Issuu on Google+

517-223-8760 ‡ 226 E. Grand River ‡ P.O Box 937, Fowlerville, MI 48836

FREE

Weekly Business & Community Guide “Serving the Local Communities” Volume XXIX No. 41

WWW.FOWLERVILLEDENTAL.COM

CONVENIENT HOURS J

7am to 7pm and Saturday Appointments Available

CONVENIENT SERVICES J

ALL TREATMENT UNDER ONE ROOF!

Single Visit Crowns, Root Canals, Wisdom Teeth Extractions, Implants, Invisalign and more!

INVISALIGN —SPECIAL—

PARTICIPATE WITH MOST PPO INSURANCES J

Minimize out of pocket expense

PAYMENT PLANS AVAILABLE JCare

Credit and In House Payment Plans

MODERN FACILITY J

With the latest technology

COMPLIMENTARY INVISALIGN EXAM

$3900 (FULL TREATMENT CASES) $2900 (10 TRAYS) $1900 (5 TRAYS)

PLUS F R E E ORTHODONTIC RECORDS ( A $500 VALUE)

OFFER GOOD FOR 30 DAYS

OFFER GOOD FOR 30 DAYS

NEW PATIENT SPECIAL

RECEIVE A FREE

50 GAS CARD!

$

WITH NEW PATIENT EXAM & REGULAR CLEANING & NECESSARY X-RAYS* *Some restrictions may apply. Coupon must be presented at time of service, xrays nontransferable. New patient only. Expires 10/31/2013.

Sunday, October 6, 2013

www.fowlervillenewsonline.com fowlervillenews@gmail.com Published Weekly

Fowlerville High Homecoming King & Queen crowned Fowlerville High School celebrated Homecoming on Friday, Sept. 27, with the crowing of the new king and queen during the halftime ceremony.The Gladiators played Ionia. Shown here are the new royalty, Jordan Klebba and Lea Faulkner, who are members of the Class of 2014. Earlier in the evening the Homecoming court, along with a few hundred other Fowlerville youth took part in the parade that went through the downtown. The weather for the parade and the halftime ceremony was near perfect for late September and brought out a large audience to both events. Photos by Deb Utter This past June the Fowlerville High School Class of 1963 celebrated its 50th year reunion. Classmates who attended the Alumni Banquet and later met for a party enjoyed seeing each other and catching up on each other’s lives. Some of them had so much fun that around 20 of them gathered again, this time for a tailgate party prior of the Friday, Sept. 27 game with Ionia and the halftime Homecoming ceremony. The group, who sat in a special section of the bleachers during the game, was introduced prior to the kick-off. The special recognition included the announcer giving a few highlights of their senior year. Among those was the crowning of the class’s Homecoming Queen, Dawn (Wyzlic) Braun in the fall of 1962. She’s shown here with the current queen, Lea Faulkner.

More photos inside

Page 2 – Fowlerville News & Views – Sunday, October 6, 2013

Fowlerville News & Views – Sunday, October 6, 2013 – Page 3

WANTED +20(67+$71(('522),1*

70

$VHOHFWQXPEHURIKRPHRZQHUVLQ )RZOHUYLOOHDQGWKHVXUURXQGLQJDUHDVZLOO EHJLYHQWKHRSSRUWXQLW\WRKDYHDOLIHWLPH (ULH0HWDO5RRÂżQJ6\VWHPLQVWDOOHGRQWKHLU KRPHDWDUHDVRQDEOHFRVW &DOOWRGD\WRVHHLI\RXTXDOLI\1RWRQO\ZLOO \RXUHFHLYHWKHEHVWSULFHSRVVLEOHEXWZH ZLOOJLYH\RXDFFHVVWRQRPRQH\GRZQEDQN ÂżQDQFLQJZLWKYHU\DWWUDFWLYHUDWHVDQGWHUPV $Q(ULH0HWDO5RRIZLOONHHS\RXUKRPHFRROHU LQWKHVXPPHUDQGZDUPHULQWKHZLQWHU

Fowlerville Business Association enjoys hayride The Fowlerville Business Association held its annual ‘After Hours’ at Mayhew’s Tree Farm & Nursery on Thursday, Sept. 24. Many members and other guests brought their children. Along with being treated by the Mayhew’s to chicken and various salads, those attending got to go on a hayride that went through the Haunted Village. The kids also enjoyed the playground eTuipment, while others in attendance sat around the campÂżre.

WWW.FOWLERVILLEFORD.COM CALL 866-409-8858

ZZZ(ULH0HWDO5RRIVFRP

CALL 866-409-8858

IF YOU DIDN’T SHOP FOWLERVILLE FORD YOU PROBABLY PAID TOO MUCH Bumper to Bumper Repairs. We do it all. Foreign & Domestic!

WE WANT YOUR TRADE! OVER 125 USED IN STOCK FROM

FREE LOCAL TOWING SERVICE* * Free towing to Fowlerville Ford for service, up to 50 miles.

Call this number

FREE SHUTTLE SERVICE

Night Drop off Service Rental Cars Available



SPECIALIZING IN DIESEL MOTOR REPAIR $

$ 23PACKAGE Point Spring 10 OFF WORKS� 20 OFF $30 OFF FUEL SAVER “THE

34 19 Inspection

$

95 $ 95

'  '  $" Any Service % $!$# Any Service Any Service ' %"$ ### Over $100 Over $200 Over $300 '$$"#' # $ "#

Includes: Visual Brake, Steering and Must present coupon when order is written. +TAX ' # Excludes $" $ any other coupon or specials. Expires 6/30/2013. Suspension& SUPPLIES '%#$"##%" # $ $ Check  &$# Transmission, brake/clutch (One coupon per person. Not valid with any or specials. ALL other MAKESoffers & MODELS. master cylinder, power steering, coolant uid levels. Must coupon when10/31/13) order is written. Must present coupon when order is present written. EXPIRES (Diesels and synthetic oil additional)

Not valid with any other offer. Expires 6/30/2013.

TIRE

:$51,1*/,*+7,1',&$725 &22/,1*6<67(0)/86+ Buy a set of 4 tires receive a Coolant Flush ',$*1267,&&+(&.  

FREE

 89

95 * $  CHANGE  OIL Â&#x2021;&RPSOHWHV\VWHPIOXVK Includes: 1 Gallon of Coolant & CAR WASH Â&#x2021;5HILOOV\VWHPZLWK%*

9(+,&/(6 $1'1(:(5

,1&/8'(6



Â&#x2021;'LDJQRVHDQ\ZDUQLQJOLJKWLQGDVK 3OXV Â&#x2021;3XOOXSDQGFKHFNFRGHV 7D[ :,7+&28321 Â&#x2021;&KHFNDVVRFLDWHGFRPSRQHQWV Â&#x2021;&KHFNHQJLQHORZFRRODQW$%6EUDNHVHWF $1<2872)25',1$5<',$*126,6(;75$5(3$,56(;75$ )25'/,1&2/10(5&85<9(+,&/(6$1'/,*+7758&.621/<

7D[  6XSSOLHV 2QPRVWYHKLFOHV0XVWSUHVHQW FRXSRQZKHQRUGHULVZULWWHQ (;3,5(6

Prices may vary on some vehicles

XQLYHUVDOVXSHUFRRO Â&#x2021;$GGFRQGLWLRQHULQVSHFWKRVHVDQGEHOWV ALL MAKES & MODELS.

*0XVWSUHVHQWFRXSRQZKHQRUGHULVZULWWHQ)RUGEXLOWYHKLFOHVRQO\1RWYDOLGZLWK Mention this ad when order is written. Plus tax and shop supplies, Â&#x2021;&KHFNV\VWHPIRUOHDNV most makes and Must present coupon when order is written. models,DQ\RWKHURIIHU9DOLGRQO\DW)RZOHUYLOOH)RUG([SLUHV excludes diesels. Not valid with any other offer. Expires 6/30/2013. Not valid with any other offer. Expires 6/30/2013.  GLHVHOVH[WUD 

 2)) $ 95 :LWK$Q\6HUYLFH

Lube Oil Filter

19

2YHURUPRUH

 2)) $ 95 :LWK$Q\6HUYLFH

Diesel  Lube & Oil Filter Change Using Genuine Ford Motorcraft parts. Includes up to 14 quarts of oil and filter & multi-point inspection.

69

NOW ONLY 2YHURUPRUH

Shop supplies and hazardous waste additional. 6.7 powerstroke slightly higher. Must present coupon when order is written. Ford vehicles only. Cannot be combined with any other specials. One to a customer. Valid only in our service department. Expires 6/30/2013.

FREE  2)) 10% OFF :LWK$Q\6HUYLFH 

Brakes ? ng Squeali

Brake Inspection and Parts & Labor 2YHURUPRUH

With repairs performed. Most cars. :LWKFRXSRQRQO\&RXSRQPD\QRWEHFRPELQHGZLWKDQ\RWKHURIIHU$OOSULFHVSOXVWD[DQGVKRSVXSSOLHV Must present coupon when order is written. 6HH6HUYLFH$GYLVRUIRUGHWDLOV3OHDVHSUHVHQWWKLVDGDWZULWHXS([SLUHV Not valid with any other offer. Expires 6/30/2013.

Most cars & light trucks. Gas only. Must present coupon when order is written. Not valid with any other offer. Expires 6/30/2013.

FREE CAR WASH

Hours of Service: Mondayâ&#x20AC;&#x201C;Friday 7:30am-6:00pm

FREE SHUTTLE Visit us at www.fowlervilleford.com SERVICE for more specials

NO GAMES, NO GIMMICKS, NO HASSLE JUST THE

REAL DEAL! t$"34t467Tt536$,4t â&#x20AC;&#x2DC;00 CHEVY MALIBU Auto., air .......................................................  â&#x20AC;&#x2DC;02 GEO PRISM..................................$2,950 â&#x20AC;&#x2122;02 FORD RANGER EXT.Auto., CAB .................$3,950 â&#x20AC;&#x2DC;00 PONTIAC GRAND AM air..........................................  â&#x20AC;&#x2122;03 FORD TAURUS WAGON â&#x20AC;&#x2DC;03 KIA SPECTRA Auto., loaded ....................................................  Auto, air, leather ...........................$3,950 â&#x20AC;&#x2DC;03 CADILLAC DEVILLE DHS white.............................................  â&#x20AC;&#x2122;01 FORD F-150 XLT Auto air .................$4,950 â&#x20AC;&#x2DC;04 FORD Auto., air ............................................................  â&#x20AC;&#x2122;01 FORDFOCUS EXCURSION LIMITED 4x4 .........$4,950 â&#x20AC;&#x2122;04 FORD EXPEDITION 4x4 ....................$6,450 â&#x20AC;&#x2DC;05 CHRYSLER TOWN & COUNTRY 7 pass., black ............  â&#x20AC;&#x2122;05 CHEVY IMPALA air, loaded ........$4,950 â&#x20AC;&#x2DC;06 FORD F-150 XL 8 ft.Auto, box ........................................................  â&#x20AC;&#x2122;03 FORDEXPEDITION TAURUS WAGON â&#x20AC;&#x2DC;04 FORD 4x4 ......................................................  Auto, air, leather ...........................$3,950 â&#x20AC;&#x2DC;04 JEEP 4x4, loaded ..............................................  â&#x20AC;&#x2122;07 FORDLIBERTY FOCUSRed, Auto, air ....................$6,750 â&#x20AC;&#x2DC;08 FORD FOCUS Auto., air ..............................................................  â&#x20AC;&#x2122;07 CHRYSLER PT CRUISER 72k, auto, air .$7,750 â&#x20AC;&#x2122;06 FORD ESCAPE air ...................$7,750 â&#x20AC;&#x2DC;07 PONTIAC G6 loadedAuto, ..................................................................  â&#x20AC;&#x2122;10 CHEVYMALIBU AVEO White ........................$7,950 â&#x20AC;&#x2DC;08 CHEVY Loaded, auto. ...............................................  â&#x20AC;&#x2122;08 DODGE AVENGER EXT Black .............$7,950 â&#x20AC;&#x2DC;05 CHEVY TAHOE 4x4 clean .....................................................  â&#x20AC;&#x2122;07 PONTIAC G6 Silver .........................$8,750 â&#x20AC;&#x2DC;06 CHRYSLER PACIFICA 66k ......................................  â&#x20AC;&#x2122;08 FORD FOCUS Auto,loaded, air ....................$8,950 â&#x20AC;&#x2DC;11 CHEVY 3 in stock .........................................................  â&#x20AC;&#x153;07 FORDAVEO EXPEDITION 4x4 Black............$8,950 â&#x20AC;&#x2122;07 CHEVY TRAILBLAZER......................$8,950 â&#x20AC;&#x2DC;11 FORD FESTIVA 4 in stock, from ...........................................  â&#x20AC;&#x2122;05 FORD SUPER CAB air ..............$8,950 â&#x20AC;&#x2DC;11 CHEVY HHR 3 in stock fromAuto, ...................................................  â&#x20AC;&#x2122;06 CHEVY TRAILBLAZER Blue ...............$8,950 â&#x20AC;&#x2DC;12 CHRYSLER 200 Gray ............................................................  â&#x20AC;&#x2122;09 CHEVY HHR Red, auto ....................$8,950 â&#x20AC;&#x2DC;05 FORD F-150 XLT 56k .................  â&#x20AC;&#x2122;06 CHRYSLER 300SUPER AWD CREW Extra 4x4, clean ........$9,850 â&#x20AC;&#x2DC;10 SUZUKI  â&#x20AC;&#x2122;11 CHEVY LIMITED AVEO LTLoaded 3 in................................................... stock .............. $10,950 â&#x20AC;&#x2122;08 MERCURY GRAND MARQUIS LS ...... $10,950 â&#x20AC;&#x2DC;04 AUDI A8 QUATTRO Navigation, moon ...............................  â&#x20AC;&#x2122;09 FORDFIESTA FUSION moon .......... $11,750 â&#x20AC;&#x2DC;13 FORD SE Leather, Black, 1k, auto. ......................................  â&#x20AC;&#x2122;08 FORD RANGER XLT Auto, air ........... $11,950 â&#x20AC;&#x2DC;12 FORD FOCUS 3 in stock from ................................................  â&#x20AC;&#x2122;10 TOYOTA COROLLA Loaded ............. $11,950 â&#x20AC;&#x2DC;09 FORD LIMITED .............................  â&#x20AC;&#x2122;08 FORDESCAPE F-150 Auto, air,36k,8loaded ft box ......... $11,950 â&#x20AC;&#x2DC;11 FORD from ..............................................  â&#x20AC;&#x2122;11 FORDFUSION FIESTA8 in7stock in stock, from.......... $11,950 â&#x20AC;&#x2122;08 CHEVY MALIBU LTZfrom Leather, loaded.. $12,950 â&#x20AC;&#x2DC;11 FORD ESCAPE 5 in stock ............................................  â&#x20AC;&#x2122;12 CHRYSLER 200 ..................... $13,650 â&#x20AC;&#x2DC;12 CHEVY MALIBU LTGray Leather, moon ...................................  â&#x20AC;&#x2122;12 FORD FOCUS 3 in stock from........... $14,450 â&#x20AC;&#x2DC;09 HONDA EX ..................................................................  â&#x20AC;&#x2122;10 HONDACR-V ACCORD White, leather ....... $14,750 â&#x20AC;&#x2DC;12 CHEVY IMPALA LT Black, moon .......................................  â&#x20AC;&#x2122;12 FORD FOCUS Black, leather, moon ... $15,650 â&#x20AC;&#x2122;11 FORDFUSION ESCAPE 5 in Silver, stock from â&#x20AC;&#x2DC;10 FORD SPORT leather, moon......... ....................$15,750  â&#x20AC;&#x2122;12 FORDCROWN FUSION 6 in stock â&#x20AC;&#x2DC;11 FORD VICTORIA White,from.......... leather .......................$15,750 

