Issuu on Google+

PLUS: REGIONAL NEWS | EXPO COVERAGE | FINANCE | COUNTRY PROFILE | LEGAL

www.thefranchisemagazine-mena.com

SALMONTINI: THE SALMON OF KNOWLEDGE The Franchise Magazine MENA takes a look at Lebanese success Salmontini La Maison du Saumon.

Franchise magazine-Final.indd 1

ISSUE 03 | January - February 2012

|| ABHA FRANCHISE 2012 – SAUDI ARABIA TO HOST ABHA FRANCHISING EXHIBITION 2012 p10

UAE DHS 20 | Kuwait KD 1.5 Egypt E £20 | KSA SR 20 | Bahrain BD 2.00 Jordan JD 3.5 | Lebanon LL 7500 Qatar QR 20 | Oman OR 2.0

03/02/12 9:52 AM

REGIONAL NEWS

2|

JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 2

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

CONTENTS

09|

20|

11| REGIONAL NEWS...

06|

09|

LANDMARK LAUNCH FOR UK LADIES CLOTHING LABEL LIPSY LANDMARK International has signed a deal with British fashion label Lipsy to launch the clothing brand in the Middle East. CANADIAN COFFEE SHOP TIM HORTON’S TAKES A BITE OF THE MIDDLE EAST TIM Horton’s Café and Bake Shop introduced a taste of Canada to the UAE when it opened its first outlet in last September. And now it looks like some Middle Eastern flavour might find its way to North America via Tim Horton’s.

COUNTRY PROFILE

16|

LEBANON

The Franchise Magazine MENA examines the franchise market in the Lebanon

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 3

FRANCHISE OPPORTUNITES..

EXCLUSIVE INTERVIEW

11|

EXCLUSIVE INTERVIEW: DONALD BOROIAN, CHAIRMAN OF FRANCORP INC. An exclusive interview with one of the world’s foremost franchising executives with over 40 years of professional field and consulting experience, Donald Boroian, Chairman of Francorp Inc.

COVER STORY....

20|

SALMONTINI: THE SALMON OF KNOWLEDGE The Franchise Magazine MENA takes a look at Lebanese success Salmontini La Maison du Saumon. It took a year of planning before founders Hussni Ajlani and Joe Basilli felt that the restaurant world was ready for their salmon inspired concept. It has been a decade since Salmontini Le Resto was launched, paving the way for sister restaurants Salmontini Le Fumoir, Salmontini La Boutique, and Salmontini.

18 27 28 30 33 35 37 38 42

MIDAMAR BRITISH ORCHARD NURSERY INSTANT SKIN CHARLEY’S GRILLED SUBS SECOND CUP SENSE GOURMET & FIGARO’S PIZZA LONDON FISH & CHIPS ANT VENTURES LFA DIRECTORY

JANUARY - FEBRUARY 2012

|3

03/02/12 9:52 AM

EDITORIAL

Stephen O’Donovan Director

Lebanon leads the way in the Middle East

T

his edition of the Franchise Magazine MENA is the first of a new year. The end of 2011 finished on a positive note for the franchise market in the Middle East and North Africa. And while the entire world is facing economic uncertainty, the franchise market for 2012 looks promising. In this edition we take a special look at the market in Lebanon. The Lebanese Franchise Association (LFA) have provided an insight into the organisation and the services they provide members. You can read all about what LFA Chairperson Charles Arbid has to say about the principles of entrepreneurship, determination and innovation in the comment section. We also bring you directory of all LFA members. This provides a thorough, yet concise overview of Lebanese franchise opportunities. Whether you are looking to buy an established franchise and plan to operate in Lebanon, or if you intend to launch elsewhere in the Middle East, we are pleased that our extensive list will point you in the right direction. Our cover story focuses on one of the biggest success stories in Lebanon’s restaurant business. The hugely popular Salmontini restaurant, which

was first established in Beirut in 2001, is the subject of our special feature. Having celebrated 10 years in business, Salmontini has since expanded to Dubai and has just launched its first franchise in Saudi Arabia.But this is issue is not all about what Lebanon has to offer. Also featured within the following pages are London Fish and Chips. Based in Dubai, this seafood culinary experience is promoting its 10 year anniversary. There is plenty going on in the franchise scene to get you out an about. In January Saudi Arabia will play host to the very first Abha Franchising Exhibition. Taking place on January 30-31, the two day event will look at all aspects of the franchising market. Expanding to the Middle East, expanding from the Middle East, or expanding within the Middle East – this expo caters to all aspects of the franchise industry. Meanwhile, in our news section we bring you all the latest on the franchising front in the Middle East and North Africa. From fashion to food, we’ve got it covered. And don’t forget our online edition available at your finger tips! Log on to www. thefranchisemagazine-mena.com for up to date information on franchise opportunities in the MENA region.

The Franchise Magazine Middle East and North Africa is published by Apex Middle East Services For editorial, advertsiing or subscriptions enquiries, please contact us today: Tel +971 4 3042510 | Fax +971 4 3042511 | visit www.thefranchisemagazine-mena.com | post: Apex Middle East P.O Box 32429 RAK Media City, Al Jazeera - Al Hamra Ras Al Khalmah. Apex Middle East is a BVI registered company. | Printed by : International Printing Press This magazine is distributed through newsagents through out the Middle East, subscriptions, exhibitions, banks, hotels, airports and professional advisors This magazines editorial and advertisiments for companies featured is not a recommendation from the magazines editorial team and readers should take advice from professionals experianced in Franchising.

4|

JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 4

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

REGIONAL NEWS

-mena.COM

WWW.

For uptodate news - data - exhibitions - directory - jobs - real estate - legal - finance - consultants - franchise concepts For marketing and advertising please call 00971 4 3042510

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 5

JANUARY - FEBRUARY 2012

|5

03/02/12 9:52 AM

REGIONAL NEWS

LANDMARK launch for UK ladies clothing label Lipsy MIDDLE EAST | LANDMARK International has signed a deal with British fashion label Lipsy to launch the clothing brand in the Middle East. The first Lipsy outlets will launch in Qatar, Bahrain, UAE, and Lebanon early this year. Landmark International, a subsidary of the Landmark Group, already runs franchise outlets for women’s high street favourites Reiss and New Look, and also retail chains Koton and Aftershock. Launching Lipsy in the region is the latest in the company’s plan to manage and develop a portfolio of international labels. The trendy London born label is popular in the fashion stakes due to its celebrity endorsements, from a galaxy of pop stars, including Pixie Lott, The

Saturdays, Miley Cyrus, and Girls Aloud singer Kimberly Walsh. It is also the go-to label for partywear and cocktail dresses amongst the late teen-to-twenty something market. Jeremy Stakol, CEO at Lipsy, said “This is a key milestone in our international expansion and underscores the international appeal of our brand. We are delighted to be working with the team at Landmark and look forward to introducing Lipsy to their customers.”

First LK Bennet UAE franchisee debuts in Dubai UAE | A RETAIL favourite of the future Queen

Since it was founded by Linda Bennett in London

of England, the first LK Bennett boutique to open

in 1990 the label has attracted a host of high profile

in the Middle East brings with it a piece of London’s

fans, with the Duchess of Cambridge being the latest

Brompton Road to Mirdif City Centre Mall.

to draw attention to the clothing and accessories

And when the high end fashion store officially opened its doors in late November, management were

range. Bensoussan added: ‘It is true that the duchess

extremely positive about the new venture. But the

has helped with our image, as she has been wearing

label’s high profile amongst style conscious Emriati

some of the products we sell extremely well. We’re

ladies meant that the popularity of LK Bennett will

very happy she is a fan, and wish that we’ll have some

not rely solely on the British Royal Family’s fashion

celebrity fans within the region soon.”

choices. Chairman of LK Bennet Robert Bensoussan

Kate Middleton’s much-favoured Maddox raffia platform wedge – as worn by the princess the day after

There are plans afoot to open three to four more stores, and within the next three years there could be six to eight LK Bennett outlets in the Middle East.

explained that the decision to open here was an easy

the royal wedding – are available in-store in coral,

one. He said, “We have a lot of customers in the UK

black, turquoise, and nude. Kate’s much-worn nude

for our first store in the Middle East, as it is a hub.

who are Emirati, so we know that our products appeal

Sledge pumps are also available for Dh 1,045. Already

More stores in Dubai are on the cards and so is Abu

here. We also have a lot of customers buying our bags

sold out across the UK, they are expected to fly off

Dhabi. With our partners (Jashanmal Group), we plan

and the clothing, so we believe that there is a good

the shelves here too. Plans to open more LK Bennett

to open many more – at least three or four more.

client-base, plus we have a fantastic relationship of

stores across the UAE are already in the early stages,

In the whole region, we’ll have between six to eight

price to quality, and that’s what counts.”

with Dubai and Abu Dhabi being the main locations.

stores, hopefully, within the next three years.”

6|

JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 6

According to Bensoussan: ‘Dubai seemed natural

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

REGIONAL NEWS

Richoux of London set to open in Oman

OMAN | UPMARKTET British restaurant chain Richoux of London is set to open in Oman and has plans to expand into the rest of the Middle East. Richoux is a café all-day dining concept with branches in the swankiest parts of London that has been in operation for more than a century. A newcomer to Qatar, Richoux already has franchise operations in Qatar and Egypt. And with its high profile locations in central London such as Mayfair and Knightsbridge, Richoux already has a strong customer following in the Middle East. The new Muscat-based franchisee is Amlaak Al Qurm and their first Richoux location will be in the recently opened Royal Opera House Mall. Further expansion plans are under way for the rest of the Middle East and the next area to be targeted by Richoux is the UAE. Richoux is inviting interest from potential partner groups in Dubai and Abu Dhabi. Current Richoux restaurants are located in four prestigious areas of London: St John’s Wood, Piccadilly, Mayfair and Knightsbridge. These areas are home to high-end department stores Harrods, Harvey Nichols, and Fortnum and Mason – all of

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 7

which are extremely popular with Emirati shoppers and big spenders. Founded in 1909, Richoux restaurants, which are famous for their patisserie, are open all day for breakfast, morning coffee, lunch, afternoon tea, and dinner. In the 100 years since Richoux restaurants opened, they have become iconic eateries for pretheatre meals, business breakfasts or afternoon teas.

Further expansion plans are under way for the rest of the Middle East and the next area to be targeted by Richoux is the UAE. Richoux is inviting interest from potential partner groups in Dubai and Abu Dhabi.”

Liquid Nutrition secures license CANADIAN performance drink Liquid Nutrition Group Inc has secured its first international license partner in the United Arab Emirates. Under the agreement, Liquid Nutrition Middle East will be responsible for the aggressive growth plans in the region. Liquid Nutrition Middle East was formed with high profile business leaders from the Middle East, including His Excellency Sheikh Mohammed Bin Butti Al Hamid, Ahmad Nimer, Mubarak Matar Al Humairi, Mohammed Loay, and Abdalla Nimer President of Liquid Nutrition Group Inc Glenn Young shared his enthusiasm over the deal. He said: ‘We are pleased that the Liquid Nutrition brand has attracted global interest so quickly. This is a significant milestone for the company and we are honoured to be partnerinng with distinguished leaders from the Abu Dhabi business community to launch Liquid Nutrition throughout the Middle East and North Africa.” Liquid Nutrition Group Inc is a functional beverage, vitamin and supplement brand committed to bringing healthy eating to communities around the world. The brand carries more than 25 different functional beverages prepared fresh for each customer. From protein drinks to meal replacements, Liquid Nutrition is suitable for anyone looking to taking control of, and improve, their health. One of the most popular products is the ‘Early Bird’, which is a breakfast meal replacement consisting of fruit, vitamin supplementsand oatmeal. It is a progressive lifestyle brand committed to engaging with consumersinterested in improving their personal health and nutrition. In 2008 research performed by the Health Authority Abu Dhabi (HAAD) revealed that 70 per cent of UAE residents over the age of 18 are classified as overweight or obese. The first location in Abu Dhabi is due to open later this spring (2012). Liquid Nutrition Franchising Corporation, LNGI is the current franchisor of six stores located in Montreal, with franchise and expansion opportunities throughout Canada and the United States, as well as license opportunities internationally.

JANUARY - FEBRUARY 2012

|7

03/02/12 9:52 AM

REGIONAL NEWS

delivering commercial legal LEGAL advice across the middle east

8|

www.trowers.com

JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 8

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

REGIONAL NEWS

Canadian coffee shop Tim Horton’s takes a bite of the ME MIDDLE EAST | TIM Horton’s Café and Bake Shop introduced a taste of Canada to the UAE when it opened its first outlet in last September. And now it looks like some Middle Eastern flavour might find its way to North America via Tim Horton’s. The zaatar croissant proved so popular with Tim Horton’s bosses during business trips to the UAE during the preliminary franchise development stages that the coffee company is considering introducing the Middle Eastern delicacy to their Canadian and US menu. Tim Horton’s US and International Chief Operations Officer David Clanachan revealed possible plans to bring the zaatar croissant back west. He said: ‘The only one thing we added to the

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 9

menu was the zaatar croissant. There are products from this region we’d like to bring back to the US and Canada. And certainly the zaatar croissant is something we would like to introduce to our menus in North America. But we’re constantly looking for innovative ideas.’ The first Tim Horton’s outlet in Dubai opened last September on the Sheikh Zayed Road, with another outlet opening at Jumeirah Beach Residence in December. For the most part the branches in the UAE share the same features as outlets in North America. However, there are just a few minor differences between Dubai and the original of the species back in Canada. Unfortunately, neither the 24 hour drive thru service nor the Everything Bagels

survived the transition. However, Tim Horton’s head honchos are confident that the brand will be welcomed by the multi cultural community in the UAE. And in a bid to make its mark the coffee house is going beyond traditional “mall locations”. Master License Agreement holders Apparel CEO Nilesh Ved is confident that the brand can adapt to new locations. Executive Chairman, President and CEO of Tim Horton’s Paul D House explained: ‘A mall is a destination. You need to be out on the street. I think in some ways it is easier than being in a mall. A mall has so many retailers trying to stand out. Here on Sheikh Zayed Road we stand out, there aren’t 50 other restaurants.’

