIB :Persib 18.30 WIB :Fiorentina 18.45 WIB :Saint-Etienne 19.00 WIB :Mitra Kukar 21.00 WIB :Sampdoria 20.30 WIB :Liverpool 21.45 WIB :Reims 22.00 WIB :Chelsea

vs vs vs vs vs vs vs vs vs vs

Valenciennes (Ligue 1 Prancis) : B Channel (Live) Mallorca (Liga Spanyol): (Trans TV) Persiba Balikpapan (ISL) : ANTV (Live) AC Milan (Serie A Italia) : TVRI (Live) Evian TG (Ligue 1 Prancis) : B Channel (Live) Barito Putera (ISL) : ANTV (Live) Palermo (Serie A Italia) : TVRI (Live) West Ham United (Liga Inggris) :Global Tv (Live) Lyon (Ligue 1 Prancis) : B Channel (Live) Sunderland (Liga Inggris) : Global Tv (Live)

ANTV (Live) B Channel (Live) Global TV (Live) TVRI (Live) Trans TV (Live)



Manfaatkan Euforia Champion WALAU peluang untuk mengejar Barcelona dalam perebutan gelar juara La Liga 2012/2013 sulit, Real Madrid tetap mematok poin penuh saat menjamu Levante akhir pekan nanti. Euforia kemenangan atas Galatasaray di leg pertama perempatfinal Liga Champion 2012/2013, akan menjadi penyemangat bagi skuad lapis kedua Los Blancos saat laga melawan Levante. Poin penuh wajib diusung skuad asuhan Jose Mourinho ini guna menghindari kejaran Atletico Madridyanghanyaberselisih1poindariRealMadrid. Jose Mourinho diprediksi akan menurunkan pemain pelapisnya pada laga melawan Levante nanti, guna memberi kesempatan untuk beristiraht bagi para pemain inti, karena tengah pekan depan Real Madrid kembali akan bertarung melawan Galatasaray di leg kedua babak perempat final Liga Champion 2012/2013. El Real yang tertinggal 13 poin dari Barcelona akan berusaha mengamankan posisi dua sekaligus menjaga peluang menjuarai Copa Del Rey dan meraih Liga Champions ke sepuluh. Mereka harus fokus bersaing dengan Atletico di liga dan final Copa. Meskipun pertengahan pekan ini Real Madrid harus melakukan pertandingan krusial di saat berhadapan dengan Galatasaray, namun El Real memiliki skuat hebat yang berlapis-lapis. Jika pun mereka menurunkan pemain lapis kedua pada pertandingan melawan Levante, hal itu tetap membuat Real Madrid lebih diunggulkan. Levante yang menempati posisi sepuluh klasemen sementara La Liga dengan koleksi poin sebanyak 40 angka, sejauh ini masih aman dari ancaman zona degradasi. Untuk itu, mereka akan

bermain bertahan dengan mengincar hasil minimal imbang dalam pertandingan ini. Hal itu sangat logis untuk dilakukan, mengingat skuad yang dimiliki oleh Levante masih kalah jauh secara kelas dari para pemain Real Madrid. Pada pertandingan pertama kedua tim di musim ini,RealMadridsuksesmengalahkanLevantedalam laga tandang di markas Levante. Saat itu, skuat besutan Jose Mourinho menang dengan skor tipis 2-1. (int)

ePaper | METRO SIANTAR Online