â&#x20AC;&#x2DC;13 CHRYSLER 200 LIMITED  â&#x20AC;&#x2122;11 FORD RANGER SUPER Black CAB................................... ................$15,950 â&#x20AC;&#x2DC;12 JEEP LIBERTY SPORT Black................................. â&#x20AC;&#x2122;12 CHEVY MALIBU LT 4x4 Leather, moon.....  $15,950 â&#x20AC;&#x2122;11 FORD ESCAPE 10 clean in stock from ........  $15,950 â&#x20AC;&#x2DC;09 HONDA CR-V 59k, extra ............................................... â&#x20AC;&#x2122;08 ACURACARAVAN RDX Loaded ..................... $16,950 â&#x20AC;&#x2DC;11 DODGE 3 in stock from.....................................  â&#x20AC;&#x2122;13 CHEVY IMPALA White, moon .......... $17,450 â&#x20AC;&#x2DC;12 FORD E-350 XLT 12VAN pass., 3 in stock from .......................  â&#x20AC;&#x2122;13 CHEVY CARGO Black .............. $17,950 â&#x20AC;&#x2DC;08 DODGE 4x4 EXTAuto, CAB ......................................... â&#x20AC;&#x2122;12 DODGERAM CARAVAN air .............  $17,950 â&#x20AC;&#x2122;11 FORD CARAVAN FLEX Black $17,950 â&#x20AC;&#x2DC;12 DODGE Auto.,........................ air ...............................................  â&#x20AC;&#x2122;12 FORDTAURUS MUSTANG CONVERT auto  $18,450 â&#x20AC;&#x2DC;10 FORD LIMITED moon, nav. Blue, ............................ â&#x20AC;&#x2122;12 FORD MUSTANG Black, premium ..... $18,950 â&#x20AC;&#x2DC;12 FORD MUSTANG Black, premium .......................................  â&#x20AC;&#x2122;11 FORD EDGE 3 in stock from ............ $18,995 â&#x20AC;&#x2DC;11 FORD 3 in stock from ...................................................  â&#x20AC;&#x2122;12 FORDEDGE E-250 CARGO VAN 6k, auto ..... $18,995 â&#x20AC;&#x2DC;12 FORD CARGO LX VAN13k, 6k, auto. .............................. â&#x20AC;&#x2122;13 FORDE-250 MUSTANG auto .........  $19,950 â&#x20AC;&#x2122;13 DODGE CARAVAN White, passenger $19,950 â&#x20AC;&#x2DC;12 FORD MUSTANG CONVERT Blue,7auto ........................  â&#x20AC;&#x2122;11 FORD RAM RANGER 4x4crew, EXT CAB ......  $19,950 â&#x20AC;&#x2DC;07 DODGE 2500 XLT 4x4, super black ...................... â&#x20AC;&#x2122;11 LINCOLN MKZ 14k, red.................. $19,950 â&#x20AC;&#x2DC;06 FORD F-250 SUPER CREW Diesel ..............................  â&#x20AC;&#x2122;13 FORD MUSTANG Black, auto, air, 13k $20,450 â&#x20AC;&#x2DC;12 CHRYSLER TOWN & COUNTRY â&#x20AC;&#x2122;13 FORD E-250 CARGO VAN ............... $20,950 Leather, nav., DVD,F-150 4 in stockSUPER from ..........................................................  â&#x20AC;&#x2122;10 FORD CABS 5 in stock $21,950 â&#x20AC;&#x2DC;10 FORD F-150 from SUPER............................ CABS 5 in stock from ...................  â&#x20AC;&#x2122;09 FORDTAURUS F-150 LIMITED LARIAT White 4x4...................................... Leather ......  $21,950 â&#x20AC;&#x2DC;12 FORD â&#x20AC;&#x2122;09 FORD F-150 SUPER CREW LARIAT 4x4 $22,950 â&#x20AC;&#x2DC;13 FORD TAURUS LIMITED Blue........................................  â&#x20AC;&#x2122;13 FORD ESCAPE Loaded, leather ........ $22,950 â&#x20AC;&#x2DC;11 CADILLAC CTS 35k COUPE AWD ..................................................... â&#x20AC;&#x2122;13 SCION 2 DOOR 9k...............  $23,950 â&#x20AC;&#x2DC;13 FORD CONVERT Auto, air............ ..........................  â&#x20AC;&#x2122;12 FORDMUSTANG EXPLORER 30k, Blue $23,950 â&#x20AC;&#x2122;14 FORD SILVERADO MUSTANGLTBlack convertible ...  $23,950 â&#x20AC;&#x2DC;10 CHEVY Crew cab, 4x4 ........................... â&#x20AC;&#x2122;10 JEEPSIERRA WRANGLER 4x4 4x4 4 DRHybrid SPORT ... $23,950 â&#x20AC;&#x2DC;10 GMC SUPER CAB ......................  â&#x20AC;&#x2122;10 FORD F-150 SUPER CREW â&#x20AC;&#x2DC;12 FORD EXPEDITION EL XLT White ...............................  5 in stock from ............................ $24,950 â&#x20AC;&#x2DC;13 CHEVY LT Ext cab, 1500............. .............................  â&#x20AC;&#x2122;13 FORD SILVERADO EDGE LIMITED AWD $27,650 â&#x20AC;&#x2122;11 FORDEXPEDITION F-150 Fx4XLT SUPER â&#x20AC;&#x2DC;12 FORD Leather,CREW 21k .............................  4x4, EDGE Black,LIMITED moon AWD ........................ $27,950 â&#x20AC;&#x2DC;13 FORD .........................................  â&#x20AC;&#x2122;12 FORDF-150 EXPEDITION Leather, 21k.. $28,950 â&#x20AC;&#x2DC;11 FORD FX4 SUPERXLT CREW 4x4, black, moon..  â&#x20AC;&#x2122;10 FORD F-150 LARIAT White, 4x4 ....... $29,950 â&#x20AC;&#x2DC;12 FORD XLTXLT EL Black ...............................  â&#x20AC;&#x2122;12 FORDEXPEDITION EXPEDITION EL Black ...... $31,850 â&#x20AC;&#x2DC;11 FORD LARIAT Black,4x4 moonWhite .................................. â&#x20AC;&#x2122;11 FORDF-150 F-150 LARIAT ........  $31,950 â&#x20AC;&#x2DC;11 FORD F-250 SUPER CREW Diesel, leather, moon .................... 

MICHIGANâ&#x20AC;&#x2122;S  #"/,3615$:

GOT A JOB? '03&$-0463& GOT A PHONE? $0--&$5*0/ 1 AUTO %*703$& CREDIT 3&1044&44*0/ ("3/*4).&/5 GET A LOAN!! REPAIR CALL /0130#-&. 866-409-8858 SPECIALIST /0$3&%*5 #

REGULAR HOURS: Mon. & Thurs. 9am-8pm

ON 6(('($/(5)25'(7$,/6 ALL SERVICE VEHICLES

Tues., Wed., Fri. 9am-7pm

&RXQWU\&RUQHUĹ&#x2DC; ALWAYS OPEN SATURDAYS 10AM to 3PM

WWW.FOWLERVILLEFORD.COM CALL 866-409-8858

WWW.FOWLERVILLEFORD.COM

CALL 866-409-8858

Saturday

10am-3pm

WWW.FOWLERVILLEFORD.COM

CALL 866-409-8858

)5((72:,1*:,7+,10,/(6 FREE TOWING WITHIN 50 MILES 21$//6(59,&(9(+,&/(6 2856(59,&('(3$570(17 OUR SERVICE DEPARTMENT 12::25.621$//0$.(6 NOW WORKS ON ALL MAKES $1'02'(/6 AND MODELS. 3$576 6(59,&(+2856 PARTS & SERVICE HOURS 0)$0SP M-F 7:30 AM - 6 PM

2,950

$

WWW.FOWLERVILLEFORD.COM

Up to 5 qts. 5W20 motor oil, lube chassis, top off fluids, multi point safety inspection. + Tax & hazardous waste collection.

WWW.FOWLERVILLEFORD.COM

CALL 866-409-8858

WWW.FOWLERVILLEFORD.COM



WWW.FOWLERVILLEFORD.COM

WWW.FOWLERVILLEFORD.COM CALL 866-409-8858

WWW.FOWLERVILLEFORD.COM

&DOO1RZ

WWW.FOWLERVILLEFORD.COM CALL 866-409-8858

CALL 866-409-8858

WWW.FOWLERVILLEFORD.COM CALL 866-409-8858

$Q(ULH0HWDO5RR¿QJ6\VWHPZLOOSURYLGH \RXUKRPHZLWKXQVXUSDVVHG³%HDXW\DQG /DVWLQJ3URWHFWLRQ´ '21œ70,667+,623325781,7<726$9(

Page 4 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

:H5HSDLU'DPDJHG :LQGRZV 6FUHHQV Â&#x2021;6LQJOH6WUHQJWK*ODVV Â&#x2021;'RXEOH6WUHQJWK*ODVV Â&#x2021;$FU\OLF3DQHOV 1RZLQIRU+DOORZHHQ ´3XPSNLQ6RODU/LJKWVÂľ 6WULQJ+DOORZHHQOLJKWV 6WU RUDQJH EODFN

)2:/(59,//(+$5':$5(  +RXUV0RQ)ULDPSP :*UDQG5LYHU 6DWDPSP&ORVHG6XQGD\V 6.,//('Â&#x2021;(;3(5,(1&('Â&#x2021;6(59,&(

Knock Knock...Whoâ&#x20AC;&#x2122;s there? Boo! Boo Who? You are soo boo-tee-ful! Ha-I made that one up my self â&#x20AC;&#x201C; can you tell? Well, as promised I have a few more books to add to your October â&#x20AC;&#x2DC;spook-tac-ularâ&#x20AC;&#x2122; reading list. Here we go: Blood on the Bridge by Christopher H. Meehan. â&#x20AC;&#x153;This is a complex, riveting tales that revolves around Arly Fleck, a violent loner who enlists the help of the Michigan Militia in a plot to blow up the Mackinac Bridge. His motive: revenge on Michiganâ&#x20AC;&#x2122;s new governor, Franklin Bones, who refuses to acknowledge the blood connection between them.â&#x20AC;? Murder on the Grand by Christopher H. Meehan. Loren D. Estleman says â&#x20AC;&#x153;Meehanâ&#x20AC;&#x2122;s Murder on the Grand is oldfashioned entertainment delivered in chromium, high-tech case that will satisfy fans of both the techno-thriller and the traditional murder mystery.â&#x20AC;? Here is the Âżrst paragraph from this thriller of a book: â&#x20AC;&#x153;Huge Ă&#x20AC;ames billowed from the car, swirling from under the smashed hood, broiling the driverâ&#x20AC;&#x2122;s body and pushing me back. I knew the person trapped in there. She was very close to me. Hands tried to grab me from

behind, but I slogged forward, forcing myself in slow motion toward the Âżre.â&#x20AC;? Now how about a kids book? Uncle Johnâ&#x20AC;&#x2122;s â&#x20AC;&#x201C; The Haunted Outhouse. Science, History, Horror, Mystery andâ&#x20AC;ŚEerily Twisted Tales! This book is Âżlled with frightening true facts about A Mad Scientists Halloween Party, The Zombie Apocalypse, twisted tales like Wienerstein and the Haunted Outhouse! And for the very young try: Knock! Knock! Knock! Whoâ&#x20AC;&#x2122;s There? By Philippe Goossens, The Witch with a Twitch by Layn Marlow, The Haunted Hamburger and other ghostly Stories by David LaRochelle, by Froggyâ&#x20AC;&#x2122;s Halloween and A Big Spooky House Donna Washington. Think the number 13 is unlucky? Here are a few tidbits on that superstition: More than 80 percent of high-rise buildings donâ&#x20AC;&#x2122;t have a 13th Ă&#x20AC;oor. Most skip right to Ă&#x20AC;oor 14. In Formula One racing, there is no car with the number 13. President Franklin Roosevelt never invited 13 guests to lunch. If someone canceled and it looked as if there might be 13 people at the table â&#x20AC;&#x201C; he invited his secretary to join the group. Check these out â&#x20AC;&#x201C; fun reads for all at the FDL. In closing here is a joke from The Haunted Outhouse...What do you do if a ghoul rolls her eyes at you? Why you pick them up and roll them back!