JANUARY - FEBRUARY 2012

|9

03/02/12 9:52 AM

EXPO COVERAGE

SAUDI ARABIA

Saudi Arabia to host ABHA Franchising Exhibition 2012 Run by consultancy firm Middle East Franchising in conjunction with the Abha Chamber of Commerce, more than 50,000 attendees are expected at the trade show.

The two day event, which is being organised by consultancy firm Middle East Franchising in conjunction the Abha Chamber of Commerce, takes place at the Abha Palace Hotel from January 30 - 31. The Abha Franchising Expo 2012 marks the industry’s first trade show of the new year and with more than 50,000 visitors to attend, the exhibition aims to help Saudi entrepreneurs as well as smalll and medium enterprises to develop business opportunities in Saudi Arabia. The expo will act as a forum to cover all aspects of the franchising market, whether it involves expanding to the Middle East, expanding from the Middle East, or expanding within the Middle East, every base will be covered. It will also provide a platform for potential investors to explore business opportunities with leading franchise firms, find new agents, sign new franchisees, appoint dealers and distributors, meet prospective business partners, engage in new joint ventures, conduct direct negotiations, and explore new markets. Speaking ahead of the Abha Franchising Expo, Mohammed Alnassar, the Managing Director of MEFranchising, who are co-organising the forum with the Abha Chamber of Commerce, explained the importance of the event to the franchising industry. He said: ‘We are proud to announce our participation in the Abha Franchising Exp 2012 in Asir. The event is a unique networking opportunity which will attract global and local companies seeking to promote and expand their brands in Asir and looking for investors and companies operating with the franchise system in the Saudi market.” In addition to the exhibition, the two day forum will also host specialist workshops and seminars on

10 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 10

how to take advantage of the available investment opportunities and lending funds in the kingdowm, illustrate the different aspects of franchising, and discuss what the future holds for the franchising market. But the Abha Franchising Expo is not just about networking, it is also expected to boost the activities of small and medium sized businesses in the Kingdom of Saudi Arabia. The Chairman of Abha Chamber of Commerce added: “As a truly global event in a rapidly expanding region, we are delighted to be hosting the Abha Franchising Exp 2012 in Asir. This is a tremendous opportunity for investors, entrepreneurs and franchisors to gather, network and exchange business

opportunities.” Such events have previously taken place in other parts of Saudi Arabia, like Riyadh and Jeddah, however it is the first time Abha will play host to a franchising exhibition. The exhibition in Abha is being supported by the Saudi Government so it is fully sponsored by important funding organisations to nurture potential franchisees fund the franchise deals. Organisers of the Abha Franchising Expo 2012 are looking for companies to exhibit at the event. It will also be supported by Saudi Funding Organisations to assist potential franchisees broker deals with franchisors during the two day event.

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

EXCLUSIVE INTERVIEW

EXPO COVERAGE

Francrop Franchise Seminar An exclusive interview with one of the world’s foremost franchising executives with over 40 years of professional field and consulting experience, Donald Boroian, Chairman of Francorp Inc.

The Late last year global franchise development consultancy firm Francorp hosted an exclusive “Own Your Own Buisness” and “Franchise Your Own Business” seminar at Dubai’s Al Murooj Rotana Hotel. The seminar, which took place on December 8, was fronted by Donald Boroian, Chairman of Francorp Inc, and was aimed towards new franchisors, business owners, investors, and corporations to provide them with the latest information, trends, and strategies in franchising. Mr. Boroian is considered one of the world’s foremost franchising executives with over 40 years of professional field and consulting experience, yet despite his hectic schedule, he took time out to speak to The Franchise Magazine MENA and discuss the services his company offers and to share his thoughts on the market in Dubai.

What does Francorp offer that other franchise development firms do not? Because we’re global - we have offices in 27 countries and service 45 countries - we’re able to have a much broader perspective, a much better sample of what is really going on world-wide. We have such experience: 36 years we’ve been in business. There’s no one even close to that, or the number of people we have. But more importantly, I think it is the experience we have globally in all of these franchises that we have.

What is the most important piece of advice you can offer franchise holders currently in the market to sell a franchise? The most critical thing in selling franchises is the selection process to begin with, because no matter how good the training is, if you aren’t selective in the people you sell to, you’re casting your pearls to the swine. So number one is selection. It’s like we

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 11

Donald Boroian, Chairman of Francorp Inc.

45

We have offices in 27 countries and service 45 countries - we’re able to have a much broader perspective, a much better sample of what is really going on world-wide. We have such experience: 36 years we’ve been in business. There’s no one even close to that.

say ‘location, location, location. It’s selection, selection, selection’’. Select the right kinds of people, that’s very critical and so is training. There is a direct correlation between the success of a franchise and the quality, quantity and duration of the training. There has to be a training programme intense and long enough.

What is your overall impression of franchising in Dubai? I’m very impressed with the quality of contemporary and cutting edge businesses in Dubai. It’s more than just simply a matter of importing major

brands from other countries. There are brands being developed here. Which is sort of an extension of the ruling family of this whole visionary, the whole population thinks like this. I’ve never seen anything like this. We have the biggest problem in a lot of countries is the government, all the restraints and so on, here, there is an encouraging atmosphere for companies to develop and grow and money available and investors within the country. The tax environment is very favourable, it’s an amazing market. So as I get back in contact with our clients about coming into Dubai I have a much more enlightened view.

Are there any specific companies you can see expanding to Dubai? I think most of the major brands in the US would consider Dubai. The thing is we [Francorp] are the gatekeeper for most of the US companies that want to go into other countries. I can call the CEO of any company and get his ear and when I tell him about what I have seen in Dubai, there will be companies willing to come here that before did not really appreciate this market. I think in general we have viewed the Middle East as kind of an unstable economic and political area. That is certainly not the case. It’s very stable and economically very viable.

How does the franchising industry in the UAE compare with other markets? I think here is the classic feeding frenzy that we have discovered in Japan and in the other countries. It is almost like they have just discovered franchise opportunities and now they are scrambling to be the first one to get the major brands here. Right now it’s following pretty much the same pattern that we have everywhere, which is food. Food is a very strong sector in franchising

JANUARY - FEBRUARY 2011 | 11

03/02/12 9:52 AM

EXPO COVERAGE

QATAR

More than 30 franchise concepts present to expo delegates in Doha The Qatar International Food Franchise Forum took place in late November 2011 and was such a success that it will roll out to other countries before 2013.

Business consultancy firm World Franchise Associates hosted a successful International Food Franchise Forum in Qatar last November. The two day event, which took place at the Marriott Hotel in Doha on November 28 and 29, was geared towards promoting international multi-unit franchise development to investors from local regions in the Middle East. Important topics such as an overview of food franchise development in the Middle East, food trends in the decade ahead, successful brand development were also included during the run of events. The theme of the forum was ‘Fast Casual: The Future of Food Franchising’ and more than 30 franchise concepts from world class franchised restaurants were presented to delegates. A host of restaurateurs, hoteliers, and investors seeking franchise partnerships to expand in the MENA region were in attendance. Paul Cairnie, CEO of World Franchise As-

12 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 12

sociates, explained that the exhibition was such a success that it would also be held in new territories in due time. He said: “Qatar, with its massive development program was a great choice. Now is the time to invest there. The IFF Program would be extended to other countries during the next 18 months.” Fast casual is the biggest concept currently sweeping the food franchise sector in Qatar. Restaurants that fall under the fast casual category occupy a central place between fast food and casual dining. The food is marketed as fresher, healthier, and yet still affordable. Figures for 2010 reveal that the Top 100 fast casual franchise chains grew 6 per cent to nearly US $18.9 billion. As part of proceedings in Doha, one-to-one meetings took place,where interested delegates availed of the opportunity to further explore options within the fast casual, quick service, casual dining, and themed restaurants industry.

The opening address was conducted by the Qatar Chamber of Commerce and Industry, and among the highlights of event were speeches from CEOs from selected franchises. Peter Wright from Spicy Pickle, Todd Sinelli from Which Wich, Binh Nguyen of Phoa Hoa, and Christian Iezzi from C House Coffee Shop addressed delegates. While representatives of World Franchise Associates acted as panellists with Von Kennedy, Director of Business Development at the Midamar Corporation, who were the principle sponsors of the forum. Over the course of the two days, Qatar was identified as a key location in the Arabian/Persian Gulf due to its geographical location beside the wealthy GCC countries – the United Arab Emirates, Bahrain, Kuwait, Omar and Saudi Arabia. Next on the agenda for Qatar is the first International Trade Exhibition (ITE) for Partners and Franchise at the city’s new Qatar National Convention Centre from 22-25 January.

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 13

NOVEMBER - DECEMBER 2011 | 13

03/02/12 9:52 AM

REGIONAL NEWS

14 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 14

www.TheFranchiseMagazine-mena.com

03/02/12 9:52 AM

REGIONAL NEWS

www.TheFranchiseMagazine-mena.com 15 | NOVEMBER - DECEMBER 2011

Franchise magazine-Final.indd 15

www.TheFranchiseMagazine-mena.com JANUARY - FEBRUARY 2012 | 15

03/02/12 9:53 AM

COUNTRY PROFILE

Country Fact Sheet: Lebanon The Franchise Magazine - MENA examines the franchise market in the Lebanon

T

he Republic of Lebanon is a country in the East Mediterranean, bordered by Syria to the north and east, and Israel to the south. Its location in Western Asia, on the crossroads of the Mediterranean Basin and the Arabian hinterland, is reflected in its complex history and has led to a cultural identity of both religious and ethnic diversity. A small, mountainous country, Lebanon was under French mandate until it gained independence in 1943. It’s population is a mixture of Christian sects, Sunni Muslims, Shia Muslims, Druze, and others as it was a refuge for the region’s persecuted minorities. Lebanon covers an area of 10,452 square kilometres and as of July 2011 its total population was estimated at 4.2 million, with a growth rate of 0.244 per cent, with as many as 87 per cent living in urban areas. The capital of Beirut is Lebanon’s largest city and is considered to be the most Westernised city of the Middle East. Beirut has a population of 1.6 million, which is almost five times that of the second largest city, Tripoli. Tourism and commerce play a major part in Beirut’s industry and in 2011, MasterCard Index revealed that Beirut had the second highest visitor spending levels in the MENA region – Dubai came in first. Lebanon has a high literacy rate and traditional commercial culture and so has traditionally been an important commercial hub for the Middle East. Given its geographical location, business connections with the rest of the Middle East are very strong, which adds to Lebanon’s highly diversified economy. The official currency is the Lebanese Pound, denoted by the ISO code of LBP. The key industries in

16 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 16

Lebanon, particularly in the main cities of Beirut and Tripoli, are banking, food processing, authentic jewellery, commerce, retail, fashion, food and beverage, tourism, fashion, mineral and chemical products, oil refining, furniture products, and metal fabricating. However, due to its terrain and geographical location, agriculture only makes up less than 10 per cent of Lebanon’s GDP. Lebanon has a competitive and free market regime, as well as a strong laissez-faire commercial tradition. There are no restrictions on foreign exchange or capital movement. Trade in Lebanon suffers from a huge imbalance due to the fact that the country is short on natural resources and machinery parts. Lebanon therefore relies severely on the imports of raw materials, causing an imbalance that induces borrowing. Lebanese imports have taken the national debt to -$4.34 billion in 2010 from -$3.682 billion in 2009 and -$2.987 billion in 2008. In terms of export trade, it has been low compared to the country’s growing imports because wars with Israel, sectarian clashes and political instability have kept the manufacturing segment less productive. Exports are pegged at $5.113 billion. However, the main exported commodities are jewellery, base metals, chemicals, vegetables, tobacco, construction minerals, electric power machinery and switchgear, textile fibres and paper. While the agriculture industry in Lebanon is not dominant, the country is well known for its agriculture produce, particularly citrus, tomatoes, grapes, vegetables, olives, apples, tobacco, sheep and goats. Lebanon’s main export trade partners are Syria (24.9 per cent of exports), UAE (12.9 per cent), Swit-

zerland (6.6 per cent), Saudi Arabia (6.1 per cent), and Turkey (4.2 per cent). Lebanon imports around three times more than is exported, importing goods and services worth around $15.78 billion at present. This is down to a combination of limited manufacturing capability, uncertainty hampering future planning, and a lack of resources. The main commodities imported into Lebanon are petroleum products, cars, medicine, clothing, meat and live animals, consumer goods, paper, textile fabrics, tobacco, electrical machinery and equipment, chemicals. Lebanon’s main import partners are Syria. (10.5 per cent), France (9.5 per cent), US (9.3 per cent), Italy (7.3 per cent), China (6.8 per cent), Germany, (4.9 per cent), Saudi Arabia (4.8 per cent), and Turkey (4.2 per cent). Lebanon is a franchise success story. Its budding franchise industry is estimated at a value of $3.2 billion and is drawing increasing international attention. The franchise market exploded with the restaurant boom in the 1990s but continued to expand with the explosion of the retail sector in Lebanon as shopping centres and entertainment centres and venues shot up across the region. Franchising is particularly popular in Lebanon because it offers a business model with a reduced risk. The success of Lebanese restaurant franchises is a result of the strong and established service sector the country has sustained its economy with. And in order to maintain this success, experts recognise and encourage the need for Lebanese and Arab entrepreneurs to market creative products to remain competitive on the international market.