Turning 65? :HFDQKHOS\RXÂżQGDKHDOWKDQGGHQWDO SODQWKDWÂśVULJKWIRU\RX )RUPRUHLQIRUPDWLRQFDOO

(517) 546-8124 LIVINGSTON COUNTY FARM BUREAU

60LFKLJDQ$YH6WH+RZHOO0,

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 5

²$UHD'HDWK²

)UDQFLV³)UDQN´/HRQDUG3KLOOLSV Francis ³FranN´ /eonard 3hillips, age , oI 0ason passed awa\ SeptemEer 2, 2, at +aven oI Rest in :illiamston, 0,. +e was Eorn to :illiam +enr\ and (va 0ae (lliott

3hillips on -une , 2 near Fowlerville. +e graduated Irom Fowerville +igh School in  and enlisted in the 8S Arm\ Air Corp. +e honoraEl\ served with the th 8S Arm\ Air Corp Signal Air :arning, Co. A in ::,, and celeErated his 2th Eirthda\ on the Eeaches oI 2maha. +e also Iought in the %attle oI the %ulge. 2n SeptemEer 2, , he married :anda 0arie Davis in Fowlerville. FranN worNed Ior *eneral (lectric Ior  \ears, 0ichigan %rass and (lectric Ior  \ears and Standard (lectric Ior 2 \ears. +e was a liIe memEer oI 9F: 3ost 7 and a memEer oI American /egion 3ost  in 0ason and helped organi]e the 0emorial Da\ and 9eterans Da\ parades. +e was a memEer oI DucNs 8nlimited Ior \ears. FranN and his wiIe served as Communit\ leaders Ior Alaiedon -+ as well as proMect leaders. +e also umpired man\ -+ soItEall games. +e loved Âżshing, hunting, carpentr\ and watching his grandchildren pla\ sports. +e was preceded in death E\ his Erother, %urton 3hillips sisters-in-law, 1orma Davis .elle\ and 1athalie Davis

Conner Erothers-in-law, .eith Conner and Roger Davis and daughter-in-law, :end\ Diane Scripter 3hillips. +e is survived E\ his wiIe and three children .athleen /arr\ 0innis, Richard 0- 3hillips, and Randall 3hillips  grandchildren, -eIIre\ Christina 0innis, Daniel Sarah

0innis, (rin /ance *raI, .ristin 3hillips, Traci 3hillips, Scott 3hillips, 1icole -eII %lacNmore, and 3aul 3hillips  great-grandchildren, T\ler and Reese 0innis, Cassa and Raegan 0innis, R\Ner and /ottie *raI, +a\lie and .ason %lacNmore and Cooper 3hillips in-laws, -o\ 3hillips, -ean :illiam 1orthrop, +oward 0illie .elle\ and FranN 0aril\n Davis as well as man\ nieces and nephews. Funeral Services were held  30 Thursda\, 2ctoEer  at the *orsline Runciman Funeral +omes, %all-Dunn Chapel, 2 S. -eIIerson, 0ason. ,nterment was in /eeN Cemeter\, 0ason. ,n lieu oI Ă&#x20AC;owers, contriEutions ma\ Ee made in FranNÂśs memor\ to the 9F: -ean R. Anderson 3ost 7, 2 +ull Road, 0ason, 0, . 2n-line condolences memories ma\ Ee shared with the Iamil\ at www.grEdmason.com

)RZOHUYLOOHWHQQLVWHDPÂżQLVKHGLQWKLUG SODFHDIWHUWKH&$$&5HGWRXUQDPHQW The Fowlerville tennis team competed in the CAAC Red Tournament on Sept. 27 and came home with a third-place Âżnish that put the sTuad in third Ior the \ear. +aslett won the meet and the season championship, with Dewitt coming in second Ior Eoth. -acoE 3rochnow won the 2nd singles Ă&#x20AC;ight with a thrilling three-set victor\ over Carmen %aEer Irom Dewitt in sets oI - 7- -. Drew 9ielEig won the  singles Ă&#x20AC;ight with a straight set victor\ over Trevor Sims in the Âżnal - -. The second douEles team oI Cod\ /eggert and =ach :ilEer lost their Âżrst match oI the season with a loss in the Âżnals against Dillon .leihege and ToE\ +elper - -. %ringing home rd place Âżnishes and earning all-league were -ohn *raEle  singles and Cod\ DurEin  singles . ,n douEles the rd douEles team oI *rant Ta\lor and Chad %orland and the th douEles team oI Alton *ilaM and David 0iechiels tooN home rd place Âżnishes also. (arning a th place Âżnish and getting honoraEle mention all-league was the Âżrst douEles team oI *arrett .ottong and Ta\lor /ocNhart.

)RZOHUYLOOH 9): /DGLHV $X[LOLDU\ KROGLQJ 6SHFLDO %LQJR RQ 2FW.  The 9F: and the 9F: /adies Au[iliar\ oI 3ost  will hold a Special %ingo on Sunda\, 2ctoEer 27, to Eene¿t the 9F:/A9F: Cancer Aid Research 3rogram. The Eingo will Ee held at 9F: 3ost , located at 2 Veterans Drive in Fowlerville. Doors will open at 2pm. and Eingo will start at pm. with Iood availaEle. The theme Ior the Eingo will Ee ³*ive Cancer the %oot´ Feel Iree to wear a +alloween costume The memEers oI the VF: and /adies Au[iliar\ have Eeen raising mone\ to Iund cancer research and assist memEers Eattling cancer since 7 and since then have raised Iunds totaling  million to date. For 7 consecutive \ears, the /adies Au[iliar\ has raised  million dollars annuall\. (ach \ear the /adies Au[iliar\ awards a two \ear 3ostdoctoral Cancer Research Fellowship to a cancer researcher with the most innovative and promising ideas. Come out and Moin us Ior an evening oI Iun and help the ¿ght against cancer

0LOOYLOOH 8QLWHG 0HWKRGLVW KRVWLQJ 3L]]D 0RYLH 1LJKW RQ 2FW.  The 0illville 8nited 0ethodist Church will Ee hosting a 3i]]a 0ovie 1ight on Saturda\, 2ctoEer , starting at pm with pi]]a, Iollowed E\ a movie, ³Second Chances.´ Donation Ior pi]]a is asNed, movie Iree The church is located at 2 1. 0-2, StocNEridge, which is  miles south oI ,- or  miles north oI StocNEridge on 0-2. For more inIormation \ou ma\ contact the church at 7--7.

2010 Ford Escape XLT

2009 Ford Flex Limited

2009 Ford Fusion SE Sedan

Best Color Out There, Blue Granite Metallic! Save on Gas with the Four Cylinder Front-wheel Drive! Save on PAYMENTS at Only...

43,000 Low Miles, Top of the Line Model, New Tires, Middle Row Buckets with Refrigerator, Vista Roof, Heated Leather, Remote Start, SYNC System, Ford Warranty and Original M.S.R.P. of $38,630.

Good Looker! 4 Cylinder Gas Saver, Red Metallic, 71,000 Miles and a Three Month Warranty! Low Interest Rates and Low Price Make For Low Payments!

12,900

$

21,900

$

$

10,900

2004 Chevy Silverado 2008 Dodge Ram Quad Cab â&#x20AC;&#x153;Laramieâ&#x20AC;? LS 2500 HD Crew Cab Two Wheel Drive 4x4

2003 Toyota Highlander Limited 4x4

Top of the Line Package, ONE OF A KIND! ONLY 16,531 Heated Leather, 20â&#x20AC;? Chromes, Miles, One Owner, Great for Hemi V-8, Remote Start, Towing, Has a Six Liter V-8 and No Power Sliding Rear Window, Accidents! Three Month Warranty 80,000 Lady Owned Miles and and Well Worth... a Six Month Warranty!

Locally Owned by the Weavers, Loaded, New Tires, Great Condition, 106,000 Miles and a Three Month Warranty for ONLY...

17,800

$

$

14,900

8,995

$

or Dealer Fees

6SDFHDYDLODEOHIRU*UDFH/XWKHUDQ 6FUDSERRNLQJ&URS &UDIW'D\ Space is still availaEle Ior scrapEooNers or craIters Ior ScrapEooNing Crop CraIt Da\ on Saturda\, 2ctoEer 2 at *race /utheran Church, +owell. The event is Eeing sponsored E\ *race Filled :alNers Rela\ Ior /iIe team. All proceeds EeneÂżt Rela\ Ior /iIeAmerican Cancer Societ\. For inIormation and to register, contact 3at 0orschecN, 7 2- or 7 22-7.

VIEW OUR INVENTORY at backhuusauto.com

Page 6 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Alchinâ&#x20AC;&#x2122;s Disposal, Inc.    Containers: 2, 3, 4 & 6 Yards 10, 15, 20 & 30 Yard Roll-Offs Call:

223-7119

Fowlerville Junior High News

Important Dates MEAP Testing begins Oct. 8-10 Parent-Teacher Conferences Oct. 23 and 24 Oct. 23 5:00-7:30pm Oct. 24 1:00-4:00 and 5:00-7:30pm Cookie Dough Pickup Oct. 24 Picture Retake Day Oct. 24 End of 1st Marking Period Oct. 31 *** Progress Notes Progress Notes will be sent home with students on Wed. Oct. 9th. If your child does not bring one home and did not receive theirs please contact the main ofÂżce. ***

%(76<:0(7+27 $FFRXQWLQJ²7D[²3D\UROO²&RQVWUXFWLRQ/LHQ  OLYEL]#FRPFDVWQHW)D[   0HPEHURI+RZHOO&KDPEHURI&RPPHUFH&RQVWUXFWLRQ$VVRFLDWLRQRI0LFKLJDQ 1DWLRQDO$VVRFLDWLRQRI7D[3URIHVVLRQDOV

MOLLISON LAW OFFICE, PLC William R. Mollison, J.D.

6*UDQG$YHQXH32%R[ )RZOHUYLOOH0,

General Practice of Law (VWDWH3ODQQLQJ 3UREDWHÂ&#x2021;(OGHU/DZÂ&#x2021;)DPLO\/DZ 'LYRUFHÂ&#x2021;-XYHQLOH&RXUWÂ&#x2021;5HDO(VWDWH Â&#x2021;&RUSRUDWH/DZ

Telephone: 517-223-1333 Free Initial Consultation Visa / Mastercard Accepted (PDLOPROOLVRQODZRIĂ&#x20AC;FH#\DKRRFRP

Published PoetsFowlerville Junior High has three published poets. Last spring, Jasmin DeRouchie, Kailyn Harvey, and Brittany Bush submitted poetry to Creative Communication, which is an anthology of poetry written by students. Their poems had to be approved to go to publication. Jasmin entered, â&#x20AC;&#x153;Brotherâ&#x20AC;&#x2122;s Angerâ&#x20AC;?. Kailyn entered, â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s Just Not Fairâ&#x20AC;?, and Brittany Bush entered, â&#x20AC;&#x153;Tomorrowâ&#x20AC;?. All of us here at FJH are VERY proud of the girls for having the conÂżdence to submit their work and even more so that they were chosen as one of the best. *** MEAP TESTING MEAP testing begins this week, please make every attempt possible to have your student at school during testing days. Testing will take place on Oct. 8-10 and Oct. 15-17. Thank you *** SPORTS FOR WEEK OF OCT. 7: Mon., 10/7: VB vs Jackson Catholic-7A, 8H; 4:30; bus-2:45 XC @ Mason; 5:00; bus3:30 Wed., 10/9: VB vs Corunna7A, 8H; bus-3:00 Thurs., 10/10: XC @ Gâ&#x20AC;&#x2122;d Ledge Invite; arrangements pending CONGRATULATIONS to Coach Burt, the 6-7-8 XC team, & parent Mike Steinhelper for a successful fundraiser to purchase badly needed uniforms. Parents,

$//<285)/225,1*1(('6

friends, businesses & other supporters helped the team realize their goal. THANK YOU ALL!! *** 7TH GRADE VOLLEYBALL On Sept. 25th, the 7th grade A and B teams pulled out stellar performances to defeat East Lansing in match play. B Team won in three straight games with scores of 21-13, 21-18 and 15-6. The B Team was lead in service points by Aliza Opolka, Maggie Hamann and Gabby Jolliff all with 5 points each. The B Team had 8 players score on service points! Great accomplishment ladies! Gabby Jolliff and Natalie Juoppperi performed as setters for the three games and provided some great assists. Kyla Chappell, Shelby Walter and Ryanne Maddox took care of the back row getting in some great digs and passes. The A team defeated a tough East Lansing team with pure determination in match play with scores of 21-14, 13-21 and 15-9. The A Team was lead in service points by Leah Ash with 7 points, Jackie Jarvis with 6 and Danielle Ryan with 4. The A Team also had 9 players with service points! A great match of serving ladies!!! Jackie Jarvis and Julianne Seiter performed as setters hustling all over the court for that 2nd hit. The back row was protected with great passes by Olivia Olmsted, Natilee Wilkinson and Grace Roedel. Last night was a great performance for both teams!! A Team improves to 2-2 on the season while B Team moves to 2-1. GO GLADS!!!! The 7th Grade Volleyball team traveled to Okemos on Sept. 30th to face a tough Chieftan squad. Both A and B teams pulled out victorious with outstanding performances on the court! B team was lead with outstanding backline defense by Kristin Dotson, Ryanne Maddox and Kyla Chappell. They defended the back row with hustle and determination. Gabby Jolliff and Natalie Juopperi performed as setters, using their hustle to get those 2nd hits and defend the net. Mary Farmer and Sara Harbin gave stellar front row performances, returning some great serves. The B team was lead in service points by Maggie Hamann with 14 and Aliza Opolka with 4. The B team shut the Cheiftans down in 3 games with scores of 21-13, 22-20 and 15-10. The B team improves their record to 3-1. The A team fought hard and never gave up in their match against the Chieftans. Meaghan Douglass, Leah Ash, Geni Winiarski and Danielle Ryan played an excellent front row, while Olivia Olmsted and Lani Burnie brought in a great defensive effort in the back row. Ginelle Leslie gave both back and front line defensive protection, providing excellent passes for her setters. Jackie Jarvis and Julianne Seiter provided great assists to their teammates at setters. The A team was led in service points by Jackie Jarvis with 8, Natilee Wilkinson with 5 and Danielle Ryan with 2. Ginelle Leslie, Madison Shaw and Meghan Doughlass each added one point. Congratulations ladies on a hard fought match! The A team downed the Chieftans 2-1 in match play with scores of 21-6, 10-21 and 15-6. The A Team improves their record to 3-2. GO LADY GLADS!!! *** CROSS COUNTRY On Sept. 25th at the Jackson Invitational, the junior high cross country team did well by many on the team receiving personal records. For the girls team, Sophia Spalding received a medal for 12th place and had a PR of 15:14, Kendall Trinka had a PR of 20:33 and Gabrielle Heiser had a PR of 21:33. For the boys team, Tyler Steinhelper came in 5th receiving a medal

2ZQHU6WHYH3DUULVK5HVLGHQWLDO &RPPHUFLDO ZZZSDUULVKFDUSHWFRP

48,&.67(3/$0,1$7(5$*12&(5$0,&7,/( 7$5.(7 $5067521*9,1</ 0$11,1*721'($/(5*5($76(/(&7,212)&$53(7

)UHH,Q+RPH(VWLPDWHV |2YHU<HDUVLQWKH%XVLQHVV} ([SHUW,QVWDOODWLRQE\/RFDO,QVWDOOHUV

20% OFF Tiz Horse Feed & Tiz Goat Feed *While supplies last.

On Sale!

23(1$03078(6'$<)5,'$<Â&#x2021;$0306$785'$< :*UDQG5LYHU)RZOHUYLOOH0,

Â&#x2021;SDUULVKFDUSHW#JPDLOFRP

 

Taste of the WILD 30# Grain Free Dog Food $40.00 each *While supplies last.

1HZ+RXUV6WDUWLQJ6HSW

0RQGD\WKUX)ULGD\DPWRSP 6DWXUGD\DPWRSP

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 7 with a time of 12:03 and Aaron Davis also received a medal coming in 10th place. Collin Smar came in 21st just missing the medal category with a time of 13:23. Robby Bilyk had a PR of 16:21, Gavin Tait had a PR of 19:11 and Justin Placido had a PR of 21:01. Great Job Gladiators! The Junior High Cross Country Team struggled Sept. 30th at their Holt meet. The 6th graders did well running 1.25 miles with times of 7:21 for Bryson Scott, 9:48 for Lucas Smith, 9:34 for Olivia DuFore and 9:36 for Gabby Juopperi. Hopefully Wednesday the team can get back on track with some personal records at LCC Cougar Clash meet. *** PLEASE TAKE NOTE OF RECENT CHANGES TO THE VGâ&#x20AC;&#x2122;S COMMUNITY REWARDS PROGRAM. SEE INFORMATION BELOW. The Community Share program will become the Cash for Class program to earn money for our school. This change took place on September 1st. During the weeks of: Oct. 20-26, Nov. 17-23, Jan. 12-18, Feb. 2-8, Feb. 23-Mar.1 purchases you make with your â&#x20AC;&#x153;yesâ&#x20AC;? card will automatically be added to our schoolâ&#x20AC;&#x2122;s account. At the end of March 2014, our school will receive a rebate check based on the percentage of all of our memberâ&#x20AC;&#x2122;s purchases. INDIVIDUALS NEED TO CONNECT THEIR â&#x20AC;&#x153;YESâ&#x20AC;? CARD TO OUR SCHOOL SO WE CAN CONTINUE TO EARN MONEY. Go to www.myyesrewards.com to link your card. You only need to link your card one time and you will have the convenience of not having to turn in receipts. Thank you for any support! *** HELP US HELP OUR SCHOOL THROUGH TARGET--There is an easy way to help us raise money for our school. Itâ&#x20AC;&#x2122;s called Take Charge of Education. Hereâ&#x20AC;&#x2122;s how it works: Visit Target.com/tcoe or call 1-800-316-6142 to designate our school, then use your REDcard whenever you shop. When you use your REDcard (Target Credit Card, Target Debit Card or Target Visa Credit Card), Target will donate up to 1% of your purchases to our school. Learn more at Target.com/ redcard or stop in a Target store to apply. Thank you for all you do for Fowlerville Junior High School! *** Volunteers and Donations Needed We have an exciting new program at Fowlerville Jr. High School this year called the CitizenShip Initiative program. The CSI program is comprised of many elements to help students learn the skills they need to succeed at school. The students learn about speciÂżc social skills to help them understand the importance of learning and getting along with others. When the skills are learned and modeled students may receive a CSI slip, good for an entry in the weekly drawings. There are also poster and video contests to promote the skills

ZIOPTIS

being presented. All of these facets of the program help students to be involved and take leadership in presenting the material to their peers. The CSI program also awards students â&#x20AC;&#x153;Glad Goldâ&#x20AC;? for their attendance, grades, citizenship, and participation in school activities. Students can use the â&#x20AC;&#x153;Glad Goldâ&#x20AC;? to purchase items at an auction provided for them at the end of each semester. This is where we need volunteers. We need parents and guardians to help with this program. We need volunteers to help with the record keeping of the â&#x20AC;&#x153;Glad Goldâ&#x20AC;?, help solicit items for the auctions and help to be a part of the CSI committee, comprised of staff, parents/guardians and students. We all will be working together to promote the CSI program. If you are interested in volunteering or donating new items for our auction (i.e. gift cards, toys, sports equipment, game tickets, etc), you can contact Kim Battjes at battjesk@fvl.k12. mi.us or 517-223-6267 or Kathleen Kephart at kephartk@fvl. k12.mi.us or 517-223-6210. We appreciate any help you can provide in continuing the CSI program. *** ATTENTION 6TH GRADE PARENTS 6TH GRADE IMMUNIZATION REQUIREMENTS Public Act 89 of 2000 mandates that an immunization assessment be completed for each sixth grade student. The law (which amended the Revised School Code, the Public Health Code, and the State School Aid Act) were implemented to ensure that children are adequately immunized against vaccine preventable disease prior to adolescence. Immunizations prior to adolescence are important, as some of these diseases become an even greater threat to health upon reaching adolescence. A child who fails to meet immunization requirements shall be excluded from school as of November 1, 2013. If you have been following the recommended schedule of immunizations up to this school year, your child will need a dose of Tdap (Tetanus-diphtheria a cellular pertussis), MCV4 or MPSV4(Meningococcal Conjugate or Meningococcal Polysaccharide) and if your child has not had Varicella or Chicken Pox, they will need 2 doses of the Varicella vaccine. If you are going to take your child to your family physician for a physical prior to school, now would be a good time to update their immunizations. If you would prefer to take your child to the Livingston County Health Department, please call them for dates, times and a fee schedule. The LCHD phone number is 517.546.9850. Please call Mrs. Nygren in the junior high ofÂżce if you have any questions @ 517.223.-6202.

Grand River Corn Maze presents

+++++ THE 5 STAR RATED MICHIGANâ&#x20AC;&#x2122;S BEST TRIFECTA OF TERROR!TAKE YOUR

SLAUGHTER HOUSE NEW

S! CARE

ING S

AMAZ

Ron Patterson

0LFKLJDQ¡V/DUJHVW5HDO(VWDWH&RPSDQ\

,21=D=;LJA;

+LZPNUÂ&#x2039;)\PSKÂ&#x2039;0UZ[HSSÂ&#x2039;9LWHPY 0UK\Z[YPHSÂ&#x2039;*VTTLYJPHSÂ&#x2039;9LZPKLU[PHS .LULYH[VYZÂ&#x2039;*VKL*VYYLJ[PVUZ

4H[[:VH]L

4HZ[LY,SLJ[YPJPHU 3PJLUZLKÂ&#x2039;0UZ\YLK



Fowlerville Community Theatre ANNOUNCES ITS N NOV. 1,, 2013, 3, DINNER NN THEATRE SHOW!

CHANCES ON THE...

er HAUNTED

.4.  t h g u a l S & BEYOND e MAZE CORN OVER 13 FT TALL!

HousMBO

R CO3 E P U S ALL NLY TS O N U HA

$30

HAYRIDE

SLAUGHTER HOUSE: $13 HAUNTED MAZE: $13

HAUNTED HAY RIDE: $13 ANY DOUBLE COMBO:

$3 DISCOUNT

CHECK WEBSITE FOR OUR 2ND 5K

DEAD MAN DASH & OBSTACLE RACE

OCTOBER 19TH.

COVERED WAITING

ALL HAUNTS OPEN

Oct 4-5, 11-12, 18-19, 25-26

HAUNT HOURS ARE:

Fri & Sat 7:00 p.m.

AMPLE PARKING

NOT IN THE MOOD TO BE

CONCESSIONS

TERRIFIED?

TQWT VJG  CETG UWRGT OC\G  TGNCZ D[ VJG DQPĆ&#x201A;TG HQT $6! Sept 14-15, 20-22, 27-29. October 4-6, 11-13, 18-20, 25-27. Fr: 6 p.m.-11 p.m., Sat: 1 p.m.-11 p.m., Sun: 1 p.m.-6 p.m.

FOR MORE INFO: 517-223-9140 CHECK THE INTERNET FOR WEEKEND UPDATES

WWW.SLAUGHTERHOUSEADVENTURE.COM 5781 W. Grand River, Fowlerville MI 48836 FOLLOW US ON FACEBOOK

AM Murder d M Mystery Comedy C d by Tony Schwartz & Marylou Ambrose

Directed by Diana Dombrowski "# Dinner Theatre Tickets $25 Each WOODSHIRE PLACE BANQUET FACILITY â&#x20AC;&#x201D;Price Includesâ&#x20AC;&#x201D; 6520 W. Grand River, Fowlerville

â&#x20AC;&#x201D;Limited Seatingâ&#x20AC;&#x201D;

GET YOUR

TICKETS TODAY

DOORS OPEN at 6:00pm DINNER at 6:30pm SHOW at 7:30pm

Show & Buffet Dinner sAppetizers, Lasagna Dinner, Dessert, Beverages, & Cash Bar

TICKETS SOLD AT DR. TIMâ&#x20AC;&#x2122;S OFFICE 746 S. Grand Ave., Fowlerville

517 223-9409

fowlervillecommunitytheatre @gmail.com

NO TICKETS SOLD AT THE DOOR

Page 8 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Upcoming Programs at the Fowlerville District Library Follow us on Facebook & www.fowlervillelibrary.org. Registration usually opens 2 weeks prior to the event unless otherwise noted. Lego Club: Wednesday, October 9th 4pm Kids

-(403@-66;*,5;,9 'U,6WHLQHU'30 

+PWSVTH[L(TLYPJHU)VHYKVM7VKPH[YPJ:\YNLY` )VHYK*LY[PĂ&#x201E;LK-VV[HUK(URSL:\YNLY`

-9,,-66;,?(4>0;/4,5;0656-;/0:(+

,_JS\KLZJOPSKYLUL_HTZSHI_YH`[YLH[TLU[OV\ZLJHSSZHUKZLJVUKVWPUPVUZ

/6>,33

)90./;65





)`YVU9K :\P[L

>.YHUK9P]LY :\P[L

65:;(--(;!:[1VZLWO/VZWP[HSZPU/V^LSS)YPNO[VU (UU(YIVY 46:;05:<9(5*,:(**,7;,+

&RPLQJ6RRQ

7KH %RXWLTXH ,QVLGH6KHHU,PDJH

Welcome Erin Archibald & Jocelynn Good! &DOOWRGD\IRU\RXUDSSRLQWPHQW



K-5th grades. Listen to a story, be inspired, and build a Lego creation. *Registration is open. There is limited space and materials; you must be registered to attend. Due to the overwhelming popularity of this program you must register in person at the circulation desk only. *** Book & Movie Group: Thursday, October 10th 6:30pm Adults. Read the book and then enjoy the movie at the library! We will have light movie-style refreshments and a brief discussion following the movie. *Register, check out the book, and come to the program. Registration is open. *** â&#x20AC;&#x153;Seek the Unknownâ&#x20AC;? Teen Read Week: October 13-19 Teens 6th-12th grades. Check out books from our display this week & enter to win prizes! *** Scrabble Club: Monday, October 21, 5pm Adults. Scrabble enthusiasts are welcome to join our monthly scrabble tournaments regardless of skill level. Improve your game while socializing at the library. Seating is limited. *Register by phone at 223-9089 or at the Circulation Desk each month to attend. Registration opens October 7th. *** â&#x20AC;&#x153;Spookâ&#x20AC;?-Tacular Stories: Wednesday, October 23rd 5:306pm Kids K-5th Grades. Join us for a spine-tingling story e[perience featuring Johnathan RandÂśs ÂłCreepy CampÂżre Chillersâ&#x20AC;?. Parents Advisory: While this event is open to all children k-5th grades, these stories include spooky sound effects, creepy voices, and scary stories to create an intense event that may not be suitable for all children. * Registration begins October 9th. Register at the Circulation Desk or call 223-9089. *** Harvest Leaf Luminaries: Thursday, October 24th 6:45pm Adults. Join us in creating a simple seasonal craft that will bring a bit of the outdoors into your home! *Seating is limited. Register in person at the Circulation Desk. Registration for this event requires a $5 refundable cash deposit. Registration begins October 10th.

Creating ConÂżdent Caregivers workshop starts Oct. 22 in Howell Creating ConÂżdent Caregiver - )ree  Week Workshop 'ate 7uesdays starting 2ct. . 7ime  pm -  pm. Place: Be Our Guest Adult Day, 2020 E. Grand River #103, Howell. Register: Contact Area Agency on Aging 1-B at 800-852-7795. This program is designed to increase the knowledge, skills and outlook of the caregiver or family member caring for a loved one with memory loss or dementia. Care for your family member with dementia can be provided at no cost while you attend this workshop! Space is limited so call today to reserve your spot!

(*UDQG5LYHU)RZOHUYLOOH VKHDULPDJHVDORQGD\VSDFRP

Fowlerville youth gets 9-point buck during Youth Hunt Austen Garrison, 15 years old of Fowlerville, shot this 9-point buck during the Youth Hunt on Saturday, September 21st around 8:15am using his T/C Muzzleloader. He was hunting with his dad, Shane Garrison in Vermontville.

Meeting on hydraulic fracturing being held this Wednesday at Conway Township Hall

The Âżrst possible site for Hydraulic )racturing, a method used for deep well drilling for natural gas and oil, could occur in Conway Township. An exploratory test well is planned on land owned by Jack Sherwood. The company doing the drilling has also leased other land in the township. While this type of drilling is legal in Michigan and the exploratory well has received a permit from the Dept. of Environmental Quality, the procedure has prompted opposition in other parts of the country. The drilling involves using an abundant amount of water and chemicals to break up the underground shale and release the gas and oil deposits. Opponents worry about the possible long-term damage this procedure might pose to the environment and underground water aquifers. A group of Conway Township residents and the Crossroads Group of the Sierra Club have planned a meeting this Wednesday, Oct. 9, at 7 p.m. at the Conway Township Hall to provide information about fracking and its â&#x20AC;&#x153;potential effects for are families and the environment.â&#x20AC;? The public is urged to attend.

ÂŽ

Safe. Sound. Secure. annuities from Auto-Owners Insurance.

A life well-lived...

'DOODV(QJOLVK

$JHQW

.DWK\5RWK

7LQD'RGVRQ

$JHQW

$JHQW

ZIZKA-GRAND-LOCKWOOD INSURANCE AGENCY Call 223-8352 or 223-8304  &$!*&,%+"&*!""

www.fowlervilleinsurance.com

In 1938 she married her childhood sweetheart. They probably fell in love the ďŹ rst time they met. He proposed on the edge of a frozen pond in the middle of winter. She said yes and for the next 20 years, she took care of his parents, her parents and her children in a small farmhouse. There was never a Great Depression in her home because of her hard work, her unwavering faith in God and her positive nature. Remember the love she gave and let us help you honor a life well-lived.