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

FADIL ALNASSAR

COMMENT

FRANCHISE MIDDLE EAST AWARDS 2012 DECEMBER 2012 Shangrila hotel | Sheik Zayed Road | Dubai Join us as we recognise the industry excellence at the 1st annual franchise Middle East Awards

For table bookings, sponsorship or nomination enquiries please contact The Franchise magazine -MENA Tel: +971 4 3042510 Email: steve@thefranchisemagazine-mena.com www.TheFranchiseMagazine-mena.com

JANUARY - FEBRUARY 2012 | 17

www.thefranchisemagazine-mena.com/awards Franchise magazine-Final.indd 17

03/02/12 9:53 AM

FRANCHISE OPPORTUNITY

Midamar: America’s favourite Halal brand Midamar is the oldest Halal food company in North America and is the first to export to Saudi Arabia, Singapore, Malaysia, and Indonesia. In March of last year, the family-owned company was crowned ‘Best New Halal Food” at the Gulfood Awards in Dubai for its Midamar Halal Air Chilled Chicken.

M

idamar Corporation is a pioneer and leader in America’s Halal food industry since 1974. The US based Halal food brand now serves the Middle East, Africa, South East Asia, and the Far East through the supply of its many products and services. Established in 1974, Midamar is a privately held family owned business founded by Bill Aossey. Since it first started, Midamar has evolved into two main areas of focus: Halal Foods Development and Export Supply Chain Management. The Halal Foods Development section is based in the American Midwestern state of Iowa, where Midamar raises only the best beef in the world, slaughtered in strict accordance to Islamic principles. Midamar boasts its own branded line of 200 premium Halal products and takes great pride in the products produced. For over 35 years the Midamar brand has set the standard for excellence in Halal food production. Its Halal certification from the Islamic Services of America (ISA), which is recognised and approved throughout the world for integrity, professionalism, and service. Midamar is also a leading USA Global Supply Chain Management and Full Service export solution provider to restaurants, hotels, and retail markets throughout the Middle East and Asia. Export services include, Midamar branded quality Halal foods, customized export consolidation, in-house expertise for all export

18 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 18

documentation needs, Arabic labelling and translation services, and international consulting and marketing services. The USA’s first and only Halal further processing facility, Midamar holds the distinction of being the recipient of the US President’s E-Star Award for Excellence in Exporting. Midamar also provides products and services for international food and restaurant franchisers expanding to the Middle East; importers looking to source and consolidate USA manufactured food products; companies interested in expanding products or brands to the Middle East seeking consulting and marketing services; and also companies looking to source restaurant equipment and spare parts. The benefits of working with Midamar are plenty. With over 35 years of international business experience in the Middle East and Southeast Asia, the company has a proven international team of dedicated professionals with a minimum tenure of more than 15 years in successfully meeting client needs. Our professional team members and global partners will help you get your products and services abroad efficiently and competively, without costly or untimely surprises.

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

FADIL ALNASSAR

#DUDKNOHMF$PHULFDQ EQ@MBGHRDRTOOKX BG@HMRSNSGD0LGGOH (DVWDQG$VLDENQNUDQ XD@QR ลข6XSSO\/LQH$QDO\VLV

COMMENT

ลข3URFXUHPHQW &RQVROLGDWLRQ ลข&XVWRP86$+DODO3URWHLQ  0DQXIDFWXULQJ .AKALMK9LMD>GG<รฃรกรขรฃ 9LGGL@%รขรกรฃ

42 QDRS@TQ@MSBNMBDOSRCDODMCNM,HC@L@Qล—R,QWHUQDWLRQDO6XSSO\&KDLQ0DQDJHPHQW6HUYLFHV  %QNLHMHSH@KMDDCR@RRDRRLDMS@MCOK@MMHMFSNRTBBDRRETKKXK@TMBGHMFEQ@MBGHRDAQ@MCRHMNUDQRD@R L@QJDSR ,HC@L@QHR@U@KTDCO@QSMDQENQNMFNHMFRTOONQSVHSG'@K@KL@MTE@BSTQHMF OQNCTBSRNTQBHMF  DWONQSSQ@MRK@SHNM K@ADKHMF BNMRNKHC@SHNM RGHOOHMF@MCCNBTLDMS@SHNM @MCPT@KHEXHMFCHRSQHATSNQ QDK@SHNMRGHOR 6GDSGDQOK@MR@QDENQLNCDRSSN@FQDRRHUDFQNVSG SGDQDRTKS EQ@MBGHRNQR@MCEQ@MBGHRDDR B@MENBTRNMCDUDKNOLDMSVHSGOD@BDNELHMC

*=EGN=L@=?M=KKOGJC>JGEQGMJ!FL=JF9LAGF9D>J9F;@AK==PH9FKAGF;GFL9;L%A<9E9JFGO 86$9RQ.HQQHG\  YNHQQHG\#PLGDPDUFRP 0LGGOH(DVW$ODD.DPDO  DNDPDO#PLGDPDUFRP

www.TheFranchiseMagazine-mena.com

JANUARY - FEBRUARY 2012 | 19

VVV LHC@L@Q BNL["DC@Q1@OHCR (NV@42

Franchise magazine-Final.indd 19

03/02/12 9:53 AM

COVER STORY

SALMONTINI: THE SALMON OF KNOWLEDGE The Franchise Magazine MENA takes a look at Lebanese success Salmontini La Maison du Saumon. It took a year of planning before founders Hussni Ajlani and Joe Basilli felt that the restaurant world was ready for their salmon inspired concept. It has been a decade since Salmontini Le Resto was launched, paving the way for sister restaurants Salmontini Le Fumoir, Salmontini La Boutique, and Salmontini.

20 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 20

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

COVER STORY

S

almontini La Maison du Saumon is a landmark concept based on salmon as the signature dish, complemented by a diverse and creative international menu. The innovative culinary experience was created by owners Joe Bassili and Hussni Aijlani in 2001. Joe’s background in the restaurant business instilled in him a culinary curiosity which led him to the Scottish Shetland Islands, where upon his return to Lebanon he was inspired to set up his own

Salmontini has evolved into four unique restaurant concepts, each offering its own individual style of serving salmon. Salmontini La Maison du Saumon is the mother brand overseeing Salmontini Le Resto, Salmontini Le Fumoir, Salmontina Riva, and Salmontini Boutique. And while the last decade has seen expansion from Lebanon to KSA and UAE, Joe and Hussni are ever present, following up on day-to-day operations, ensuring the passion and enthusiasm that created this unique experience continues to grow.

salmon smokehouse in the mountain village of Hayata. In contrast, Swiss-raised Hussni was originally attracted to the food processing

The team remain committed to introducing new concepts to the market and innovating premium value products to maximise the

industry and intrigued with the skill involved in developing new production techniques. The two men shared a passion for salmon

diversity of experiences – all under the Salmontini La Maison du Saumon umbrella.

and a mutual vision of a restaurant providing premium food with the highest quality service in a relaxed yet elegant atmosphere. The result was Salmontini La Maison, which originally opened in Beirut business district Solidere. In the 10 years since its launch,

Salmontini Le Resto The fine dining aspect of the Salmontini experience has locations in Beirut’s posh Achrafieh area and in Dubai 5 star Kempinski Hotel at

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 21

JANUARY - FEBRUARY 2012 | 21

03/02/12 9:53 AM

REGIONAL NEWS

the Mall of the Emirates. But Salmon is not the only treat at the high end restaurant as the menu also boasts an array of international French dishes, accompanied by a rare and vintage wine collection. Salmontini Le Fumoir This unique dining concept started in August 2011. It prides itself on using only the best catch of Scottish Salmon from the Hebrides Isles, where farms stick to strict regulations and every aspect of the process is carefully controlled, in particular the premium fish feed. The salmon on the menu at Le Fumoir is farmed in one of the most peaceful and tranquil environments on earth. This process has a paramount effect on taste, texture and colour of the salmon. All salmon is shipped by airfreight to the state of the art smoke house in Dubai, where it undergoes traditional methods of filleting and smoking. This blend of tradition and technology ensures only the best quality and hygiene. Salmontini Riva Another new concept from Salmontini la Maison du Saumon can be found at the modern bistrostyle Salmontini Riva. The Beirut outlet boasts a

22 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 22

“Developing our people is a cornerstone of our business model. We are constantly striving to cultivate a team of exceptional leaders at all levels of our company.” spacious terrace, which seats 64, and a luxurious champagne bar. This riverside restaurant is situated on the waterfront at Zaitunay Bay in Beirut, making it the perfect location where fresh seafood is served throughout the day. SALMONTINI BOUTIQUE This is the delicatessen style option from the group. The coming months will see the opening of the Salmontini franchise in Jeddah. Up first will be a stand-alone outlet with a seating capacity of 180 and its own boutique with a selection of salmon and sushi products for take away. FRANCHISING Our Goal is to make working at Salmontini La Maison du Saumon more than just a job,

but a place where people can achieve their professional dreams. Respect, trust and support are the three main guiding principles in relations with investors and franchisees. Developing our people is a cornerstone of our business model. We are constantly striving to cultivate a team of exceptional leaders at all levels of our company. Our company vibrant culture impacts everything we do, from how we treat our employees and what we value, to how we recognise and reward a job well done. We are opening new distribution channels in the neighboring countries, as well as airports. Our ultimate goal is to open our own outlets in Europe and at the same time start supplying exclusive selected venues with our prime quality smoked salmon.

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

COVER STORY

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 23

NOVEMBER - DECEMBER 2011 | 23

03/02/12 9:53 AM

COVER STORY

24 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 24

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

COVER STORY

Q&A

with Hussni Ajlani

How did the decision to franchise the Salmontini concept come about? After investing personally in Salmontini for the last 10 years, creating the different concepts (Resto, Riva, Fumoir, Boutique), and making sure all the operations ran smoothly, it was the logical choice for the international development of the Salmontini brand, while maintaining a high level of service and quality.

What qualities must a franchise partner possess? In terms of potential Franchisee, we would be looking at partners who would first share the passion for Hospitality and Fine Dinning, with a strong management background, to spread the “Salmontini Experience” around the World.

How much is the franchise fee? The Franchise Fee, is calculated according to the value of the brand and its actual development. We also take into account the potential and the size of the territory requested by the franchisee.

What support is provided to the franchisee? All support is given to the franchisee, this varies from interior design and kitchen design, to recipe development, as well as operation manual and recruiting staff. Most importantly a constant and

close follow up on the operation from our franchise team who keep an eye on the operation, its finances and cost control.

Is there any specific training provided to franchiees? All the Heads of Operation are trained in our own locations in Beirut and in Dubai for a minimum of 3 months before being sent to the franchised location. There is also a special training course to educate on our salmon products in the Dubai smokehouse.

What other assistance is available? We assist all our franchisees with branding material through our creative department and we assist them in setting up their yearly marketing plan, as it has to be in Line with our Standards and common international communication. In addition, our Ace team is constantly available to travel to any location for any additional assisstance and any modification in our operation is immediately implemented in all the different location. The long-term success of a franchise depends directly on the strong and professional ongoing support of the Franchisor, and this is why we have created a specially dedicated team for that purpose.

All support is given to the franchisee, this varies from interior design and kitchen design, to recipe development, as well as operation manual and recruiting staff. Most importantly a constant and close follow up on the operation from our franchise team who keep an eye on the operation, its finances and cost control.” For More Information Please Contact: Hussni Ajlani Dubai: + 971 50272526 - Beruit: + 961 3759799 www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 25

JANUARY - FEBRUARY 2012 | 25

03/02/12 9:53 AM

REGIONAL NEWS

26 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 26

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

FRANCHISE OPPORTUNITY

British Orchard Nursery Miss Vandana Gandhi first introduced her vision of preschool education to Dubai’s expat community in 2006. Further branches have since sprouted across the UAE and now the British Orchard Nursery is looking to expand overseas.