JK

Niblack Funeral Home LLC 'LOOLQJKDP/LYHUDQFH&KDSHO

 &#*&$+!&*!!0  Scott Niblack, owner/manager www.niblackfuneralhome/com  $! $ 

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 9

Living Happy & Healthy By Dawn Siggett $&( &ertiÂżed Personal Trainer & Group Instructor

Just Breathe! Breathing is important when exercisingâ&#x20AC;Śand forâ&#x20AC;Śwell staying alive. However you would be surprised how many people hold their breath while working out. If I had a nickel for every time I had to tell my class or a client to breatheâ&#x20AC;ŚI would be a very wealthy woman. Here are the in and outs of breathing while exercising. Whether you are walking, running, biking, cycling, or doing any other form of cardiovascular exercise, remember to breathe and to breathe deeply. You can breathe through your nose or mouth or a combination. Whatever is the most comfortable for you. You just need to remember to breathe. When using weights or doing strength training, the most important thing to remember about breathing is to just do it! Never hold your breath. Fitness experts recommend that you exhale on the exertion phase of the exercise and inhale on the easier phase. So when lifting, curling or pushing weight â&#x20AC;&#x201C; exhale. Inhale when you bring the weight back to the starting position. So when working out, have fun and remember to breathe!!! Did You Know: --The word â&#x20AC;&#x153;Aerobicâ&#x20AC;? means: With oxygen. So â&#x20AC;&#x153;Aerobic Exerciseâ&#x20AC;? refers to the use of oxygen to adequately meet energy demands during exercise via aerobic metabolism. --1 gram Fat = 9 calories 1 gram of Alcohol = 7 calories 1 gram of Protein = 4 calories 1 gram Carbohydrate = 4 calories Not only is protein less calories than fat, it is more Âżlling and more satisfying! --Body mass index (BMI) is a measure of body fat based on height and weight, this applies to both adult men and women. BMI is used to screen for weight categories that may lead to health problems. There are many websites that will calculate your BMI, just search â&#x20AC;&#x153;BMIâ&#x20AC;? and many will pop up. There are also free BMI aps for your smart phone. You simply need to put in your height and weight. If your BMI is not where you want it to beâ&#x20AC;Śeating healthy and working out will help correct that! --The American Council on Exercise (ACE) researched the efÂżciecy of the NintendoÂśs Wii Fitâ&#x20AC;Śand the results will surprise you. They found Wii Fit to be a very mild workout, but for those that are just starting a workout program, this experience may be just what you need. The best workout is the one youÂśll actually do and stick with. So if this keeps you coming back for moreâ&#x20AC;Ś.then it is worth the cost. ACE also found that Wii Sports may be a good next step and a better option because the intensity of exercise is a little greater.

%ULDQ%HKQNH#'LFN6FRWWFRP

However, if you have already been exercising regularly, the Wii programs should not be your only workout. --Many studies show that people who exercise regularly beneÂżt with a positive boost in mood and lower rates of depression. When you exercise, your body releases chemicals called endorphins. Endorphins trigger a positive feeling in the body. So if the holidayÂśs get you down, go for a workout and you will feel better! --Research shows that it takes 21 days to make or break a habit. So if you want to start a Âżtness program, try to commit for at least 21 days, hopefully it will become a habit and

your Âżtness program will continue! This also works when trying to eliminate unhealthy foods in your diet. Remove the unhealthy food from your diet for at least 21 days and you will Âżnd that you no longer desire or crave it. 2nce a year I use this practice. I pick one unhealthy food item that has made its way into my diet and I eliminate it for 21 days. It is not always easy, but it does work.

Livingston Catholic Charities holds volunteer training program The Livingston County Catholic Charities (LCCC recently held their semi-annual training for volunteers that work in LCCCÂśs 9olunteer Caregiver Program or at Be 2ur *uest Adult 'ay. Speakers from 9ina and *leaners enlightened volunteers and staff about 9inaÂśs dental services and *leanerÂśs community garden. Suzi Snyder, the Director of Senior Services at LCCC, worked with volunteers and staff to simulate daily living activities with limitations and difÂżculties seniors encounter due to the aging process and medical issues. Some examples â&#x20AC;&#x201C; attendees were asked to wear gloves to simulate decreased sensation in their Âżngers, glasses to simulate diminished vision from cataracts and *laucoma, shoe inserts to simulate difÂżculty walking due to neuropathy or arthritis, and were asked to breathe through a straw to simulate breathing problems. After donning all of the above, attendees were asked to complete a series of tasks: write a number down from the phone book, pick out a speciÂżc color pill from the pill box, button a shirt and walk to the end of the room. 2ne attendee exclaimed, â&#x20AC;&#x153;What an eye-opener!â&#x20AC;? And what an eye-opener it was for everyone in attendance! Many could not complete these common everyday tasks. These basic tasks are important to the senior who wishes to remain independent in their homes for as long as possible. LCCC co-workers and volunteers, along with other community entities, work together to assist seniors in need to preserve their dignity and ability to remain independent in their homes.

Need OfďŹ ce or Computer Supplies?

Master Media Supply is your answer We have supplies for all your ofďŹ ce needs

           

7087 W. Grand River Fowlerville, MI. 48836 www.mastermediasupply.com

517-223-9320

Page 10 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Donna Peddicord, Sam Champagne (Senator Joe Huneâ&#x20AC;&#x2122;s assistant), Louis VanCuyle, and Sunny Westerburb were among the volunteers. Photographs by Linda Dobel

â&#x20AC;&#x2DC;Free Dentalâ&#x20AC;&#x2122; Day at Howell clinic helps over 150 patients

Five area Dentists: Dr. Thomas Kellogg, Dr. Walter Goodell, Dr. Brian Bishop, Dr. Kelly Quinn and Dr. Matt Fulton, together with staff and friends, provided free dental treatment to those in need Saturday, September 21. Patients began arriving as early as 5pm the night before. Over 150 people were in line by the time registration opened at :00am. Patients were seen on a Âżrst Fome, Âżrst served basis. Dr. Kelloggâ&#x20AC;&#x2122;s team and volunteers worked hard to see as many people as possible from 8:00am to 3:00pm and were able to provide 20,000 in donated serviFes. $long with free dental Fare, breakfast, lunFh and live musiF were provided and many pri]es were rafĂ&#x20AC;ed off. The kids enMoyed the Wildwood 5anFh Petting =oo, faFe painting and bounFe house. This yearâ&#x20AC;&#x2122;s event required over 50 volunteers and took about 6 months to plan. â&#x20AC;&#x153;We had many people who were treated last year who volunteered to work this yearâ&#x20AC;&#x2122;s event.â&#x20AC;?

Volunteer Dentists: Dr. Matt Fulton, Dr. Brian Bishop, Dr. Thomas Kellogg, Dr. Walter Goodell, Dr. Kelly Quinn

said Sarah Tottingham, event Foordinator. The response for help is inspiring! Dentistry from the Heart has a history of patients who reFeive treatment staying to help others after getting their needed Fare. The event is in its Âżfth year. /ast yearâ&#x20AC;&#x2122;s donation was over 25,000 of free dentistry. The Âżve year total is over 120,000 and 500 patients served. Dr. Kellogg believes the events response proves that there is a greater need for this type of event. Dental infeFtion is the 1 disease in the world and is responsible for the loss of many lives. People suffer with broken or infeFted teeth Fausing pain that keeps them at home, missing their Fhildrenâ&#x20AC;&#x2122;s events and preventing them from Âżnding employment. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve seen a lot of people who have lost their Mobs and beneÂżts and wanted to help.â&#x20AC;? said Beth Roland, employee of Dr. Kellogg. The Kellogg Team deFided to give baFk what they were really good at: Dental Fare. â&#x20AC;&#x153;, Fhallenge other dentists to do this kind of thing. ,tâ&#x20AC;&#x2122;s great for everybody! ,t is truly the highlight of our year in our ofÂżFe.â&#x20AC;? said Dental Hygienist, BeFky MinFa.

Dr .Kellogg and the Kellogg Dental Team would like to offer speFial thanks to all who donated goods and serviFes to help make the event possible and the enormous generosity of all the volunteers, who give of themselves, serving our Fommunity. For questions about hosting an event like this or about the event itself, Dr. Kellogg Fan be reaFhed at Smilmkr@ sbFglobal.net, 517-546-3330 or visit our website at smilemaker.org. Whatâ&#x20AC;&#x2122;s next: â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re planning to have our annual Free Dental Day eaFh September. Our long term goal is to implement a low or no fee permanent FliniF in the years to Fome in the Howell area.â&#x20AC;? said Dr. Kellogg. â&#x20AC;&#x153;My motivation Fomes from the spirit of my parents, -une and (dward Kellogg, who were avid volunteers and Fommunity aFtivists. My parents ingrained in me to always be thankful and to be generous in giving baFk.â&#x20AC;? http://www.dentistryfromtheheart.org/ www.faFebook.Fom/HowellFreeDentalDay

Knights of Columbus

Fowlerville Council 8605

Polish Oktoberfest

)5(( :,),

Dinner R Dance | Saturday, October 19, 2013

6:00-11:00 p.m.

Brings Families Together

Dinner will be served at 6:00 p.m. Catering by Halina which includes:

Č&#x2C6;Â&#x192;Â&#x2019;Â&#x2014;Â&#x2022;Â&#x2013;Â&#x192;ĆŹÂ&#x2039;Â&#x2021;Â&#x17D;Â&#x201E;Â&#x192;Â&#x2022;Â&#x192; (Sauerkraut and kielbasa) Č&#x2C6; Â&#x2018;Â&#x17D;Â&#x192;Â&#x201E;Â?Â&#x2039;Č&#x2039;Â&#x2022;Â&#x2013;Â&#x2014;Â&#x2C6;Â&#x2C6;Â&#x2021;Â&#x2020;Â&#x2026;Â&#x192;Â&#x201E;Â&#x201E;Â&#x192;Â&#x2030;Â&#x2021;Č&#x152; Č&#x2C6;Â&#x2039;Â&#x2013;Â&#x203A;Â&#x2026;Â&#x160;Â&#x2039;Â&#x2026;Â?Â&#x2021;Â?ÇĄÂ&#x2019;Â&#x2018;Â&#x2013;Â&#x192;Â&#x2013;Â&#x2018;Â&#x2021;Â&#x2022;ĆŹÂ&#x2DC;Â&#x2021;Â&#x2030;Â&#x2021;Â&#x2013;Â&#x192;Â&#x201E;Â&#x17D;Â&#x2021;Â&#x2022; Č&#x2C6;Â&#x192;Â&#x17D;Â&#x192;Â&#x2020;ÇĄÂ&#x201D;Â&#x2018;Â&#x17D;Â&#x17D;Â&#x2022;Â&#x192;Â?Â&#x2020;Â&#x2020;Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2021;Â&#x201D;Â&#x2013; Č&#x2C6;Â&#x2018;Â&#x2C6;Â&#x2C6;Â&#x2021;Â&#x2021;ÇĄÂ&#x2C6;Â&#x201D;Â&#x2014;Â&#x2039;Â&#x2013;Â&#x2020;Â&#x201D;Â&#x2039;Â?Â?Â&#x192;Â?Â&#x2020;Â&#x2026;Â&#x192;Â&#x2022;Â&#x160;Â&#x201E;Â&#x192;Â&#x201D;

Music starts at 7:00 p.m.

ERobert Kolo and the Misty BluesD Ticket Sales limited to 250 dinners

Č&#x2C6;Â&#x2020;Â&#x2014;Â&#x17D;Â&#x2013;Â&#x2022;ÇŚÍ&#x201E;ʹͲǤͲͲ Č&#x2C6;Â&#x160;Â&#x2039;Â&#x17D;Â&#x2020;Â&#x201D;Â&#x2021;Â?Č&#x2039;ͳʹĆŹÂ&#x2014;Â?Â&#x2020;Â&#x2021;Â&#x201D;Č&#x152;ÇŚÍ&#x201E;ͳͲǤͲͲ

Â&#x2013;ǤÂ&#x2030;Â?Â&#x2021;Â&#x2022;Â&#x192;Â&#x201D;Â&#x2039;Â&#x2022;Â&#x160;Â&#x2C6;Ď?Â&#x2039;Â&#x2026;Â&#x2021;Â&#x192;Â&#x2013;͡ͳ͚njʹʹ;njͺ͸ͺ͜ Or Eugene Gierlach at ͡ͳ͚njʹʹ;nj͡͝͝Ͳ

St. Agnes Catholic Church 855 E. Grand River Ave., Fowlerville, MI 48836

Great Food & Friendly Service

)5(( :,),

Open 7 days a week

7:00 AM to 10:00 PM

Featuring Breakfast & Lunch Specials Mon. thru Fri. We serve Breakfast, Lunch and Dinner all day long!

&KHFNRXWRXU1HZ/RFDWLRQ       

    

'LQQHU6SHFLDOV

0RQ 7XHVMeat Loaf :HGPrime Rib 7KXUVPasta Night/BBQ Baked Chicken )ULFour Piece Fish & Chips emade â&#x20AC;&#x153;Homu so psily!â&#x20AC;? 6DW 6XQTurkey Dinner or a BBQ Rib Dinner for two made d

&KHFNRXWRXU/XQFK6SHFLDOV Mon. thru Fri. 11am-4pm

963 South Grand Fowlerville

517-223-1441

5834 Highland Rd Waterford

248-742-1846

$LUSRUW5RDG

0 +LJKODQG5G

Â&#x2039;Â&#x2026;Â?Â&#x2021;Â&#x2013;Â&#x2022;Â&#x192;Â&#x17D;Â&#x2021;Â&#x2022;ĆŹÂ&#x2014;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x2022;Â&#x2026;Â&#x2018;Â?Â&#x2013;Â&#x192;Â&#x2026;Â&#x2013;ÇŁ

     



-

:DWHUIRUG

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 11

Last Chance trout

Not so many years ago I found myself wading a rather remote stream in the middle of the Lower Peninsula. Actually it was the last weekend in September, a time when I usually had temporarily abandoned my interest in trout in favor of a grouse hunt or some late scouting for deer. But it was still nearly a week before bow hunting opened and a day so full of summertime temptations that I couldnâ&#x20AC;&#x2122;t resist time on one of the nicer bodies of water I knew of, not for numbers of Âżsh taken but for sheer beauty. A brilliant sun burned down on browning cattails and a half colored mix of conifers and hardwoods as I slowly moved upstream. With hardly a breeze to stir the vegetation around me, the bubbling stream was almost the only sound on that perfect afternoon. Rarely more than knee deep, there were deeper pools, overhanging banks as well as downed trees, logs, roots and shadows, plenty of cover for the most nervous of trout. During the next hour or so I cast some of the last members of my worm bed along all kinds of likely spots but except for two or three young Âżsh, probably not even of legal size, my efforts were ignored. Still it was a happy day with everything youâ&#x20AC;&#x2122;d want other than trout. And then around a bend came two fellows in a canoe. They were enjoying an early duck season, hoping to jump birds along the stream as they carefully paddled. And then I passed a deer crossing that by the looks of it had been used for years by the concentration of tracks. I began to question my choice of activities. I was still questioning my choices when a solid strike tore the crawler off my hook near an overhanging bank and a tangle of submerged limbs. But try as I did, no follow-

4th Annual Arc of Livingston Expo being held Oct. 17

The 4th Annual Arc of Livingston Expo will be held Thursday, October 17, from 1:00-7:00 p.m. at the 2/42 Community Church, 7526 West Grand River, Brighton. The Arc Expo is a free event where people with disabilities and their family members can have a chance to learn about what resources are available in our community that support their involvement and participation. Key Note Speakers: Michigan Alliance for Families from 1:00 â&#x20AC;&#x201C; 3:00. -- Many area resources, agencies & local businesses available to help enhance and improve quality of life! -- Disability Awareness Information! -- Guest Speakers! -- Engaging activities for children! Follow Us on Facebook for up to date information regarding Arc Expo. Door prizes, family fun, light refreshments, and massages. For more information call the Arc of Livingston at 517546-1228.