B

ritishorchard Orchardnursery nurserywas wasfounded in ritish founded in 2006, in Dubai, 2006, in Dubai, UAE with anUAE aim of with an aim of imparting imparting quality childcarequality and world childcare and world class to pre-school class preschool education the education to the varied expatriate community of varied expatriate community of the uae. the uae. We currently have branches across the country, in bur Jumeirah, Sharjah and Abuthe BritishDubai, Orchard currentlyDeira, has branches across Dhabi. We follow the British curriculum, under country, in bur Dubai, Jumeirah, Deira, Sharjah and Abu Dhabi. We follow the guidelines. British curriculum, OFSRED (UK governing body) The under (UK governing guidelines. brand OFSRED was conceptualized at the body) start targeting The brand was conceptualized at thepopulation start targeting the international and cosmopolitan the international cosmopolitan population of uae, which is aand challenge in its own right. of uae, which is a challenge in its own right. Quality Quality assurance modules were put in place, and assurance modules were put in place, and with with a R&D team, we enhanced the curriculum a R&D team, British Orchard enhanced there into a ‘thinking curriculum’, linked to clear child curriculum into a ‘thinking curriculum’, linked to assessment, thereby monitoring the teaching clear child assessment, thereby monitoring theand learning at the per school, with an ethos of teaching and learning at the pre-school, withbeing an the best the industry, regular staff internal ethos of in being the best in the industry, regularand staff externaland training on the uk curricular internal external training on the ukstandards curricular standards were imparted. high corporate were imparted. With highWith corporate governance, governance, and enhanced given importance to the and enhanced importance to the given formulation formulation of various policies andthe procedures, the of various policies and procedures, focus being focus being onsafety healthofand of the on health and thesafety children, we children, went on to

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 27

British Orchard went on tochain qualify as the first East qualify as the first nursery in the Middle nursery chain the Middle to be ISO 9001 to be ISO 9001in2008 qualityEast certified. 2008 quality certified. Franchising was the logical progress path we envisioned for our brand. The preschool industry Franchising was the logical progress path that is highly regulated the brand. UAE, with prior they envisioned forintheir Theregular pre-school and during set up, from the various governing industry is highly regulated in the UAE, with bodies. The regulatory do pose hurdle regular prior and duringguidelines set up, from the various to franchising in the UAE. With strong in-house governing bodies. The regulatory guidelines do pose hurdle franchising in the UAE. systems, andtothrough knowledge of theWith market strong in-house systems, and through knowledge dynamics, we were the nursery of choice for the of thegovernment market dynamics, theyawarded were thea prestigious nursery of UAE and were choice fortothe UAE andfranchise, was awarded contract open ourgovernment first corporate a prestigious contract to open there first corporate within the RTA building (road and transport franchise, within the RTA building (road and authority, UAE government). transport authority, UAE government). The Middle east is a vast country and there is a clear need toeast cater the country preschool requirements The Middle is to a vast and there is a of the new age parents, and rising population of clear need to cater to the pre-school requirements working parents, who are looking for a quality set of the new age parents, and rising population of working parents, areIflooking quality up for their youngwho ones. Middle for Easta is to be set a up for their young ones. If Middle to be powerful knowledge economy. WeEast needisworld a powerful knowledge economy, world class schooling and education in we ourneed country. classpreschool schoolingindustry and education the country. The in the in Middle East has The pre-school industry in the Middle East has taken an innovative turn towards childcare quality

taken an innovative turn towardshence childcare quality institutions across the country; we have institutions the country; hence UAE British looked into across the feasibility of entering via the Orchard is looking into expanding with more franchise route. The opportunity to provide an franchise with in the Middle East. The opportunity established international preschool would benefit to provide an established international pre-school potential franchisees. The model is built and would benefit potential franchisees. The model customized to the UAE to market conditions, is built and customized the UAE market with the challenges of the real estate, and teacher conditions, with the challenges of the realtraining estate, ect taken into consideration. systems to and teacher training ect takenWe intohave consideration. provideOrchard complete marketing and support to our British has systems to provide complete marketing and support to their partners, including partners, including rigorous training programmes rigorous training programmes on the UK on the UK curriculum. curriculum. The woman entrepreneur has evolved, and is highly innovative and conscious of the global The woman entrepreneur has evolved, and is changes. The preschool segment not only will highly innovative and conscious of the global provide the woman franchisees in the middle east changes. The pre-school segment not only will ,the platform to fulfilfranchisees their business ambitions, provide the woman in the Middle East, but also the inner dream and reward of making a the platform to fulfil their business ambitions, positive to their society.Something but also contribution the inner dream and reward of making aI am very contribution proud to be atopart of.society. positive their For more information go to www.britishorchardnursery.com or Call : British Orchard Nursery, Bur Dubai 04-3983536

JANUARY - FEBRUARY 2012 | 27

03/02/12 9:53 AM

FRANCHISE OPPORTUNITY

INSTANT SKIN Combining art, technology and business processes, PRECISE are industry pioneers in sub-surface laser etching of high quality crystals producing 2D and 3D portraits, trophies, awards, corporate gifts and mementos since 2002

W

ith retail outlets at Dubai Duty Free, Dubai International Airport, Deira City Centre Shopping & Entertainment Mall, Mall of the Emirates, and Atlantis the Palm amongst others, the company’s 15,000 square meter production facility in Dubai is also licensed to exclusively develop and produce gifts and models for the Jumeirah Group, including 3-D likenesses of the Burj Al Arab, and Emirates Towers. PRECISE also supplies crystal merchandise to Atlantis The Palm, and the iconic Burj Khalifa. What we offer Focusing on originality, customisation and creativity as well as high quality finishing and production efficiency, the latest venture of PRECISE is Instant Skin, offering products and services via a reseller network. Instant Skin is a revolutionary concept

allowing instant, durable personalisation of digital devices such as mobile phones, iPods, game consoles, cameras and laptops. Technology has been developed by PRECISE to use personal or original digital pictures as well as other images to personalise digital gadgets. Franchise Opportunities Building the franchise model to expand sales throughout the Middle East and Africa, into Asia and Europe, Instant Skin opportunities lend themselves from small business up to multimillion dollar corporate looking to expand services and offerings. The franchisee outlay for Instant Skin is small enough to make it possible for a 100% return on investment within 9-12 months, and with space requirements only 30 – 50 square feet, this is an ideal concept for a kiosk or existing in-store set up.

Extensive training is provided for retail staff on the operation of the equipment and skin application, along with management training. Marketing and promotion support is given, alongside the growth of the parent company and new divisions, making this a very attractive investment opportunity, wherever the market.

For More Information Please Contact: infor@preciseme.com T: +971 4 8858603 / F: +971 4 8858632 28 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 28

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

EXPRESS YOURSELF Instant SkinÂŽ is a revolutionary new process which was developed to create personalised skins for gadgets and electronic devices, such as your mobile phone, laptop, ipod, portable gaming consoles, computer mouse and camerasâ&#x20AC;Ś anything really! Customers who care for an added element of individuality can take their own photos and pictures of families, friends and favourite characters and have the image printed and vacuum wrapped on to their gadget instantly! www.instantskin.com

Franchise magazine-Final.indd 29

03/02/12 9:53 AM

REGIONAL NEWS

CHARLEY’S GRILLED SUBS For anyone wishing to get involved in an excellent fast food concept. Charley’s Grilled Subs (Franchise Operator of the Year Finalist @ Retail City, 2010)

T

his World renowned concept popular in the US, UK, Canada, Japan, Germany and the Korean peninsula is now in the Middle East. You could enjoy our signature Philadelphia cheese steaks, gourmet fries, freshly squeezed lemonade, fried desserts and much more Currently, we have eight stores in Dubai located at the Mall of the Emirates, Ibn Battuta Mall, Deira City Centre, Dubai Festival City, Dubai Mall, Arabian Center, Mercato and Mirdif City Centre. In 2010, we opened three sub franchisee owned and operated stores at Al Wahda Mall in Abu Dhabi and Bawadi Mall and UAEU Campus in Al Ain. New franchisee owned and operated stores are also scheduled to open at the Enoc gas stations in JAFZA and Al Twar and Mushrif Mall in Abu Dhabi. Company owned stores will open at Enoc Emirates Road and Dubai International Airport ( Terminal 1 / Concourse 1 ). Also own and operate Charley’s Grilled Subs outlets in Abraj Al Bait in Meccah, Al Noor Mall in Medinah and Mall of Arabia in Jeddah, Saudi Arabia.

30 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 30

>> Technical Specs: Preferred Location: Food Court Minimum Area: 50 to 60 sq mts Average Check: Dhs. 24. Minimum Shopfront: 6 mts Water, Drainage & Extraction Required Minimum Power Required: 70KVA

For more information please contact Al Madani Group of Companies LLC Saher Gharaibeh 506 al khaleej center UAE TEL 00971(0)43520500 FAX 00971(0)43596068 saher@amg.ae www.amg.ae

www.TheFranchiseMagazine-mena.com

03/02/12 9:53 AM

FRANCHISE OPPORTUNITY

www.TheFranchiseMagazine-MENA.com

Franchise magazine-Final.indd 31

NOVEMBER - DECEMBER 2011 | 31

03/02/12 9:53 AM

REGIONAL NEWS

Barista Crafted with Love UAE | Oman | Bahrain | KSA | Kuwait | Syria | Egypt | Qatar | Jordan

Now Franchising www.TheFranchiseMagazine-mena.com JANUARY - FEBRUARY 2012 32 | 4FDPOE$VQ#JO)FOEJrXXXNZTFDPOEDVQDPNrXXXCJOIFOEJDPN

Franchise magazine-Final.indd 32

03/02/12 9:53 AM

FRANCHISE OPPORTUNITY

SECOND CUP: SECOND TO NONE

O

ver the past 35 years, Second Cup has offered its guests, the utmost in comfort and service: Warm and inviting; comfortable, modern and contemporary; rich and textured; familiar yet global. You can enjoy our signature coffees, the finest of teas, gourmet sandwiches, baked goodies and pastries, interesting and unusual merchandise in a plush and striking environment in over 400 cafés in 16 countries with a strong presence in the Middle East. We continue to be a second home to tens of thousands of discerning guests every day in the UAE, Bahrain, Egypt, Jordan, Kuwait, Oman, Qatar, Saudi Arabia, Syria, Turkey, Cyprus, Lebanon, Romania and the US in addition to Canada. As one of the longest and most established specialty coffee retailers, with an existing and fast growing international presence, we are well positioned to expand the Second Cup experience throughout the rest of the world and make Second Cup a respected global brand. We will continue to build upon our proven model of growth through Sub Franchise Partners. Bin Hendi Enterprises LLC ( www.binhendi.

com ) is the Master Franchisee and Exclusive Developer of Second Cup Coffee in the MENA region. In the UAE, you can find company owned and operated stores at the Mall of the Emirates, The Dubai Mall, Dubai Festival City, Sharjah City Centre, Al Ain Mall, Al Ghazal Mall, Spinney’s – Bur Dubai and Spinney’ s – Jumeirah and sub franchisee owned and operated stores at Najda Street, Khalidiya and HCT, Abu Dhabi. We also have over 30 sub franchisee owned and operated stores across the MENA region. In 2011, we are all set to open doors at several upcoming developments in the region. At the very core of Second Cup’s success lies the passion for all we do and all we offer to our customers… and starts with the highest quality coffee beans you can buy. Most of the coffee beans we use for our coffees or sell to our customers are exclusive to Second Cup. We search

the world looking for the best of the best…from the lush mountains of Costa Rica and Colombia, to the distant lands of Central Africa, to the exotic and enchanting island of Sumatra. Our exclusive coffee supply agreements link us to the finest estate coffee growers in these, the best coffee growing regions of the world. A continuing commitment to product development has kept Second Cup relevant and a great investment opportunity. In addition to our cafés, our product line has also grown from simple whole bean coffee to more than 30 premium coffees, specialty beverages, complementary foods and merchandise items. Each cafe is uniquely designed to create a warm, inviting feeling in a contemporary setting that maximizes traffic flow and function, and complements the local culture. Our disciplined design and concept allow for modest customization to reflect the local culture and tastes of the host community that it serves.

For More Information Please Contact: g.kunnappally@binhendi.com T: +971 505536485 www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 33

JANUARY - FEBRUARY 2012 | 33

03/02/12 9:53 AM

REGIONAL NEWS

pizza advert

pizza editional

34 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 34

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

SENSE GOURMET & FIGARO’S PIZZA

Sense Gourmet was granted the Master Franchise of Figaro’s Italian Pizza, Inc of Oregon, USA and has been operating chain of restaurants in the emirates and planning to do more through its effort of selling Local Franchises.

A

t present it has five outlets located in Marina Mall, Abu Dhabi, Mega Mall and Damas Building in Sharjah, Rigga and the Walk JBR in Dubai. Before the end of the year it will open its 3 outlets in Abu Dhabi, Dana Plaza outlet and two more outlets within the next year are planned, 35 outlets in total up to 2016. Sense Gourmet food Company is a private joint stock company created in 2006 in Abu Dhabi to expand Foodco Holding’s, part of Ali & Son’s Group, presence into catering, International restaurant Franchise and other retail operations in the hospitality sector in the Middle East. Its objective is to establish high potential restaurants across GCC countries and provide International standard quality catering services. The initial capital of Sense Gourmet is AED 33.0Million Dirham (9 million US) with a par value AED1/- per share 47% of Senses Gourmet’s shares is held by Foodco and the balance is held by Foodco shareholder.

33m

AED

The initial capital of Sense Gourmet is AED 33.0Million Dirham (9 million US)

During the years Sense Gourmet bought the Abu Dhabi National Catering LLC from foodco Holding for 850,000 AED to run and manage its nutrition contracts with the Ministry of Defence. Sense gourmet is looking for potential new Franchisee’s and for more information please call Gamal Abdelnour, QC Manager Tel 00971(0)26731000 Fax 00971(0)26732355 ,

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 35

JANUARY - FEBRUARY 2012 | 35

03/02/12 9:54 AM

United Arab Emirates Kingdom of Saudi Arabia United Kingdom

Franchise magazine-Final.indd 36

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

LONDON FISH & CHIPS : “TRUST YOUR SENSES”

O

ur story begins in 2001, when the London Restaurant Company Ltd. was formed in the United Kingdom, birthplace of the fish and chips tradition. Our dream was to bring this beloved and simple culinary delight to the Middle East and beyond. We soon launched our first-outlet of London Fish & Chips in the prestigious Al-Faisal mall in the heart of Riyadh, capital city of Saudi Arabia. It wasn’t long before the restaurant had established itself as a firm favorite of the local population. The reaction was a taste of greater things to come, as we began opening popular outlets nationwide. Today customers can enjoy London Fish & Chips at every major shopping mall in Riyadh, Jeddah, Madinah, Khobbar and Damman. With success in Saudi Arabia came further expansion abroad. We opened our first outlet in Dubai, United Arab Emirates in 2004. Demand for quality fish & chips soon led to additional outlets throughout the UAE. We’re now poised to expand even

wider in the region and beyond. London Fish & Chips has become a well-known and highly respected brand in the Gulf area thanks to a robust business strategy, a highly motivated management team and a commitment to providing first-class food and exceptional service to our expanding customer base. The success of any enterprise depends on assembling the right team for the challenge. At London Fish & Chips, we look at prospective franchisees as important long-term partners and team members. They are key to reaching out goals. We’re looking for talented and driven entrepreneurs who recognize the tremendous opportunity in becoming a restaurant owner/ operator and want to join to us on the exciting journey we’ve begun. Our commitment to

excellence in all areas means we carefully assess potential franchisees to ensure that our culture and high standards will be maintained at every outlet. Selected candidates will have a proven track record of achievement as business owners or managers and the financial resources necessary to launch a successful franchise. Once onboard, a franchisee can expect support every step of the way, with ideas, resources and expertise to help develop and grow the business. We currently have franchisees in Eastern Saudi Arabia and Abu Dhabi, and are discussions with other interested parties regionally and internationally. We see the enormous potential in our company and have our sights set on bringing our brand to the world.