Fowlerville Fire Department Report The department responded to 7 emergencies this week. Thursday, Sept. 26, at 8:48 a.m. personnel answered a call to assist EMS on Deacon Hill Road in Iosco Township. At 8:29 p.m., Friday, Sept. 27, a medical emergency on Cedar Road in Handy Township was reported. FireÂżghters were dispatched to a medical emergency on Ann Street in the Village at 9:47 p.m. on Saturday, Sept. 28. Tuesday, October 1, at 4:01 p.m the department responded to a medical emergency on South Grand Avenue in the Village. FireÂżghters were dispatched to an injury accident on Fowlerville Road in Handy Township at 7:47 p.m. Wednesday, Oct. 2, at 2:19 a.m. personnel responded to Chase Lake Road in Conway Township to investigate a Âżre alarm activation in a residence. A second Âżre activation on Nicholson Road in Handy Township was reported at 4:12 a.m.

Fowlerville Garden Club to meet Oct. 9 at VFW Hall

The Fowlerville Garden Club will be meeting on Wednesday, October 9, from 7 to 9.00 p.m. at the VFW Hall. Please join us to listen to our speaker on â&#x20AC;&#x153;Fitness and Gardeningâ&#x20AC;?. Attendees will also be doing a fun fall craft. The meeting is open to everyone, no matter what your skill or knowledge level is. Questions? Contact Nan-Marie Fox @ 517-230-8084.

up action occurred. I spent some time working the spot and Âżnally vowing to carefully Âżsh the place again on my way back down to my truck. But Iâ&#x20AC;&#x2122;d spent too much time trying for what I assumed to be a fairly nice brown trout. Even as I pulled away and continued to think about the Âżsh, I had failed to notice that the sun had all but abandoned the sky and I was some distance from my truck. And I didnâ&#x20AC;&#x2122;t even have a Ă&#x20AC;ashlight. Still reluctant to quit Âżshing after Âżnally having some action, I again lost track of the time until it was clear I couldnâ&#x20AC;&#x2122;t get back before dark. Stumble/splashing back downstream against the fading light; I was determined to at least reach the place where Iâ&#x20AC;&#x2122;d had the solid strike earlier. It was getting so that only the tree line against the sky was giving me much real information as to where I was in the stream. Sudden encounters with submerged logs, rocks and holes reminded me of my situation and I had to slow down. But just as I began to think of giving up on Âżnding the trout hole, I found it. Checking my bait as best I could and reaching into my memory bank for as much information as possible, I tossed my lure toward what I hoped was the center of the pool. It was met by a solid strike and a hook-up. In the near blackness of the river a good Âżsh swirled and tugged against my line, daring me to let him run. But I lifted my rod tip and at the same time, netted the barely visible splash in front of me. Then I carefully slipped a Âżnger into the gill and unhooked the squirming trout into my creel. And then, amazingly, repeated the sequence on a second Âżsh. I hadnâ&#x20AC;&#x2122;t seen either, remember. At the truck Âżnally, and in the glow of a headlight, I discovered, not two Âżne brown trout but a pair of nearly 14 inch brookies. Last chance trout indeed.

 

/,1'$&:$/.(5

  

 

5(%(&&$$52%(576



  

204 E. GRAND RIVER FOWLERVILLE

 6HUYLQJ)RZOHUYLOOHIRU2YHU<HDUV General Practice Including But Not Limited To: +%&&!!!

+""!%%

+ * )

+$ ! &&$%

+"&%

+("$

+$"!'&

+

+$%"! !'$*

+"'$&* %

$&"! )

+!$'#&*

2YHU<HDUV&RPELQHG([SHULHQFH OLQGDZDONHUDWW\#VEFJOREDOQHW UHEHFFDUREHUWVDWW\#VEFJOREDOQHW

1RZ$FFHSWLQJ0DVWHU&DUG 9LVD :HHNHQG (YHQLQJV$YDLODEOHE\$SSRLQWPHQW

Page 12 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Cleary University to celebrate 130th anniversary with special events

VILLAGE OF FOWLERVILLE VILLAGE COUNCIL MEETING MINUTES SYNOPSIS MONDAY, SEPTEMBER 9, 2013 The Regular Village of Fowlerville Council Meeting was called to order by President Copeland at 7:30 p.m., in the Council Chambers. Trustees present: Bell, Helfmann, Hill, Kuehn Salfate and Stock. Absent: None. Also present: Village Clerk, Kathryn Arledge, Chief of Police, Thomas Couling and Village Attorney, Richard McNulty. TO ADD ITEM # 10 Discussion of the railings on Collins Street and add item # 11. Discussion of the Construction Project on North Grand Avenue AND APPROVE THE AGENDA, AS AMENDED. MOTION CARRIED. TO APPROVE THE CONSENT AGENDA CONSISTING OF ITEMS 6.a. THROUGH 6.f., AS PRESENTED. MOTION CARRIED. TO BRING THIS ITEM OFF THE TABLE FOR DISCUSSION. MOTION CARRIED. TO CONTINUE TO REMAIN AS IS, AND NOT AMEND THE CURRENT ORDINANCE. ROLL CALL VOTE. AYES: BELL, STOCK, HELFMANN, HILL, KUEHN, SALFATE AND COPELAND. NAYES: NONE. UNANIMOUS VOTE. MOTION CARRIED. TO APPROVE TRAFFIC CONTROL ORDER #13-018, AN ORDER TO ESTABLISH NO PARKING ANYTIME ON NORTH HIBBARD STREET FROM FOWLERVILLE SCHOOL PROPERTY TO NORTH STREET ON THE WEST SIDE OF THE STREET. ROLL CALL VOTE. SALFATE, HILL, STOCK, KUEHN, HELFMANN BELL AND COPELAND. NAYES: NONE. UNANIMOUS VOTE. MOTION CARRIED. MOTION HILL, SECOND KUEHN, TO APPROVE RESOLUTION NO. 13-25, A RESOLUTION APPROVING PERSONNEL ACTION REQUEST REGARDING KIM LOOSE. ROLL CALL VOTE. AYES: HILL, KUEHN, STOCK AND COPELAND. NAYES: BELL, HELFMANN AND SALFATE. MOTION CARRIED. TO NOT AMEND THE CURRENT ORDINANCE NO. 435, REGARDING THE PLANNING COMMISSION MEMBERSHIP, THEREFORE THE ORDINANCE WILL REMAIN AS IS. ADVERTISE AND ACCEPT APPLICATIONS FOR THE PLANNING COMMISSIONER VACANCY. ROLL CALL VOTE. AYES: BELL, STOCK, HELFMANN, HILL, KUEHN, SALFATE AND COPELAND. NAYES: NONE. UNANIMOUS VOTE. MOTION CARRIED. TO INSTALL RAILINGS ON BOTH SIDES OF COLLINS STREET FOR AN AMOUNT NOT TO EXCEED $10,000.00. ROLL CALL VOTE. AYES: KUEHN, SALFATE, STOCK, HILL, HELFMANN AND BELL. NAYES: COPELAND. MOTION CARRIED. TO APPROVE THE REVENUE REPORT FOR THE PERIOD OF AUGUST 22 THROUGH SEPTEMBER 5, 2013, AS PRESENTED. UNANIMOUS VOTE. MOTION CARRIED. TO APPROVE AND PAY THE EXPENDITURES FOR THE PERIOD OF AUGUST 27 THROUGH SEPTEMBER 9, 2013. MOTION CARRIED. TO ADJOURN THE MEETING AT 8:40 P.M., MOTION CARRIED. Kathryn Arledge Clerk

Cleary University is celebrating its 130th anniversary Oct. 10-13 and the party at the Howell campus includes something for just about everyone. Events include: an Entrepreneurâ&#x20AC;&#x2122;s Forum featuring local business leaders, the Livingston Economic Club Luncheon, a community-wide picnic, intercollegiate athletics, a disc golf tournament and the dedication of a new mural by a worldrenown Michigan artist. â&#x20AC;&#x153;Cleary University is proud of its rich history and strong educational tradition,â&#x20AC;? said Thomas Sullivan, president of Cleary. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think most people realize that Cleary has been around for 130 years. This is our way of celebrating our history and provides an introduction for those who may not know us.â&#x20AC;? Some events are ticketed and some are free. All events are open to the public. The Entrepreneurâ&#x20AC;&#x2122;s Forum kicks off Founderâ&#x20AC;&#x2122;s Week Oct. 10 at the Johnson Center. â&#x20AC;&#x153;The Entrepreneurâ&#x20AC;&#x2122;s Forum is designed to share 21st century relevant information about what it takes to be successful as an entrepreneur in the region,â&#x20AC;? said Stewart Brannen, director of Cleary Universityâ&#x20AC;&#x2122;s Center for Innovation and Entrepreneuship. Topics that will be covered include: The habits of highly successful entrepreneurs, visionary thinking, â&#x20AC;&#x153;Food, Mood and Cognition,â&#x20AC;? professional branding and strategic decision making. The keynote speaker for the day is photographer and World War II author Robert H. Miller. Miller wrote â&#x20AC;&#x153;Hidden Hell: The Story of My Fatherâ&#x20AC;&#x2122;s POW Diary.â&#x20AC;? He co-authored â&#x20AC;&#x153;Portraits of Service.â&#x20AC;? Both books will be available for purchase and Miller will sign them. The event is sponsored by The Livingston Economic Club. For tickets, visit http:// www.cleary.edu/tickets/ or call 517-586-3002. Intercollegiate athletics will be featured as well. The Cleary University Golf Tri-Match is Friday, Oct. 11 at Chemung Hills in Howell and the Cleary University menâ&#x20AC;&#x2122;s soccer team closes out its inaugural season Saturday, Oct. 12 against Lawrence Tech at Page Field at 10 a.m. Both events are free. Following the soccer game there will be a free communitywide picnic at the Johnson Center on the Livingston Campus from noon to 4 p.m. The picnic features free food, a hayride, games and dancing. The Cleary University Alumni Association will rafĂ&#x20AC;e a time-share in Cancun, Me[ico. The Cleary Student Veterans Association will host a disc golf tournament at 2 p.m. on the Cleary University course. Entry is 5 and the top three Âżnishers win a cash prize. E-mail Brian Hoch at bhoch@cleary.edu to register. The grand opening of the Arthur Secunda Museum at Cleary University concludes Founderâ&#x20AC;&#x2122;s Week activities, Sunday, Oct. 13 at 2 p.m. at the Johnson Center. Arthur Secunda is scheduled to attend and speak. The celebration of the museumâ&#x20AC;&#x2122;s grand opening will include the conveyance of the NASA gift â&#x20AC;&#x153;Earth from Space,â&#x20AC;? along with more than 40 additional pieces to the museumâ&#x20AC;&#x2122;s collection. For information about Founderâ&#x20AC;&#x2122;s Week, visit CLEARY. EDU/community/Founder-Week. Cleary University (cleary.edu) is an independent, notfor-proÂżt, multi-campus, specialized business university, committed to the betterment of society through the success of its alumni and their employers; to operate as a role model of responsible business practice; to embrace quality management principles, innovation, and an attentive customer focus; and to aspire to a better future. Clearyâ&#x20AC;&#x2122;s mission is to provide a practical, application-based education, which equips students to advance their careers.

â&#x20AC;&#x2DC;Headless Horsemanâ&#x20AC;&#x2122; 5-K/10K Run being held Oct. 26 in Howell

The 5th Annual Headless Horseman 5K/10K is ready to get everyone into the Halloween spirit. With nearly 1400 runners participating last year, you will not want to miss this event! We encourage everyone to get into the spirit of the season in Sleepy Howell by participating in the Headless Horseman 5K/10K, a costumed run walk on Saturday, Oct. 26, beginning at 7:30 p.m. Run Ichabod, Run!!! The headless Horseman 5K/10K will start and Âżnish near State Street in Downtown Howell. All runners are encouraged to dress up in costume and run as their favorite Halloween character. Late registrations, post race awards, and refreshments will all be held on State Street. Awards will go to overall menâ&#x20AC;&#x2122;s, womenâ&#x20AC;&#x2122;s, and Masters. Age group awards to the top three places in each menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s group in the 5K/10K: 10 and under / 11-12 / 13-14 / 15-18 / 19-24 / 25-29 / 30-34 / 35-39 / 40-44 / 45-49 / 50-54 / 55-59 / 60-64 / 65-69 / 70+. All early registrants will receive a race packet and long sleeve soft tech shirt. Late registrants are not guaranteed a shirt. Deadline to register before late fee is added is October 24 at 11:59pm. Pre-registration price is $25 per person. Price increases to $30 per person the day of the event. Race starts and ends in Downtown Howell at the corner of Clinton and State streets. For more information, or to register, please contact the Howell Area Parks & Recreation Authority at 517/546-0693 e[t. 0 or visit www.howellrecreation.org.

7999 Mason Rd. at S. Fowlerville Rd., Fowlerville

' # 

!   '  " '$ "! ' '  " '  ' ! '% '&  (#

Fresh Coffee & Cappuccino Summer Hours :LQWHU+RXUV SUMMER HOURS: Mon thru Sat: 0RQ7KXUDPWRSP Mon.-Sat. 6:30-10 )UL 6DWDPWRSP 6:30am-10pm Sunday 8-9 6XQGD\DPWRSP Sun: 8am-9pm

(517) 223-9178

Fowlerville varsity soccer team loses close match to Jackson Northwest The Fowlerville varsity soccer team was defeated in a hard fought match by Jackson Northwest 2 â&#x20AC;&#x201C; 1 at the Gladiator Âżeld. Despite being down 2 - 0, Fowlerville battled back and Ale[ Montrose headed in the lone goal after colliding with the Northwest goalkeeper to score his Âżrst goal of the season. The goal was assisted by a cross from Nick Wanczyk. The Gladiators continued to Âżght and almost scored an equalizer with 10 seconds left in the game. The Gladiator defense of Riley Swails, Bailey Edwards, Mitch Frederick, Ryan Gross, and Josh Copeland played a terriÂżc game and limited the Mounties to relatively few scoring opportunities. Will Massey played his Âżrst game at forward and had a terriÂżc outing. Jacob Jarvis was in net for the Gladiators and made numerous e[cellent saves throughout the night Records: Jackson Northwest: 9 - 2 - 4 (3 - 1 - 2 league) Fowlerville: 0 - 11 - 2 (0 - 5 league)

DEEP LASER THERAPY NOW OFFERED WE OFFER MANY TYPES OF ADJUSTMENTS INCLUDING IMPULSE INSTRUMENT ADJUSTMENT

 Deep-Tissue laser therapy

Page 14 - Fowlerville News & Views - Sunday, October 6, 2013

Prices effective Sun., Oct. 6 through Sat. Oct. 12, 2013

OPEN 7 DAYS A WEEK Monday - Saturday 7:00 a.m. to 8:00 p.m. Sunday 8:00 a.m. to 5:00 p.m.