Contac details:- London Business Group Suite 314, Ibn Battuta Gate, P.o.Box 120918, Dubai, United Arab Emirates.T: +971 4 4479788 / F: +971 4 4479789 www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 37

JANUARY - FEBRUARY 2012 | 37

04/02/12 8:59 AM

FRANCHISE OPPORTUNITY

38 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 38

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

ANT VENTURES From a single coffeehouse to the largest Lebanese F&B chain in the region

N

ature’s emblem for hard work, perseverance and determination, Ant Ventures is a holding that best symbolizes self-discipline, team work and refined organization skills. Stirred by the success of Casper & Gambini’s delivery service concept in 1996, Ant Ventures has grown throughout the years to become today the owner, manager and operator of a palette of 5 unique food & beverages concepts in the Middle East: Casper & Gambini’s, Eatalian, Tarator, From The Tree, and 35 Rooms hotel. Casper & Gambini’s is an award-winning all-day restaurant-café with over twenty-two operations running across the Middle East. C&G specializes in

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 39

offering gourmet meals and beverages in an elegant and contemporary atmosphere, all in good taste. Eatalian is a unique Italian concept serving authentic Italian cusine revisited with a modern flair. Tarator uplifted tradition by creating gourmet falafel & shawarma sandwiches. From The Tree is a frozen yogurt and juice bar specialized in freshly squeezed fruit and vegetable juices as well as delicious made-to-order fruit and yogurt smoothies, detox juices and natural energy boosters. 35 Rooms is one of the trendiest hotels in Lebanon, located in Hamra in the heart of the capital Beirut. It’s the perfect mix of comfort and

originality, offering a stylish stay for executive business trips, family vacations, and weekend getaways. With over 15 years of experience, the Lebanese chain’s regional network covers today Kuwait, Saudi Arabia, Egypt, Jordan, Qatar, Bahrain, Sudan and Syria, through 26 operations, whether groupowned or franchised. Plans for further expansion in the region and internationally remain on the Group’s priority agenda, with an aim to reach the whole MENA region through new ventures and partnerships. For more information, kindly contact Ant Ventures’ Franchising Department on franchise@antventures.com.

JANUARY - FEBRUARY 2012 | 39

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

KL

40 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 40

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

REGIONAL NEWS

What is Doner Kebab? KL

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 41

JANUARY - FEBRUARY 2012 | 41

03/02/12 9:54 AM

LFA DIRECTORY

LFA DIRECTORY

T

he Lebanese Franchise Association (LFA) is a non profit organisation dedicated to developing and promoting excellence in the franchising sector in Lebanon. It is the official mouthpiece of the Lebanese franchising sector. The LFA believes in promoting Lebanese and foreign expertise around the world through franchising. The LFA works hard to raise public awareness on the importance of the role the franchise sector plays in promoting the exports of Lebanese goods, services, franchise concepts, putting forth Lebanese entrepreneurship and creativity around the world. The LFA is the only association serving as the voice of franchising in Lebanon and is a major participation in teh international franchise arena. The association acts as a filter and lobby for franchisee and franchisor with the Lebanese government.

42 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 42

Over the following pages, The Franchise Magazine brings you an overview of the Lebanese Franchise Association’s members. Our directory provides a break down of franchises in Lebanon, what each franchise is about and where to go for further information on each franchise. It is a must read for anyone interested in Lebanon’s franchising market or anyone perhaps considering buying a franchise. The LFA updates members on all changes in franchising laws and provides regular educational programs on how to conduct a franchise. All members have to sign up and abide by the LFA’s Code of Ethics. Members can avail of the latest up to date information about topics such as improving relationships with franchisees, use of technology, public relations, marketing, advertising, field operations, and networking. Benefits of being a LFA member:

- Training programs, seminars and exhibitions organized by LFA or LFA partners. - Networking facility, through B2B meetings, conferences and specialized organized events. - Access to LFA Member Directory and listing of profile of the yearly LFA publication. - Profile listing on LFA’s website and brand visibility through website links - Access to potential franchisors or franchisees contacting LFA - Timely notification of upcoming local and international franchising conferences and events Special participation fee in LFA conferences, workshops, and intellectual property registration. For further information on LFA Membershio, and enquiries on joining the LFA as a member, consult lfalebanon.com for further information.

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

A Name: Abd El Wahab Ghia Holding Activity: Restaurant group This Lebanese restaurant developer and operator started with a French restaurant in 1997 but due to the economic boom experienced in Lebanon during the late 1990s it wasn’t long before Duo and Abdel Wahab opened. Now the group owns and manages four distinctive concepts and venues in operations. Abdel Wahab Lebanese cuisine opened in 1999, Duo International cuisines opened in 2002), Shah Oriental Restaurant/Lounge (2003), and El Paladar Latin Bar/Restaurant (2006) Year Established: 1999, Lebanon Number of Franchises: 6 Further Information: www.ghiaholding.com fadi@ghiaholding.com Name: Accessorize Activity: Fashion retail outlet Accessorize specialises in jewellery, clothing, and accessories. A leading brand in its field, high street store Accessorize boasts almost 1000 free standing stores worldwide in 55 countries across the globe. Seasonal and regional themes run through merchandise, always presenting a unique take on the latest trends. Year Established: 1984, London, United Kingdom Number of Franchises: 10 Further Information: www.accessorize.com Name: Abdul Rhaman Hallab & Sons 1881 Activity: Specialist confectionary This beverages and sweets operation offers traditional Oriental sweets, pastries, ice cream, confectionery, and chocolate. Year Established: 1881, Tripoli, Lebanon Number of Franchises: 6 in Lebanon, Saudi Arabia, Qatar, and Latakia (Syria) Further Information: www.hallab.com.lb or email franchise@hallab.com.lb

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 43

Name: Adolfo Dominguez Activity: Fashion design and distribution Adolfo Dominguez started off as a small tailoring workshop, growing over 30 years to become an international success in fashion retail. The fashion brand includes, AD Man, Woman, U Adolfo Dominguez, ADC Accessories, AD+, AD Kids, Mi Casa, Jewellery, ECO Collection, Pets, and Bridal collections. Adolfo Dominguez was the first Spanish fashion designer to float on the stockmarket. Year Established: 1973 Number of Franchises: 27 – 600 boutiques worldwide, including 8 in the Middle East since 2000 - Lebanon, Saudi Arabia, UAE, Iran, Kuwait, Cyprus, Belgium, Luxembourg, Slovenia, Spain, Portugal, France, UK, USA, Japan, Argentina, Costa Rica, Chile, Ecuador, El Salvador, Guatemala, Mexico, Panama, Peru, Puerto Rico, Uruguay. Further Information: www.adolfodominquez.com or email ddiez@adolfodominguez.es Name: Al Baba Sweets Activity: Confectionery manufacturer Produces and supplies five lines of oriental sweets, including Gelati Baba, Dolce Baba, Cioccolata Baba, and Al Baba Jewels. The company’s core values are quality and consistency. Year Established: 1950 in Saida, Lebanon by Mohammad Bashir El Baba Number of Franchises: 5 branches and 2 outlets in Lebanon Further Information: www.albaba-sweets.com or email amanibaba@albaba-sweets.com Name: Al Balad Activity: Lebanese casual dining Al Balad restaurants specialise in contemporary interpreted traditional Lebanese cuisine and were the first to introduce casual dining in sociable surroundings. Al Balad Restaurants are determined to further expand their horizons and presence onto an international level. Year Established: 2000 in Beirut

Franchises in: Kuwait, KSA, Qatar, Lebanon. Further Information: www.albaladrestaurant.com or email pascale.barakat@sinecolb.com Name: Al Diwan Beirut Activity: Restaurant Al Diwan Beirut is a unique Lebanese food franchise with roots in the Ashrafieh region. The original concept Diwan al Sultan Brahim was the result of years of studies conducted by five of five sons of the Ramy family. Their simple idea of Lebanese fast food with delivery services at affordable prices is a success story today known as Al Diwan Beirut. Year Established: 1998 Number of Franchises: 1 Further Information: www.aldiwanbeirut.com or email sultan@sultanbrahim.com Name: Al Rifai Roastery Activity: Nuts, chocolate, confectionery, and coffee manufacturer, retailer and wholesaler. Al Rifai stores offer freshly roasted nuts, coffee, and premium Al Rifai products; confectionery, chocolate, coffee, and nuts. While the company’s origin’s were modest, their goals were not. Al Rifai’s ambitions are to become an internationally recognized brand name and leading provider of nuts, kernals, coffee, sweets, and chocolate in the local and global retail and wholesale market.. Year Established: 1948 by Moussa Al Rifai Number of Franchises: 158 in the Middle East, North Africa and Sweden. Further Information: www.alrifai.com or email info@alrifai.com Name: Aldo Activity: High street footwear and accessories brand International brand Aldo specializes in on-trend fashion footwear, bags and accessories for stylish young men and women. The brand is constantly evolving, with new styles inspired by trends from all around the world providing consumers with a global perspective on fashion. The shop fit is bright, fresh,

JANUARY - FEBRUARY 2012 | 43

03/02/12 9:54 AM

LFA DIRECTORY

modern and minimalist. Year Established: 1972 by Aldo Besadoun in Montreal, Canada. Number of Franchises: 17 Further Information: www.aldoshoes.com or email info@retailgrp.com Name: Al Sultan Brahim Activity: Lebanese seafood restaurant Al Sultan Brahim is a seafood restaurant that holds quality, value, and taste above all else. Dedicated to fulfilling customers’ needs, while enhancing the group’s expertise and competitiveness, Al Sultan Brahim has proved a success through maintaining its distinct standard over the decades. Year Established: 1968 by Elias, Ibrahim, and Chaker Ramy Number of Franchises: 2 in Dubai and Qatar Further Information: www.sultanbrahim.com or email sultan@sultanbrahim.com

and express transportation service providers by facilitating regional and global trade and commerce. Year Established: 1982 by Fadi Ghandour Number of Franchises: 6-10 Further Information: www.aramex.com Name: Aviator Style Activity: Ready-made fashion wear and accessories for women and men. In addition to a wholesale department that caters to hundreds of customers Aviator Style also operates retail outlets. Aviator Style provides the franchisee with a comprehensive support system at all levels, helping to identify market needs, choose a location, plan,design and create the store. Staff training at all levels in provided, and marketing, promotions and advertising campaigns are also assisted. Year Established: 1988 in Beirut by Jihad el Maghariky Number of Frachises: 6 outlets in Lebanon Further Information: www.aviatorstyle.com or email franshise@aviatorstyle.com

Name: Anne Klein Activity: Women’s shoes and bags Anne Klein offers American style clothing and accessories relevant to women’s everyday lives. Designed by an in-house team, AK Anne Klein is a footwear collection that gives each shoe a unique character. Year Established: 1970s Number of Franchises: 3 stores Further Information: www.anneklein.com or email info@retailgrp.com

Name: Avis Activity: Car rental company The first company to rent cars from airport locations, Avis promises superior services to provide a stress free rental experience. Year Established: 1926 by Halim Kurban Number of Franchises: 1818 branches in 160 countries Further Information: www.avis.com.lb or email raja@avis-lebanon.com

Name: Aramex Activity: Transportation solutions from international express to air/land/sea freight. Aramex delivers everything from a single package to comprehensive logistic solutions. Originally established as an express operator, the company rapidly grew into a global brand recognized for its customized services and innovative multiproduct offering. Having traded on the NASDAQ stock exchange for five years, Aramex aims to be recognized as one of the top five global logistics

Name: Azadea Group Holding Activity: Franchise retailers Azadea Group is a Lebanese retail holding company based in Beirut. The company has been representing franchised brands for more than 25 years, managing more than 37 international brand names ranging form clothing, accessories, food, multimedia, home furnishings and sports goods. Year Established: 1978 by Wassim Daher Number of Franchises: 37 international brands within 355 stores.

44 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 44

Further Information: www.azadea.com or email dany.bachir@azadea.com

B Name: Big Star Activity: Clothing business The company started off from its Big Star Jeans before diversifying into other areas of fashion. Big Star International Clothing SARL has been in the clothing business for more than 30 yeas now, with 15 stores in Lebanon and the Middle East. It also has the franchise for four brands in Lebanon: Big Star, Tally Weijl, LTB, and Redskins. It is also the franchiser for Big Star in the Middle East. Year Established: 1994 by Samir Morcos Number of Franchises: 12 Further Information: www.bigstarlebanon.com or email e.dmond@bigstarlebanon.com Name: Brioche Dorée Activity: French bakery and café Brioche Dorée is a French-style casual food restaurant. The branch opened in Beirut in 2010, combining traditional French food, combing flavour and nutrition. The restaurant adapts its menu to different times of the day, catering for in house diners or take away customers. Year Established: 1983 by Louis Le Duff Number of Franchises: 500 fast food and French snack restaurants around the world. Further Information: www.briochedoree.fr or email nfaure@snacksystemsal.com Name: Burger King Activity: Fast food restaurant Home of the Whopper, Burger King is the second largest fast food hamburger chain in the world. Known for its flame grilled burgers, the fast food outlet extends its standards to its friendly employees, clean surroundings, and new products. Year Established: 1999 by the Kallassi Group Number of Franchises: 21 in Lebanon Further Information: www.kingfood.com.lb or email k.afadel@kingfood.com.lb

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

C Name: Café Blanc Activity: Lebanese restaurant Committed to delivering the freshest and finest Lebanese cuisine within modern surroundings, Café Blanc focuses on consistent delivery of quality of food, services, and cleanliness. It is a casual place where customers can come at any time of day to eat or just enjoy a coffee and nice dessert with friends. Year Established: 2004 Number of franchises: 9, also in Kuwait, KSA, UAE. Further Information: www.cafeblanc.com or email jp@blendsltd.com Name: Café Najjar Gourmet Activity: Coffee shop With its selection of Arabica coffee, heart-warming hot drinks, refreshing cold drinks, and tempting desserts, Café Najjar Gourmet targets the fastest growing segment in the F&B industry – the youth market. Year Established: 1997 by Mr Georges Najjar Number of Franchises: operating in Lebanon, Jordan, Oman. Further Information: www.cafenajjar.com or email michelnn@cafenajjar.com or eawaiki@cafenajjar. com Name: Casper & Gambini’s Activity: Restaurant/Café – corporate catering and delivery services. Lebanese chain of all day restaurantcafés specialising in serving gourmet meals and award winning signature coffee, with an emphasis on healthy and fresh ingredients. Recognized amongst the Top 25 fastest growing companies in Lebanon. Year Established: 1996 by Annette Maalouf Ramy and Anthony Maalouf Number of Franchises: 26 in Lebanon, Kuwait, Saudi Arabia, Egypt, Jordan, Qatar, Bahrain, Sudan, and Syria.

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 45

Further Information: www.casperandgambinis. com or email franchise@casperandgambinis.com Name: Castania Nuts Activity: Nuts roasting A leader in the nuts market, Castania nut boutique is a retail outlet offering consumers fresh dry and roasted nuts. As well as selling walnuts, pine nuts, and almonds amongst others, Castania also sells sweet nougats, malban, chocolate, dry fruits, coffee, syrups, and Dragees. Year Established: 1985 by Elias Daniel Number of Franchises: 4 Further Information: www.castanianuts.com or email info@castanianuts.com Name: Century 21 1st Global Lebanon Activity: Real estate brokerage, property management, property appraisal and marketing. Century 21 1st Global Lebanon provides comprehensive and unique real estate services, while maintaining highest levels of customer satisfaction. The brand has been in the property market for more than 45 years. The team at Century 21 1st Global Lebanon are dedicated to providing the best real estate services, including selling, buying, renting, property management, property appraisal and marketing. Specialised real estate studies consultancy services are also provided. As the most recognized consumer brand name in real estate, Century 21 prides itself on professionalism, dependability, and customer understanding now synonymous with the Century 21 Gold Standard. Number of Franchises: 67 around the world. Year Established: 2003 Further Information: info@century21fglobal.com Name: Charles and Keith Activity: Women’s shoes and bags Offers high quality, trendy footwear to fashion conscious ladies. Over the years, the label has positioned itself at the forefront of footwear retail industry with their unique blend of innovative marketing and product concepts. In 2007, Charles and Keith launched its bags and accessories collection, with its Charles Keith Signature Label

also launched that year. Year Established: 19996 Number of Franchises: 1 store, 180 stores across 27 countries. Further Information: www.charleskeith.com or email info@retailgrp.com Name: Chem Dry Lebanon Activity: Carpet and upholstery cleaning. Chem-Dry is an international franchise company that relies on thousands of independent professionals to provide one-on-one service to commercial customers. It is world’s largest carpet and commercial fabric cleaning company, serving and protecting more than one billion square feet of carpet a year. Chem-Dry’s Hot Carbonating Extraction cleaning method explodes dirt and spots from fibres. Carpets cleaned by Chem-Dry are dry within two hours so employees can get back to work quickly. Year Established: 2009 by Ahmad Al-Khatib Number of Franchises: 1 in Lebanon, also in 4,000 locations in 45 countries around the world. Further Information: info@chemdrylebanon.com Name: Coca-Cola, National Beverage Company Activity: Beverage production and distributor Industrial Franchisee Company in Lebanon bottling and selling all Coca-cola products, including Coca-Cola, Cola Lite, Crush, Crush Lite, Sprite, Sprite Lite, Coke Zero. Year Established: Number of Franchises: Further Information: www.coca-cola.com or email ali.hussaini@transmed.com Name: Coldwell Banker Activity: Real estate services Coldwell Banker is dedicated to delivering real estate brokerage services, commercial services, investment consultancy, strategic planning, market surveys and analysis, architectural planning and design. Certified education courses are also available for associates and consultants. The business operates as a real estate master franchisor and has expanded its brokerage owned offices and franchised offices in

JANUARY - FEBRUARY 2012 | 45

03/02/12 9:54 AM

LFA DIRECTORY

response to transactions traffic and market demand. Year Established: 2003 Number of Franchises: 7 branches in Lebanon Further Information: www.coldwellbanker-lb. com or email elie.harb@coldwellbankerlb.com and customer.service@coldwellbanker-lb.com Name: Colombiano Coffee House, by Accelerate S.A.I Activity: Food and beverage Billed as a fusion between some of the better known coffee house concepts in the world and international casual food, concepts. Colombiano Coffee House’s Euro-Latin inspired menu offers healthy breakfasts, salads, sandwiches, pastries, and deserts, as well as coffee, milk shakes and cocktails. Year Established: 2004 by Nelly Ghreishy Number of Franchises: 25 in Lebanon, Qatar, UAE, KSA Further Information: www.colombiancoffeehouse. com or email contact@colombiancoffeehouse.com Name: Colortek Activity: Paints, wall paper, wall and floor innovations, kids’ room decoration products. Lebanese manufacturer, wholesaler. And retailer of paints, paint accessories. Faux finishing, waterproofing, wood products, and raw materials. Colortek is essential for every home owner, architect, and interior designers. Colortek has a variety of design solutions and is tailored to suit your individual requirements to transform your living space into the home of your dreams. Year Established: 1960 by Mohammad Kassaa Number of Franchises: 12 Further Information: www.kassaa.com www. colortekfranchise.com or email kassaa@kassaa.com Name: Cortefiel Activity: Men’s and women’s clothing Spanish fashion brand Cortefiel works tirelessly to maintain continuous quality customer service. The stylish garments incorporate the latest trends

46 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 46

in international fashion that all customers identify with. Cortefiel stores regularly update stock every two weeks with new colours and styles to offer customers more fashions. Year Established: 1880 in Madrid Number of Franchises: 4 in Lebanon Further Information: www.cortefiel.com or email info@retailgrp.com Name: Costa Coffee Activity: Coffee house The Costa brothers’ unique “Mocha Italia” blend is the foundation of all Costa coffees. Quality food is also served to equal the quality coffee. Costa Coffee controls the whole coffee-making process – they source, store, blend, and grind from start to finish. Year Established: 2006 Number of Franchises: 7 in Lebanon Further Information: americana2@american-lb. com Name: Crepaway Activity: Casual restaurant chain Crepaway mixes food and fun in a trendy atmosphere to offer customers a varied menu of high quality food. Its quirky menu boasts appetizers, salads, crepes, burgers, sandwiches, platters, and desserts, all served in a lively, feel-good venue. Year Established: 1984 Number of Franchises: 5 Further Information: www.crepaway.com or email franchise@crepaway.com

D Name: Darling’s Touch Activity: Fashion jewellery and accessories Darling’s Touch offers an enjoyable and comfortable shopping experience for the elegant lady looking for exclusive beauty and sought after, fashionable jewellery and accessories. The ranges include creative collections

inspired by western and oriental styles. Jewellery is available in high end department stores in the Middle East and Miss Lebanon 2007 wore the designs. Year Established: 2003 by Abdulrahman Zeitoun and Madiha Raslan Number of Franchises: 3 Further Information: www.darlingstouch.com or email info@darlingstouch.com Name: Dent de Lait Activity: Nursery-preschool Bilingual preschool for kids’ aged between 1- 5. Education focuses on the expansion of each child’s abilities, identifying strengths and weaknesses, as well as finding emotional balance. Dent de Lait originated as a small daycare centre and has grown into a leading educational institution with a variety of after-school programs. Year Established: 1997 Number of Franchises: 1 Further Information: www.dentdelait.com.lb or email hana@dentdelait.com.lb Name: Diet Centre Activity: Nutrition services and healthy food production The Nutrition and Diet Centre has been a pioneer in the field of nutrition and weight loss since its inception. The Diet Centre has created awareness by educating through diet programs and nutritional consultations, and Diet Shops, which deliver and provide healthy options. The Nutrition and Diet Centre is on mission to go beyond the concept of weight loss towards achieving better health through education, research, workshops, and media collaborations. Year Established: 1990 Number of Franchises: 5 Further Information: www.dietcentre.com or email rfjabri@yahoo.com Name: Doculand Activity: Print and copy centre Doculand copy centre offers

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

distinguished high-quality service to every firm’s professional needs. The copy centre’s flagship was established 14 years ago to fill a niche in the local Lebanese market. The first franchise opened in Jordan in 2008 and now Doculand is looking to recruit aggressive, success-hungry franchisees, driven to succeed in their market. Year Established: 1998 Number of Franchises: 1 in Jordan, two branches in Lebanon. Further Information: www.doculand.com.lb or email franchise@doculand.com.lb Name: Dunkin’ Donuts Activity: Coffee and donut shop Dunkin’ Donuts Lebanon opened its first branch in 1998 in Zalka. 13 years later, with 30 points of sale, it is a favourite amongst Lebanon’s young and young at heart according to the Pan Arab Research Centre (PARC), having ranked #1 for two consecutive years. Dunkin’ Donuts Lebanon has won the Gold Award for best licensee worldwide, Leader in Brand Building, and the Pathfinder Award, all from DD corporate. Year Established: 1998 Number of Franchises: 30 Further Information: www.ddlebanon.com or email info@ddlebanon.com Name: Duo - Ghia Holding Activity: Restaurant developer and operator Duo is a combination of two of Ghia’s successful concepts – Italian restaurant Ciao and French bistro Le Monot – to create a contemporary dining experience with a feel good ambiance. Aside from Duo, Ghia Holding also operate three other concept venues: Lebanese cuisine at Abdel Wahab (1999); Latino bar and restaurant El Paradar (2006); and Oriental restaurant and lounge Shah (2003). Year Established: 2002 Number of Franchises: 2 Further Information: www.ghiaholding.com or

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 47

email fadi@ghiaholding.com

E

Name: Eternity Activity: Clothing Eternity is a clothing label that quality stylish casual wear for customers who wish to dress in a contemporary without spending too much. The Update Garment Company began to design, develop, and sell casual clothes and accessories for women, men, and children in 1992. The first independent retail store opened in 1998 and now, more than a decade later, the label understands the daily demands of the clothing industry and what is required for store owners to enjoy success. Each franchise is privy to Eternity’s support system to help each owner with all aspects of managing a store. Year Established: 1992 by Hassan Bitar Number of Franchises: 15 Further Information: hassan@eternityfashion.com

fun. The Group is divided into six departments, decorations, ‘Fireworks Department’, ‘Fiesta World’ for kids, ‘Ashkal’ 3D Styrofoam art work, ‘Gift ‘n’ Wrap’ specialising in presenting handicrafts and souvenirs, and ‘Fake Cakes’. Year Established: 1994 Number of Franchises: 2 in Kuwait Further Information: www.fiestagroup.com or email fiesta@fiestagroup.com Name: Frizzy Activity: Kids’ entertainment and education centre Frizzy is a new concept in combining children’s entertainment and education to achieve edutainment, with emphasis on pampering the brain. Frizzy celebrates and educates the right and left side of the brain, making sure that kids are having both fun and learning. This dynamic concept is constantly looking for new novelty to edutain kids and attract tweens and teens. Year Established: 2009 Number of Franchises: 2 Further Information: www.myfrizzy.com or email lamice@myfrizzy.com

F

G

Name: Facco Gioielli Activity: Jewellery Facco Jewellery uses the finest gold for its highquality romantic and modern Italian jewellery collections. Its flagship boutique and high end stores are located in Downtown Beirut and in Dbayeh’s ABC Mall. Facco Gioielli is synonymous with creative strength and enjoyed by trendy women. Year Established: 2009 by Jacques Jean Sarraf Further Information: www.maliagroup.com or email christianeboustany@maliagroup.com

Name: GlobeMed Ltd Activity: Healthcare benefits management solutions GlobeMed Ltd owns, exports, and franchises the know-how and support systems for the management and healthcare benefits in the Middle East and North Africa region. It also owns and manages primary and dental care clinics, offers medical coding programs through classrooms and elearning platforms, and provides an electronic commerce platform for buyers and suppliers in the pharmaceutical industry. Year Established: 2001 Number of Franchises: 9 Further Information: www.globemedltd.com or email admin@globemedltd.com

Name: Fiesta Group Activity: Events The Fiesta Group specialises in events. Fireworks, balloons, handicrafts, kids’ entertainment, and fake cakes – the party experts are there to make each and every event unique and

JANUARY - FEBRUARY 2012 | 47

03/02/12 9:54 AM

LFA DIRECTORY

H Name: Haagen Dazs Activity: Ice cream café Quality ice cream specialists first established in Lebanon in 2003. Outlets also located in Beirut Souk and ABC Dbayeh exude genuine friendliness and relaxation. Year Established: 2003 Number of Franchises: 5 Further Information: agf@abresia.com Name: Hardee’s Lebanon Activity: Quick service restaurants This unique burger chain was introduced to the Middle East in 1980 and soon proved popular throughout the region launching 200 stores in Kuwait, UAE, Saudi Arabia, Bahrain, Qatar, Oman, Jordan, and Lebanon. Year Established: 1996 in Lebanon Number of Franchises: 9 restaurants Further Information: americana2@american-lb. com Name: Hospitality Services Activity: Events organiser, publisher Experts in all areas of event management – from planning, organization, design, logistics, branding, and promotions. Hospitality Services is ISO-9001 certified and has organized many international exhibitions and events in the Middle East. Hospitality Services is also the soul publisher of specialized regional magazines, directories and newsletters within the event management industry. Year Established: 1994 Number of Franchises: 3 Further Information: www.hospitalityservices.com. lb or email joumana@hospitalityservices.com.lb

I Name: IPT Sal Activity: Import, storage and distribution of petroleum products.