• Rug Doctor • Coffee Bar • Propane • ATM • Produce • Full Service Meat • Deli • Bakery

We Accept:

PHONE

517-223-8822

Fowlerville, MI U.S.D.A. CERTIFIED 95% LEAN

NATURAL CHOICE BONE-IN ASSORTED

FRESH GROUND ROUND Family ck

3

Pa

curtisgrocerystore.com

PORK CHOPS

1

$ 49 BONE-IN

CENTER CUT PORK CHOPS

2

STAR RANCH BONELESS

SPARE RIBS

1

$ 99

LB.

2

2

2

LB.

2

DAIRY FRESH

LONGHORN CHEESE

3

ALL VARIETIES

$

99 LB.

Save

49

$ SEAFOOD 1.0 0 ..................... SALAD . . . . . . . . . . . . . . . . . . .LB. SICILIAN

Save

PASTA 70¢ SALAD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .LB.. . . . . . . . . CAROLINA OVEN ROASTED OR

Save

¢ SMOKED . .LB. ......... TURKEY . . . . . . . . . . . . . . . . . . . . . . . . . 50 Save

1.00

$

4 $ 99 4 $ 29 4 $ 19 2

Save $ SMOKED $ 0 HAM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.0 . . .LB. .........

OLD TYME BROWN SUGAR OR

7

2/$

LB.

Sandwich of the Week

BURT’S SPECIAL

LB.

LB.

LB.

LB.

HALF GRINDER

4 $ 99 7 $ 49 4 $ 49

+ TAX WHOLE GRINDER

1 LB. PKG.

3

PRODUCE

RYE BREAD

1

$ 99

1 $ 79 1 $ 49 4 ¢ 89 8.99

$ SOURDOUGH BREAD . . . . . . . . . . . . . . . . . . . . . . . . 12 COUNT

SNOWFLAKE DINNER ROLLS. . . . . . . . 8X8

PUMPKIN BARS

W/CREAM CHEESE ICING . . . . . . . . . . . . . . . . . . . . . . . . . . .

PUMPKIN DONUTS . . . . . . . . . . . . . . . . . . .

DOZEN . . . . . . . . . . . . . . . . . . . . . .

$

99

SLICED BACON

2

CALIFORNIA RED OR GREEN SEEDLESS

GRAPES

$ 49

APPLES

MACS, JONATHAN, DELICIOUS, EMPIRE, CORTLAND, GALA 3 LB. BAG

5

2/$

LB.

+ TAX SUB OR WRAP

TASTEE CARAMEL APPLES

3 CT. PKG.. . . . . . . . . . . . . . . . . . . . . . . . . FRESH

HYDROPONIC TOMATOES . . . . . . . . . . . . . . . . FRESH HEADS

CELLO CAULIFLOWER . . . . . . . . . FRESH

SLICING CUCUMBERS . . . . . . . . . . . . . PORTABELLA CAPS OR SLICED MUSHROOMS 6 OZ. PKG. . . . . . . . . . . . . . . . . . . . . . . . .

5 $ 29 1 2/$ 5 2/$ 1 2/$ 5 2/$

LB.

$ 99

LB.

MICHIGAN

+ TAX

BAKERY

BIG BUY

$ 49

LB.

1

13.5 OZ. PKG.

BREAKFAST SAUSAGE

$ 69

LB.

LB.

SMOKED SAUSAGE

HOMEMADE

BONELESS HAMS

$ 49 DELI

2

$ 99

$ 99

CUMBERLAND GAP WHOLE OR HALF

SMOKED PICNICS

ENGLISH CHUCK STEAKS

JOHNSONVILLE

BOLOGNA OR SALAMI

$ 99

LB.

STAR RANCH CHOICE ANGUS BONELESS

LB.

OSCAR MAYER LUNCH MEAT

STEW BEEF

1

$ 99

LB.

$ 39

LB.

COOK’S

Family Pack

COUNTRY STYLE

LOIN END ROAST

$ 49

CHICKEN BREASTS

$ 99

LB.

BONE-IN CENTER CUT

2

GRADE A BONELESS

1 LB. PKG.

MICHIGAN

RUSSET POTATOES 10 LB. BAG

2

$

99

Fowlerville News & Views - Sunday, October 6, 2013 - Page 15

DAIRY

PARKAY SPREAD QUARTERS

PRAIRIE FARMS QUARTS

PRAIRIE FARMS COTTAGE CHEESE

MILK OR ORANGE JUICE

5

CRYSTAL FARMS SOFT CREAM CHEESE 8 OZ. TUB . . . . PILLSBURY SWEET ROLLS

ORANGE JUICE 59 OZ.

2

8 OZ. PKG. . . . . . . . . . . . . . . . . . . . . . . . .

KRAFT AMERICAN SAVE MORE SINGLES WITH

CRYSTAL FARMS

DAVID’S DELI BAGELS 14.2 - 14.25 OZ.

12 OZ., P.P. $2.99 . . . . . . . . . . . COUPON! ........

PRAIRIE FARMS UNSWEET TEA GALLON. . . . . . .

1

$ 39

YOPLAIT YOGURT 4 - 6 OZ. . . . . . . . . . . . . .

KELLOGG’S CEREAL

2

12.4 - 13.9 OZ. . . .

KRAFT CHUNK OR SHREDDED SAVE MORE WITH CHEESE COUPON!

99

$ 99

BARILLA

PASTA

1

12 - 16 OZ.

$ 29

GENERAL MILLS CEREAL 12.8 OZ. MULTI-GRAIN CHEERIOS, 14 OZ. CHEERIOS, 12.2 OZ. CINNAMON TOAST CRUNCH, 10.6 OZ. TOTAL

EXCLUDES LASAGNA & MANICOTTI

5

2/$

SAVE MORE WITH COUPON!

SAVE MORE WITH COUPON!

KRAFT

DELUXE OR VELVEETA DINNERS

2

BETTY CROCKER PREMIUM

BROWNIES OR COOKIE BARS

9.4 - 14 OZ.

$ 69 SAVE MORE WITH COUPON!

SHURFINE

SYRUP

1

24 OZ. BTL.

$ 99

4

2/$

FRUIT SNACKS, ROLL-UPS, FRUIT BY THE FOOT OR GUSHERS

5

2/$

16

PLUS TAX & DEP.

PETER PAN

PEANUT BUTTER 3 PACK, 16.3 OZ.

6

$ 99 HUNT’S SNACK PACK PUDDING OR GELS 4 COUNT

1

$ 19

2

$

TIDE

LAUNDRY DETERGENT 100 OZ. LIQUID OR 95 OZ. POWDER

12

99

FRITO LAY

DORITOS

6

2/$

99

PLUS TAX & DEP.

2

$ 19 HUNT’S TOMATOES 14.5 OZ.

1

$ 19

LEAN CUISINE

10

5/$

SAVE MORE WITH COUPON!

10 - 16 OZ. . . . . . . . . . . . . . . . . . . . . . . . .

GREEN GIANT STEAMERS

2

11 - 12 OZ. . . . . . . . . . . . . . . . . . . . . . . . . .

$ 99

DOVE, M&M, TWIX, SNICKERS, MILKY WAY ICE CREAM TREATS . . . . . .

PRAIRIE FARMS

ICE CREAM OR SHERBET HALF GALLONS

MARIE CALLENDAR’S PIES

28 - 45 OZ. . . . . . . . . . . . . . . . . . . . . . . . .

6

INNOVASIAN CUISINE

12 - 18 OZ. . . . . . . . . . . . . . . . . . . . . . . . .

KRAFT

MAYO

2

KRAFT

$ 49

SAVE MORE WITH COUPON!

SAVE MORE WITH COUPON!

POST CEREAL

15 - 20 OZ. SHREDDED WHEAT, 18 OZ. GRAPE NUT FLAKES, 16 OZ. BRAN FLAKES, 24 OZ. GRAPE NUTS

FIORA

BATH TISSUE 1 PLY 12 PACK

5

$ 99

$ 59 BOUNTY

8 ROLL

PAPER TOWELS CHARMIN OR 9 ROLL MEGA OR 18 ROLL PKG.

9

KRAUT

17 - 18 OZ.

$ 99

2

FRANK’S

BBQ SAUCE

1

30 OZ.

$ 99 LAY’S

BAKED SNACKS OR ROLD GOLD PRETZELS 6 - 16 OZ. P.P. $3.29

5

2/$

PROGRESSO

SOUP

DRESSING

2

NEW YORK GARLIC BREADS, STICKS, TEXAS TOAST OR KNOTS

POTATOES OR ONION RINGS 16 - 32 OZ.

2/$

2 5 $ 99 2 $ 79 1 2/$ 7 $ 99 5 $ 99 5

17.4 - 19.8 OZ. . . . . . . . . . . . . . . . . . . . . . .

ORE IDA

16 OZ.

$ 69

KELLOGG’S EGGO WAFFLES, DRIZZLERS, $ 49 WAFFLERS, OR PANCAKES . . . . . . . . . . . . . TOTINO’S PIZZERIA 2/$ OR PIZZA ROLLS

STOUFFER’S

WESTERN OR WISHBONE

BUSH’S BEST

BAKED OR GRILLIN’ BEANS 21 - 28 OZ.

SAVE MORE WITH COUPON!

10 - 11 OZ. P.P. $4.29

24 PACK CANS

FROZEN

5 - 9 OZ.

$

5 - 8 OZ. PKG.

15

99

GRANOLA BARS

MOTTS & BETTY CROCKER

LABATT BLUE OR BLUE LIGHT

$

NATURE VALLEY OR FIBER ONE

$ 69

16.5 - 19.5 OZ.

PABST BLUE RIBBON 30 PACK CANS

$

12 - 16 OZ. . . . . . . . . . . . . . . . . . . . . . . . . .

MINUTE MAID

12 OZ. APPLE JACKS, 12.5 OZ. CORN POPS, 15.5 OZ. COCOA KRISPIES, 14.7 - 15 OZ. FROSTED FLAKES, 10.5 - 12.7 OZ. FROOT LOOPS, 12 OZ. RICE KRISPIES, 15.3 OZ. HONEY SMACKS

24 OZ. . .

DEAN’S DIPS

4/$

$

5 29 2 $ 69 1 $ 69 1 2/$ 4 $ 49 2 $ 49 2 $ 99 2 10/$ 6

1 LB. BOX OR 13 OZ. BOWL . . . . . . . . . . . .

4/$

10

18 - 19 OZ.

8/$

SAVE MORE WITH COUPON!

7•UP, VERNORS, A&W, DR. PEPPER, SQUIRT, SUNKIST

99

14 OZ. CAN

¢

HTEL ROH

TOMATOES

5

10 OZ.

4/$

MAGNERS

HARD CIDER 4 OR 6 PACKS

1 OFF

12 PACK CANS

$ 00

PLUS DEP.

REGULAR PRICE

14

4/$

AUNT MILLIE’S FAMILY STYLE

BREADS

3

20 - 24 OZ.

2/$

KELLOGG’S

POP TARTS

KEEBLER

6.6 OZ. FUDGE STICKS, 6 - 15 OZ. FUDGE SHOPPE OR E.L. FUDGE, 12 OZ. VANILLA WAFERS, 10 - 15 OZ. DELUXE OR SANDIES COOKIES, 13 OZ. ANIMAL COOKIES

2

$ 50

SAVE MORE WITH COUPON!

COCA COLA

12 PK. CANS OR 8 PK. / 12 OZ. BTLS.

22 OZ. 12 CT. PKG.

2

$ 99 SAVE MORE WITH COUPON!

12

3/$

PLUS DEP.

SAVE MORE WITH COUPON!

HERSHEY BAKING CHIPS

EXPIRES 10/12/13

8 - 12 OZ.

5

2/$

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13 EXPIRES 10/12/13

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13

GOOD ONLY AT PARTICIPATING AFFILIATED FOODS STORES THRU 10/12/13

NOT RESPONSIBLE FOR TYPOGRAPHICAL ERRORS. STORE HAS RIGHT TO LIMIT QUANTITIES.

Page 16 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Fowlerville Homecoming Queen candidates

and one of the King candidates were getting ready to ride in the parade on Friday, Sept. 27. From left are Shauna Holiday, Tresa Brake, Nicholas Keller, Lea Faulkner (who was later crowned as Queen), and Molly Hutchinson.

The Class Representatives on the Homecoming court are, from left, sophomores Riley McGuire and Michael Scott, juniors Marissa Leonard and Tyler Burkhardt, and freshmen Kristen Burkhardt and Tommy Quaine.

This yearâ&#x20AC;&#x2122;s Foreign Exchange Students enjoyed the Homecoming Parade, Game and Dance. (L to R): Hikari Ban from Japan, Pedro Rutino from Spain, Chaewon Kim, Republic of Korea. (Photo by Deb Utter)

The crown bearers and last yearâ&#x20AC;&#x2122;s King and Queen were on hand for the parade and the halftime ceremony. From left, are McKayla HatÂżeld, Owen Smith, Gavin McGregor, Megan Christoson, Kody Sweet, and Clara Johnson.

STAY WARM WITH OUR

GREAT DEALS!

Schedule your appointment online at

www.Ă&#x201E;_yourfurnace.com

Follow us on Twitter!

DHEATING DAIR CONDITIONING DMAINTENANCE

facebook.com/AccuTempHeating

$98

@Accu_Temp

Like us on Facebook!

* Precision

Gas Furnace Tune-Up

$159

*

These members of the Fowlerville High School class of 1963, who held their 50th class reunion this past June, got together again for a tailgate party at the homecoming football game.

.

Â&#x2021;&KHFN,JQLWLRQ6\VWHP )ODPH6DIHW\ Gas Precision Tune-Up Â&#x2021;&KHFN*DV3UHVVXUHÂ&#x2021;&KHFN$OO6DIHWLHV on 2 Gas Furnaces at the Â&#x2021;,QVSHFW+HDW([FKDQJHU %XUQHUVÂ&#x2021;&OHDQ &RQGHQVDWH'UDLQVÂ&#x2021;&KHFN2SHUDWLRQ Same Address &RPEXVWLRQ(IĂ&#x20AC;FLHQF\7HVWLQJ *Excludes oil boilers and oil furnaces. Not valid with any other offer. Coupon must be presented *Not valid with any other offer. at time of service. Equipment must be in Coupon must be presented at time of service. operating order. Prior sales excluded. Equipment must be in operating order. Expires 10/31/2013 Prior sales excluded. Expires 10-31-2013.

$195

*

Oil Furnace Precision Tune-Up

Â&#x2021; &lean +eat ([chanJer Flue Pipe Zith 9acuum Â&#x2021; 5eplace 1o]]le Oil Filter Â&#x2021; &lean (lectrodes Â&#x2021; &hecN +eat ([chanJer Â&#x2021; &omEustion (IÂżcienc\ TestinJ Â&#x2021; Up to   +ours /aEor

*Not valid with any other offer. Coupon must be presented at time of service. Equipment must be in operating order. Prior sales excluded. Expires 10-31-2013.

SPECIAL SAVINGS!