48 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 48

We own and manage an extensive network of gas stations spread throughout Lebanon, and have also signed exclusive petroleum supply agreements with a large number of gas stations throughout the county. ITP supplies gas, oil, petrol and lubricating oil to factories, companies, hospitals, schools, restaurants, clubs, and homes. Year Established: 1987 Number of Franchises: 180 Further Information: www.iptgroup.com.lb or email info@iptgroup.com.lb

J Name: JouéClub/Magic Treel Sal Activity: Toy and baby products retailer Joué Club is the leading top and baby products retailer in France and Europe with more than 300 stores worldwide. Joué Club Lebanon has toytrained staff and offers an unmatched selection of new toys, old favourites within 1200 square meters in Verdun and a boutique shop in Achrafieh. Also offers a playground area, a multi-purpose room for theatres, educational activities, shows, events and birthday parties. Year Established: 2009 Number of Franchises: 2 Further Information: www.joueclub.com or email ronald@magictreesal.com

K

Name: Kababji Sal Activity: Authentic Lebanese Grill Fresh, healthy, high quality food in a casual setting. The Kabab-ji Franchise Program includes everything from support for owners, management and operational training, design manual, set up manuals and operational manuals, as well as continuous support. Year Established: 1993 Number of Franchises: 18 Further Information: www.kabab-ji.com or email ola.saghir@kabab-ji.com

Name: KFC Lebanon Activity: Fast food restaurant One of the world’s largest fast food chains, specialising in fried chicken. Aside from the Colonel’s trademark fried chicken, KFC also serves fries, mashed potatoes and gravy, Year Established: 1993 Number of Franchises: 19 in Lebanon Further Information: www.americana2@ americana-lb.com

L

Name: La Maison du Café Activity: coffee shop chain Born of Café Najjar’s success, La Maison du Café opened in 2000 in Lebanon and is now part of 11 outlets in Lebanon and the Gulf countries. Franchisees receive an operations manual, describing the process in full detail. Year Established: 2000 Number of Franchises: 9 outlets in Lebanon and Qatar Further Information: www.lamaisonducafenajjar. com or email administration@primedc.com Name: La Posta Activity: Restaurant/Shop/Gourmet Shop. La Posta brings the best ingredients from Italy to present authentic Italian cuisine in a trendy atmosphere. Through strict production procedures, trained chefs, attentive service, and attention to detail, diners enjoy a true Italian experience. Franchisees are regarded as partners and not customers. Year Established: 2001 by Michel Ferneini Number of Franchises: 1 also in Kuwait Further Information: www.laposta-beirut.com or email franchise@medi-resto.com Name: La Senza Activity: Lingerie Affordable, high quality underwear and sleepwear. La Senza strives to become a destination speciality

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

lingerie store for all consumers and to provide a constant range of merchandise relevant to the gift purchaser. Year Established: 1990 in Canada and USA Number of Franchises: 13 stores Further Information: www.lasenza.com or email info@retailgrp.com Name: Leil Nhar Activity: Restaurant Leil Nhar is managed by skilled, devoted and ambitious owners that have a considerable reputation and experience in the food and beverage field. It provides fast dining at a low price, yet nice atmosphere all around the clock. Year Established: 2007 Number of Franchises: 1 Further Information: www.leilnhar.com or info@ leilnhar.com Name: Leila Activity: Restaurants Leila serves traditional Lebanese dishes. Leila has two sub brands, Leila’s Coffee Shop and Leila’s Kitchen. Leila’s franchising system is structured, offering support before, during and after to ensure that the same standard prevails. Year Established: 2006 Number of Franchises: 3 Further Information: www.leilarestaurant.com or email joe.a@leilarestaurant.com Name: Let’s Burger Activity: Restaurant Inspired by American burgers. Let’s Burger specialises in traditional-style home-made burgers, using only the best and freshest ingredients. Burgers are made daily and served on a home-made sesame bun with a wide selection of toppings to choose from. Let’s Burger sold it’s first franchise within 20 days of opening. Year Established: 2008 Number of Franchises: 1

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 49

Further Information: ww.letsburger.com or email info@letsburger.com Name: Lina’s Activity: Restaurant More than just a sandwich restaurant, Lina’s gives fast food elegance and style. Lina’s originally opened in Paris and now has more 60 restaurants worldwide. Meals are based on original ingredients and recipes. Lina’s is developed and managed by Catertainment in Romania, India, Turkey, Iraq, UAE, Oman, Sudan and other potential North African countries. Year Established: 2001 Number of Franchises: 11 – Downtown, ABC Achrafieh, Hamra, Verdun, ABC Dbayé, Kaslik, City Mall, Le Mall Sin El Fil, Jal El Dib, Mzaar – Kfarbian, Le Mall Saida. Further Information: www.linaslb.com or email peggykhoury@catertainmentsal.com Name: Lola et Moi Activity: Kids’ fashion Summary: Lebanese kids boutique Lola et Moi began its expansion in 2005 in Riyadh, before continuing into the Middle East and the US. Clothes from the label are worn by the kids of Hollywood stars Tom Cruise, Jessica Alba, Brooke Shields, and Salma Hayek. Year Established: 2003 Number of Franchises: Further Information: info@lolaetmoi.net

M

Name: Mariella Burani Activity: Clothing and accessories Mariella Burani is a ladies’ fashion label featuring stylish and timeless, contemporary and sophisticated. Year Established: 2009 Number of Franchises: 1in down town Beirut Further Information: www.maliagroup.com or email christianeboustany@maliagroup.com

Name: MAYRIG Activity: Restaurant Summary: Mayrig is a restaurant that serves traditional Armenian food prepared with a motherly touch as it is prepared by elderly women and professional chefs. Year Established: 2003 by Aline Kamakina and Serge Maacaroun Number of Franchises: 1 Further Information: www.mayrigbeirut.com or email info@mayrigbeirut.com or l.matta@mayrigbeirut.com Name: McDonald’s Lebanon – Miknas Food s.a.l Activity: Fast food restaurant Instantly recognised quick service restaurant serving hamburgers, fries, drinks, salads, ice-cream, and coffee. McDonald currently has more than 32,00 outlets in more than 119 countries. Year Established: 1998 in Lebanon, 1955 in Chicago. Number of Franchises: 23 Further Information: zsalam@mcdonalds.com.lb Name: Mezzo di Pasta – Mercato s.a.l Activity: Restaurant Mezzi di Pasta is a fast food restaurant serving 100 per cent fresh pasta within five minutes for takeaway or eat-in. Diners choose their own fresh pasta, favourite cheese, and one of 10 different sauces. Year Established: 2008 Number of Franchises: 50 Further Information: www.mezzodipasta.com or email maroun.sfeir@mercato.cc Name: Miss Sixty Activity: Women’s fashion apparel and accessories Miss Sixty is an internationally recognised fashion label, known for its experimental urban designs and edgy styles. Its approach to fashion has earned the brand a reputation for its innovative designs, variety of styles, and creativity. Year Established: 2007 Number of Franchises: 4 Further Information: www.maliagroup.com or

JANUARY - FEBRUARY 2012 | 49

03/02/12 9:54 AM

LFA DIRECTORY

email christianeboustany@maliagroup.com Name: Monsoon Activity: Women and children’s clothes Monsoon combines modern design expertise and traditional materials to provide customers with clothes for every occasion. The clothing range is made using handicrafts, such as hand block printing and tribal embroidery. Year Established: 1973 Number of Franchises: 5 stores Further Information: www.monsoon.com or email info@retailgrp.com Name: Moulin d’Or Activity: Bakery – Pastry - Restaurant Moulin d’Or started off as an Arabic bakery and later became a French bakery. Today, the company has a significant market share in California and is recognised by the international standard ISO 9001:2000. Moulin d’Or also operates an e-delivery service via www.BuyLebanese.com, and supplies its products to supermarkets, minimarkets, restaurants, and hotels. Through their franchise scheme Moulin d’Or offers investors the opportunity to experience the price and independence of owning a business with the benefits of a proven system and strong network. Training, assistance, and support offered. Year Established: 1979 Number of Franchises: 7 Further Information: www.moulindor.com or email melhem@moulindor.com

N Name: Nai Lingerie – Garocco Co Ltd Activity: Lingerie shop Nai Lingerie manufactures and markets high quality women’s lingerie. The company’s wholesale exporting operation was halted to focus on satisfying the retail demand for its underwear lines. Nai Lingerie stocks comfortable, yet unique, under garments in a one of a kind boutique setting. Year Established: 1997 by Roger Jammal

50 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 50

Number of Franchises: 5 Further Information: www.nailingerie.com or email info@nailingerie.com Name: Nestlé Toll House Café Activity: Food and beverage Nestle Toll House Café by Chip serves more than 45 varieties of cookies and baked goods and aromatic Nescafé coffee. Currently seeks candidates to become café owners in Lebanon. Offers comprehensive franchise support program. Nestlé Toll House Café by Chip was ranked #1 by Entrepreneur Magazine’s 2009 and 2010 Franchise 500. Year Established: 2009 Number of Franchises: 110 Further Information: www.nestlecafe.com or email firas@effenbee.net Name: Nine West Activity: Shoes and accessories Created to satisfy the desire and craving of women all over the world for fashionable shoes at accessible prices. Year Established: 1979, USA by Jerome Fisher and Vincent Camuto Number of Franchises: 13 stores Further Information: www.ninewest.com or email info@retailgroup.com Name: Nougatini Activity: Chocolate and confectionery Nougatini transformed the chocolate business into an art form, showcasing flavour, variety and elegance with its handmade confectionery. Franchise opportunities, remains a family run business, with members in key executive roles. Year Established: 1968 by Kamal Barrage Number of Franchises: 3 Further Information: www.nougatini.com or email karima@nougatini.com

O

Name: Okaidi Activity: Children’s clothing

Kid’s clothing line that also promotes an ethical mindset. Okaidi was officially launched with 100 stores and 44o employees. Aimed at children aged 0 to 14, Okaidi is a modern clothing brand, that is universal and accessible to all and respects the ideas and identity of every child in the world. Year Established: 1996 in France Number of Franchises: 9 stores Further Information: www.okaidi.com or email info@retailgrp.com Name: Original Marines Activity: Retail and wholesale garments Original Marines stocks clothes designed for all the family: parents, teenagers, and children. Customer satisfaction is at the heart of the decision making process of this Italian clothing label. Each Original Marines franchise is part of an economically successful business and is backed by stability, safety, and all the necessary support. Year Established: 2005 by Elie Wehbe Number of Franchises: 45 shops in Middle East and Africa, 650 stores in Europe Further Information: www.originalmarines.com or email eliew@lifcosal.com

P

Name: Pain d’Or Activity: baker – pastry – chocolate – ice cream – catering Pain d’Or serves customers with freshly baked goods and delivers a unique experience through the wide range of products on offer. Over the last 20 years, the bakery has earned an impeccable reputation for quality and value in the Lebanese market. Pain d’Or is venturing into new markets and expanding its franchising presence with plans to cover the whole Saudi territory and the Gulf and MENA regions. Year Established: 1982 by Mohamed El Koussa & Sons Number of Franchises: 2 Further Information: www.paindor.com.lb or email malco@malco.com.lb

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

Name: Paolobongia Activity: Jewellery designer and manufacturer Fearless in his designs and with lines ranging from traditional to innovative, Paolo Bongia has created a dazzling new way that people see jewellery. His jewellery collections are now exhibited at annual shows around the world and today Paolo Bongia has more than 10 showrooms in addition to several points of sale. Year Established: 1988 by Paolo Bongia Number of Franchises: 11 Further Information: www.paolobongia.com or email paolo@paolobongia.com Name: Patchi Activity: Retail and industry Patchi is a trendsetting chocolate manufacturer. The brand initiated chocolate as a gift. Today Patchi is a global name with branches in 25 countries worldwide, including, Armenia, Azerbaijan, Brunei, Hong Kong, India, Indonesia, Ivory Coast, Jordan, Kuwait, Morocco, Philippines, Oman, Qatar, Singapore, South Africa, and USA. Year Established: 1974 by Nizar Choucair in Lebanon Number of Franchises: 17 Further Information: www.patchi.com or email patchi@patchi.com Name: Paul and Shark Activity: Fashion Apparel and Accessories Paul and Shark is a luxury sportswear brand catering for men, ladies, and boys. The brand combines chic with casual and the company operates a production structure. Flagship boutiques and spaces are in business in high end retail locations. Year Established: 1921 by Jacques Jean Sarraf Number of Franchises: 6 Further Information: www.maliagroup.com or email christianeboustany@maliagroup.com Name: Pumpkin Patch Activity: Children’s Apparel Pumpkin Patch is a one stop shop for all kids’ wear.

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 51

Originating in New Zealand, it caters to newborn babies through to older kids. Clothes are designed by an in-house team, dedicated to creating quality everyday wear, party wear, nightwear, swimwear, rain gear, and accessories. Pumpkin Patch also caters to new mothers and has a fashion mini brand called Urban Angel for pre and early teens. Year Established: 1990 Number of Franchises: 4 stores Further Information: www.pumkinpatch.com or email info@retailgrp.com

R Name: Rafaat Hallab & Sons 1881 Activity: Confectionery: Catering and Events business; Restaurant, Exporting, Franchising. Rafaat Hallab & Sons is currently offering potential investors a franchise opportunity in a newly adapted model, which will grant the franchisee a reasonable investment with an acceptable rate of return. The franchise model consists of a standard sweet making kitchen for production and point of sale for selling premium quality goods. Full training and customer service supplied. Year Established: 1881 Number of Franchises: 3 self-owned: 5 Further Information: www.hallab.com or email corporate@hallab.com Name: Rectangle Jaune Activity: Men’s Clothing Rectangle Juane is a men’s clothing manufacturer and retailer, supplying a whole range for men, from formal to casual, as well as accessories. Rectangle Juane is focused on an expansion strategy through the GCC and western Europe to develop brand equity and awareness. Year Established: 1988 by Charles Arbid Number of Franchises: 6 Further Information: www.rectanglejuane.com or email jdaher@rectanglejuane.com

S Name: Salmontini – La Maison du Salmon Activity: Restaurant Salmontini is a trendy fine dining restaurant, which specialises in salmon. The restaurant is renowned for its traditional smoked salmon. Salmontini also serves other seafood, sushi, sashimi, and a wife variety of meat dishes and salads. Year Established: 2008 Number of Franchises: 1 Further Information: www.salmontini.com or email ajhussni@salmontini.com or tarek.koleitat@ salmontini.com Name: Sebastian Activity: Men’s and Women’s Footwear Sebastian shoes are made with high quality Italian leather in Parma, Italy and sold in the high-end retail location of downtown Beirut. This sought after brand also has seven independent boutiques and a new showroom – AP Space – in the heart of Milan. Year Established: 2009 by Jacques Jean Sarraf Number of Franchises: 1 Further Information: www.maliagroup.com or email christianeboustany@maliagroup.com Name: Secret PonPon Activity: Bags Secret Pon-Pon was created by Italian handbag designer Chiara Montonari, who launched the brand with a single handmade bag made from a pair of jeans. The brand has grown and Secret Pon-Pon collections include uniquely trendy handbags and small leather goods in a range of colourful and fun designs. Year Established: 2009 by Jacques Jean Sarraf Number of Franchises: 2 Further Information: www.maliagroup.com or email christaineboustany@maliagroup.com Name: Semsom Activity: Lebanese Cuisine Semsom serves Lebanese cuisine with a twist. The concept is a combination of

JANUARY - FEBRUARY 2012 | 51

03/02/12 9:54 AM

LFA DIRECTORY

a traditional and modern restaurant. Semsom is spreading all over the Middle East. Their aim is to spread the Lebanese way of life all over the world – to promote Lebanon. Year Established: 2008 Number of Franchises: 5 Further Information: www.semson.com or email info@semsom.com Name: Sequoia – Paris Activity: Leather goods The Sequoia brand grew from the idea of handbags as a fashion accessory, rather than for practical use, and now the brand carries shoes, jewellery, and accessories. Since its launch, Sequoia has reached the top of the French market and implemented its products into a significant strategic position in major markets abroad, which represents 49 per cent of its activity. Year Established: 1988 by Daniel Sisso Number of Franchises: 2 Further Information: www.sequiaparis.com or email mbassil@rectanglejaune.com Name: Silkor Laser Medical Centre Activity: Laser and Medico-aesthetic and skin treatment services. Silkor is the MENA region’s leading chain of laser hair removal, laser medicoaesthetic and skin treatment services. Customers receive the most advanced, non-invasive medical and aesthetic treatments. Silkor was established in 1997 and since then has provided more than 3.2 million treatments in the Middle East. It has also expanded to parts of the MENA region and is poised to expand into Europe. Silkor oversees and supports regional operations by providing HR services, marketing, operations, finance, corporate development, and project management. Year Established: 1997 Number of Franchises: 9 Further Information: www.silkor.com or email lara@silkor.com or silkor@silkor.com Name: Siom Orfevres Activity: Silverware

52 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 52

Founded in 1967, the Siom brand enjoys universal recognition and is considered one of the largest suppliers of silverware in the Middle East. Siom is consumer driven and offers an extensive range of products to meet the silverware market needs. Collections meet the diverse lifestyle of consumers, while specialist products to cater to corporate and business needs and requirements. Siom is looking for entrepreneurs interested in maximising their business investment through the proper marketing and franchising of its brand and concept, particularly in the Middle East. Year Established: 1967 Number of Franchises: 2 Further Information: www.sion.com.lb or email antoinebaroud@siom.lb Name: Sipes Activity: Paints and Construction Chemicals. The Sipes Group is one of the largest paint manufacturers in the Middle East area, with production facilities in six Arab countries: Lebanon, Jordan, Syria, Saudi Arabia, Egypt and Libya. Sipes is seeking strategic partnerships to cover the high demand in the Middle East, Europe, and Africa. Year Established: 1956 by Ahmad Darwish Bizri Number of Franchises: Further Information: email sipes@cyberia.net.lb Name: Spring Activity: Footwear Spring is an international brand that specialises in creating high quality footwear. A widely recognised brand with 200 stores in Canada, USA, Asia, and the Middle East, Spring has a dynamic growth plan for the next five years and is looking for interested franchisees to be a part of that vision. Year Established: 1991 Number of Franchises: 1 store Further Information: www.spring.com or email info@retailgrp.com Name: Steve Madden Activity: Shoes

Name: Sushi Ko Sarl Activity: Japanese Sushi Restaurants Started off as a kiosk-style sushi delivery has developed into a chain of restaurants with 4 in Lebanon. Sushi Ko went international in 2008 when it opened in Romania, with two more branches since then. The company intends on repeating this success in the Middle East and is looking for franchises to achieve this. Year Established: Number of Franchises: 3 Further Information: www.sushikolb.com or email nicolasmakhoul@sushikolb.com

T Name: Tally Weijl Activity: Clothing Business Part of the Big Star Lebanon franchise, which also includes Big Star Jeans, LTB, and Redskins. The company is keen on expanding within the Middle East by opening more stores and offering more franchises in Lebanon and in the region. Year Established: 1994 Number of Franchises: 15 Further Information: www.bigstarlebanon.com or email e.morcos@bigstarlebanon.com Name: TGI Friday Lebanon Activity: Casual Dining Casual dining restaurant famous for its American menu aimed towards families, couples, groups, and singles. The name is an abbreviation of ‘Thank Goodness It’s Friday’. Serves starters, meals, alcoholic and non-alcoholic beverages. Year Established: 1993 in New York Number of Franchises: 2 Further Information: americana2@american-lb. com

V

Name: Virgin Megastore Activity: Music, DVD, and Games

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

LFA DIRECTORY

BIFEX 2012 LFA LEBANON 23rd -24th May As International Franchisors seek greater market penetration, they increasingly turning towards the Middle East. The region has turned to be a perfect franchising platform with eight out of the top 20 countries included in the Global Retail Development Index (GRDI). Several Factors have accelerated international retailers’ decisions to expand in the region. These factors include exponential growth in retail space, significant investments in shopping malls and the relatively high income. Forum Topics: > Global Trends in the Retail Industry > Role of Shopping Malls in Promoting Brands & Concepts

Summary: Blank Page Year Established: Number of Franchises: Further Information:

W Name: Watermelon Activity: Juice Bar and Coffee Shop Watermelon is a boutique juice bar and coffee concept offering a relaxing, yet welcoming, atmosphere, serving fresh fruit and veg juices, coffee, tea, and a small healthy food menu. Inspired by nature, Watermelon’s colours change each season, and both climate change and the environment are pressing concerns of the company. The first outlet opened in Kuwait, followed by Lebanon, then seven more in KSA, UAE, and Kuwait

www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 53

> A Closer Look into Consumer Behavior in the Retail Industry > Branding: The Cornerstone of Success > Bringing the Customer Closer: Loyalty Programs, Fidelity Cards & Social Media > Franchising as a Means to Enhance Women’s Role in Business

Contact us for the LFA Member Special Registration Form. Chamber of Commerce bldg, floor 13 Sanayeh, Beirut Lebanon Tel:+961 1 742134, +961 71 400533 Fax: +961 1 744162

Who Should Attend? > Interested in the latest global retail trends and developments? > Praying for a partner in the booming retail sector in the MENA? > Caring to network and share experiences with top franchise professionals? > Looking to further expand your franchise in the region?

again. Watermelon is looking for franchisees to further expand. Year Established: 2003 Number of Franchises: 9 Further Information: www.h2o-lemon.com or email jp@blendsltd.com Name: Wooden Bakery Activity: Bread Factory The Wooden Bakery offers a variety of Lebanese, French, and European breads, as well as French and American pastries, Arabic sweets, sandwiches salads, cheeses, and deli. The company are looking to push their presence and create a brand in the bakery industry by offering more and delivering better. Year Established: 1969 by the Bou Habib family. Number of Franchises: 21 in Lebanon, 1 master franchise in Riyadh. Further Information: www.woodenbakery.com or

email franchise@woodenbakery.com

Z Name: Zoughaib Activity: Jewellery and Watches Zoughaib is a jewellery designing and manufacturing company that evokes exceptional brand image in Lebanon and abroad. Zoughaib is offering you, through franchising, the chance to become a privileged partner of one of the most successful brands in the jewellery business. Zoughaib will offer assistance in every step of the franchising process. Year Established: 1981 by Joseph Zoughaib Number of Franchises: 2 Further Information: www.zoughaib.com or email f.azzi@zoughaib.com

JANUARY - FEBRUARY 2012 | 53

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

T H E TAY L O R T R A D I T I O N Since 1854, Taylor of Old Bond Street has manufactured and VROG WKH Ă&#x20AC;QHVW LQ WUDGLWLRQDO DQG PRGHUQ KLJK TXDOLW\ PDOH grooming products and accessories. Todayâ&#x20AC;&#x2122;s product offering is the result of over 150 years of UHVHDUFKDQGSURGXFWUHĂ&#x20AC;QHPHQW2XUXQULYDOOHGH[SHULHQFH of manufacturing specialist grooming products gave us a true LQVLJKW LQWR ZKDW LV UHTXLUHG RI  WKH Ă&#x20AC;QHVW VKDYLQJ FUHDPV soaps and lotions. 7D\ORURI 2OG%RQG6WUHHWH[HPSOLĂ&#x20AC;HVWUDGLWLRQDO(QJOLVK

style combining it with state of the art design, up to the minute manufacturing techniques and the heritage of a long established IDPLO\EXVLQHVV2XUNQRZOHGJHDQGH[SHULHQFHSURYLGHWRGD\¡V man with an offering that is both sophisticated and practical. As a Taylor of Old Bond Street franchise owner you will be responsible for establishing your retail shop in an approved city location, oversee the management and development of your outlet and provide customers with quality products and H[FHOOHQWFXVWRPHUVHUYLFH

T H E F R A N C H I S E PA C K A G E To open and stock a Taylor of Old Bond Street shop you will require a total investment in the region of ÂŁ130,000, depending on shop size and location. The initial payment to Taylor of Old Bond Street of ÂŁ48,500 is in respect of the following: Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021;

Franchise rights Shop premises approval and design assistance Business manuals Initial training

Â&#x2021; Â&#x2021; Â&#x2021;

2QJRLQJVXSSRUWIURPKLJKO\H[SHULHQFHGIUDQFKLVRU Dedicated website and email address Business stationery and marketing materials

Further investment includes initial product stock, acquisition of shop, legal advice and working capital.

B E PA R T O F A B I L L I O N P O U N D M A R K E T A recently commissioned report on the market for menâ&#x20AC;&#x2122;s grooming products found that: Â&#x2021;

The male grooming market is currently estimated to be worth over ÂŁ14 billion and is continuing to grow year-on-year

Â&#x2021;

0HQDUHZLGHQLQJWKHLUWRLOHWULHVUHSHUWRLUHVLJQLĂ&#x20AC;FDQWO\ in terms of quantity consumption and product range

Â&#x2021;

Skincare is now accepted and increasingly popular â&#x20AC;&#x201C; particularly with upcoming generations

Â&#x2021;

There is abundant evidence of an upsurge in new niche product and brand launches

Â&#x2021;

Todayâ&#x20AC;&#x2122;s fashionable man typically uses eight or more different male grooming products

54 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 54

Taylor of Old Bond Street occupies the prime position in WKLV UDSLGO\ H[SDQGLQJ PDUNHW DV WKH EUDQG DEOH WR PRVW HIIHFWLYHO\ H[SORLW WKHVH H[FLWLQJ IDVKLRQ DQG EHKDYLRXUDO WUHQGV:LWKWKHKHOSRI LWVQHZH[FOXVLYHIUDQFKLVHQHWZRUN WKHFRPSDQ\ZLOOEHDEOHWRH[SDQGDQGIXUWKHUVWUHQJWKHQLWV brand prominence in the rich vein represented by the growing male grooming market sector. Taylor of Old Bond Street will only be establishing its UHWDLORXWOHWVLQLQWKHPRVWVRSKLVWLFDWHGDQGOX[XULRXVFLWLHV throughout the UK and worldwide.

www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

A CUTTING EDGE BRAND WITH A SENSE OF TRADITION For more information on this luxury retail franchise contact Richard Langrick on +44 (0)1603 620301, email richardl@fdsltd.com or visit www.thefm.net/e1574 www.TheFranchiseMagazine-mena.com

Franchise magazine-Final.indd 55

JANUARY - FEBRUARY 2012 | 55

03/02/12 9:54 AM

FRANCHISE OPPORTUNITY

56 | JANUARY - FEBRUARY 2012

Franchise magazine-Final.indd 56

| 56 www.TheFranchiseMagazine-mena.com

03/02/12 9:54 AM


Franchise Magazine - Mena Issue 3