$20 OFF

*

',$*1267,&)(( :,7+5(3$,5

*Coupon must be presented at time of service. Not valid with any other offers. Prior sales excluded. Valid only with repair. Expires 10/31/2013.

$7 OFF

&8/9(5(;&$9$7,1*,1&

*

$1<$35,/$,5( 25/(112;0(',$ ),/7(5

6DQG *UDYHOÂ&#x2021;6FUHHQHG7RSVRLOÂ&#x2021;/LPHVWRQHÂ&#x2021;&UXVKHG  'HFRUDWLYH6WRQHÂ&#x2021;'ULYHZD\5HSDLUVÂ&#x2021;'HPROLWLRQ:RUN

*Pick up counter sales only. Expires 10/31/2013.

$1<$35,/$,5(25 /(112;+80,',),(5 :$7(53$1(/

BUY 1, GET THE 2ND 1/2 PRICE!* *Pick up counter sales only. Expires 10/31/2013.

 Howell

517-548-1555 Fowlerville 517-223-3700 £änxĂ&#x160;Ă&#x20AC;>Â&#x2DC;`Ă&#x160;">Â&#x17D;Ă&#x192;Ă&#x160; Ă&#x20AC;Â&#x2C6;Ă&#x203A;iĂ&#x160;UĂ&#x160;-Ă&#x2022;Â&#x2C6;Ă&#x152;iĂ&#x160;£ää Howell, MI 48843 We accept the following:

:HEEHUYLOOH

 +RZHOO

Fowlerville News & Views – Sunday, October 6, 2013 – Page 17

Smith Elementary School News

Ron and Helen House celebrate 50 years of marriage

Congratulations to Ron and Helen House, who are celebrating 50 years of marriage on October 12, 2013. They were married at the Webberville Methodist Church. They have three children: Teresa House, Scott (Kelly) House and Brenda House. Grandchildren include: Rebecca and Emily House and Jordon and Brenden Gorski.

Men’s Basketball starts later this month in Howell

The Men’s Basketball leagues start later this month. 30 & Over will be played on Fridays from Oct. 18 to March 21– 6:30pm-10:00pm 18 & Over will be played on Saturdays from Oct. 19 to March 15-- 9:00am-12:00pm Are you ready for the upcoming basketball season? Gather up your friends, family, and co-workers and get a team registered for this league! Season will consist of 10 games and the end of the year playoffs. Winning team after playoffs will receive an automatic bid into the MRPA State Tournament to be held in March. Fees include a $225 team fee, a $40 forfeit fee (fully refundable if team does not forfeit), and players fees ($25 for residents of the City of Howell, Oceola, Genoa, and Marion Townships and $50 for non-residents). For more information, or to register, please contact the Howell Area Parks & Recreation Authority at 517/546-0693 ext. 0 or visit www.howellrecreation.org.

Plain¿eld United Methodist serving chicken supper on Oct. 19

A Chicken and Biscuit Supper will be served at the Plain¿eld United Methodist Church, 17845 M-36, north of Gregory, starting at 5 p.m. Free will donation. Take outs available. Public invited.

IMPORTANT DATES: October 7- Fundraiser Sales End (Orders & Money Due) October 9-PTC Meeting – 3:45 October 29 – Student Picture Re-Take Day October 31- Halloween Parade (Parade Begins at 1:15 pm) November 4, 5 & 6 – Vision Screening For 1st Grade November 6 – Full Regular Day of School – Conferences Evening Only November 6 – Parent/Teacher Conferences (5-7:30 pm) November 7 - ½ Day of School – Conferences Afternoon & Evening (Dismissal Time 12:18) November 7 – Parent/Teacher Conferences (1-4 & 5-7:30 pm) November 12, 13, 14, 15 & 18 – Hearing Screening For K & 2nd Grade *** Attention parents of students who ride Fowlerville school buses: please note that bus drop-off times will be approximately 5-10 minutes later than usual for most students who live south of Grand River Avenue (the center of town). Beginning Monday, the intersection of Grand River and Grand Street will be closed for two to four weeks. The alternate routing caused by the construction and detour will result in delayed drop-offs. Pick-up times should remain fairly consistent. Thank you for your understanding throughout this construction project! *** Lost & Found- Last year Smith Elementary made 2 LARGE donations to local charities of items found around the school. We prefer that all lost items be returned to their owners! Currently we have one small basket of lost things on the wooden bench in the entryway of the building. If the stack grows, it will be moved to the back of the cafeteria. There is some very nice clothing in there but we have no idea who it belongs to. Write your child’s name on their belongings: extra shoes, hats, sweatshirts, jackets, etc. *** Concussion Law - Parents must sign & return the sheet indicating they have read the Concussion Law information. Without your signature, your child may have to sit out of PE class. *** Volunteers: If you are planning to help in the classroom, attend ¿eld trips, or have lunch in the cafeteria, you must complete the Volunteer Application and be approved through a background check. The sooner you complete the application, the sooner you can be added to the list. It currently takes about 3 weeks for the process. Thank you for your patience and understanding in the meantime.

it is not your child’s scheduled year for screening. --You do not want your child screened. Please call the Health Department if: --Your child has a programmable shunt. Call (517) 546-9850 and ask for the Hearing & Vision Coordinator. *** PLEASE TAKE NOTE OF RECENT CHANGES TO THE VG’S COMMUNITY REWARDS PROGRAM. SEE INFORMATION BELOW. The Community Share program will become the Cash for Class program on September 1, 2013. Purchases you make with your “yes” card will automatically be added to our school’s account. At the end of March 2014, our school will receive a rebate check based on the percentage of all of our member’s purchases. Individuals need to connect their “yes” card to our school so we can continue to earn money. Go to www.myyesrewards.com to link your card. You only have to link your “yes” card once plus you’ll have the convenience of not having to save your receipts. Once you link your card – it will automatically calculate the rebate for our school. THANK YOU! *** YES! WE COLLECT BOXTOPS! Help us keep the BoxTop trophy here at Smith! Snip and trim the BoxTops for Education off of designated products and send them to school. We collect them each Friday for our Fabulous PTC Volunteers to count!!! Thank you ALL for your help with this. *** HELP US HELP OUR SCHOOL THROUGH TARGET There is an easy way to help us raise money for our school. It’s called Take Charge of Education. Here’s how it works: Visit Target.com/tcoe or call 1-800-316-6142 to designate our school, then use your REDcard whenever you shop. When you use your REDcard (Target Credit Card, Target Debit Card or Target Visa Credit Card), Target will donate up to 1% of your purchases to our school. Learn more at Target. com/redcard or stop in a Target store to apply. Thank You For All You Do For H.T. Smith Elementary!

Ballroom Dancing being offered by Howell Recreation Oct. 9-Nov. 3 Ballroom Dancing will be offered from Wednesday October 9 to Wednesday, November 13 from7:00 pm-9:00 pm This class will teach students how to lead and follow, learn timing to music, and dance the basic waltz, fox trot, swing, Latin dance, rumba, Cha Cha, tango, and mumba! At the end of the course, you’ll learn basic steps in all dances mentioned plus some new steps to help you dance with a style ¿nesse. You can sign up as a single or couple. High school students are welcome! Get ready for your next wedding or party! Cost is $60 for residents of the City of Howell, Oceola, Genoa, and Marion Townships and $120 for non-residents. Class is held at the Bennett Recreation Center located at 925 W. Grand River in Howell. For more information, or to register, please contact the Howell Area Parks & Recreation Authority at 517 546- 0693 extension 0 or visit www. howellrecreation.org.

Vision Screening for 1st Grade - Vision Screening will be held November 4th & 5th with Re-Screenings on November 6th. Please call the School if: --You have a concern and it is not your child’s scheduled year for screening. --You do not want your child screened. *** Hearing Screening for K & 2nd Grade – Hearing Screening will be held November 12, 13, 14, 15 & 18th. ReGuaranteed Installation Screenings will be on th I`3VJHS*LY[PÄLK0UZ[HSSLYZ December 2, 3, 4, 5 & 9 . Please call the School if: --You have a concern and

211 N. Grand, Fowlerville 1 block north of Grand River (JYVZZMYVT[OLÄYLZ[H[PVU

517-223-9231 Free Estimates

HUGE YEAR END SALE

NELSON’S MECHANICAL Offers:

‡*HQHUDO$XWRPRWLYH5HSDLU ‡%UDNHV ‡6XVSHQVLRQ $OLJQPHQWV ‡(OHFWULFDO ‡1HZ&DU0DLQWHQDQFH ‡7LUHV ‡$6(&HUWLÀHG7HFKQLFLDQV

Hours: Mon.-Fri. 7:00am-5:00pm

ON ALL LAMINATE FLOORING

TAKE 10% TO 25%

Hours: Mon-Fri 9:00-5:30

Tues til 7:30 Sat 10:00-3:30

OFF

Customized Financing Available

www.CARPETDEPOTFLOORINGMI.com

FREE CARPET PADDING WITH ANY INSTALLED CARPET JOB Wood

100’s of Instock Carpet Remnants!

Page 18 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

PUSHIES CHIROPRACTIC CLINIC Dr. Ann Marie Pushies Palmer Graduate Hours: Mon., Wed. & Thurs. 9am to 12 noon & 3pm-6pm Fri. 9am to 12 noon & 3pm-5pm Closed Tuesday

Specializing in... Family Chiropractic, Sports Injury Most insurances accepted

      1/2 mile east of main light in town, on south side of Grand River Ave.



PUBLIC HEARING VILLAGE OF WEBBERVILLE Please TAKE NOTICE THAT THE Village of Webberville Council will conduct a hearing on a new Industrial Facilities Exemption CertiÂżcate for 0S Precision Components, LLC. For real and personal property at a public hearing on Tuesday, October 1, 2013 at 630p.m. or as soon thereafter as possible, at its Chambers at 11 S. 0ain St., Webberville, 0I 882. If you are unable to attend the meeting, but would like to comment on the granting of the Industrial Facilities Exemption CertiÂżcate, please write to -aymee Hord, Village 'eputy Clerk, P.O. %ox 38, Webberville, 0I 882. -aymee Hord Village Deputy Clerk 1-21-38 1062013

&216,*10(17$8&7,21 21681'$<2FW DWDP

WEBBERVILLE SCHOOLS DISTRICT Webberville Class of 1978 Reunion - The Class of 1978 is planning a reunion for Saturday, November 23, 2013, at 6:00PM at Spagâ&#x20AC;&#x2122;s Bar and Grill Banquet room in Williamston. The event planners for this event would like to get a hold of anyone that at any time during the school years was part of the class of 1978. If you know of anyone that should be at this event, please send their email, address or phone number to Norm Nack. Please RSVP as soon as possible as payment is needed by November 1st. Cost will be $ 25.00 per person. Menu: buffet style including appetizers, salad, main course and dessert. Cash bar will be available. Make checks payable to: Norm Nack, 4791 Columbia Rd, Webberville, MI 48892 *** Trivia Night â&#x20AC;&#x201C; The Webberville Athletic Boosters are sponsoring Trivia Night on Saturday, October 12 at the Oak Lane Golf Course. The doors open at 6:30PM and the trivia starts at 7:00PM. Tables of up to 8 people will complete with other groups to answer trivia questions in various categories. The cost is $10 per person and cash prizes will be awarded. To register your team, please call Janell at 517-376-0671. *** Board Meeting â&#x20AC;&#x201C; The next board meeting of the Webberville Community Schools Board of Education will be Monday, October 21 at 7:00PM in the Spartan Center Community Room. *** Parent/Teacher Conferences â&#x20AC;&#x201C; Conferences for K â&#x20AC;&#x201C; 12 grade students will be on Wednesday, October 23 and Thursday, October 24 from 4:00PM â&#x20AC;&#x201C; 7:00PM. *** No School â&#x20AC;&#x201C; There will be no school on Friday, October 25.

WEBBERVILLE ELEMENTARY SCHOOL Elementary Booster Meeting â&#x20AC;&#x201C; If you are a parent of an elementary student, you ARE a booster! Attend the meetings and get involved in the activities that help to support the teachers and students. The next booster meeting is Monday, October 7 at 6:00PM in room 10. *** Elementary Ipad RafĂ&#x20AC;e - The Elementary Boosters are running a RafĂ&#x20AC;e for an Apple iPad. The tickets are on sale now and the drawing will be at the end of the 3rd quarter of the homecoming football game on Friday, October 18. Tickets are $5.00 each.

&&216,*10(176:$17('

WEBBERVILLE SECONDARY SCHOOL

12+286(+2/',7(067,5(625-81.$&&(37('

Homecoming Information â&#x20AC;&#x201C; The Homecoming football game will be held on Friday, October 18 at 7:00PM. The events related to Homecoming are as follows: October 7 â&#x20AC;&#x201C; Float building begins October 14 â&#x20AC;&#x201C; Wall decorating & Spirit Week begins October 14 â&#x20AC;&#x201C; Powder-puff game at 6:30PM October 18 â&#x20AC;&#x201C; Elementary Fun Run â&#x20AC;&#x201C; starts at 8:00AM October 18 â&#x20AC;&#x201C; Homecoming parade, tailgate and football game. Crowning of the King and Queen. October 19 â&#x20AC;&#x201C; Alumni Volleyball Game at 10:00AM October 19 â&#x20AC;&#x201C; Homecoming Dance - 7:30PM-11:00PM *** Alumni Volleyball Game - The varsity volleyball team will host an alumni vs. varsity volleyball game on Saturday, October 19 at 10:00AM. If alumni are interested in playing, please contact Coach Kemler at (517)294-1682. *** Senior Picture Information â&#x20AC;&#x201C;Senior pictures must be submitted to the yearbook staff by November 15. Digital images are preferred in jpeg format, CMYK at 300dpi. Pictures must be: wallet size, vertical format facing forward, color, head and shoulders pose facing forward, traditional or neutral background â&#x20AC;&#x201C;no outdoors shots, no hands, no identiÂżcation marks can appear in photo, head size must be 1.5 inches from the hair to chin line, eyes should face forward. We cannot include pictures that do not meet these requirements. If you choose to use your school ID picture, please dress appropriately.

$OOFRQVLJQPHQWRIPDFKLQHU\WUDLOHUVWUDFWRUVODZQ JDUGHQHTXLSPHQWJXQVDQGDQ\IDUPRUVKRS LWHPVDUHZHOFRPH

+RUVH 7DFN$XFWLRQ VW6DWXUGD\RIWKHPRQWKDWSP

*(<(5$8&7,216(59,&( +D\ 6WUDZ6PDOO$QLPDO$XFWLRQ             

Webberville Report

$XFWLRQHG,WHP 4XDQWLW\ 6TXDUH+D\  5RXQG+D\  6TXDUH6WUDZ  +HQV  5RRVWHUV  5DEELW  *XLQHD3LJV  *XLQHDV  'XFNV  3LJHRQV  *HHVH  *RDWV  &DOYHV 

3ULFH5DQJH           (DFK  

Webberville 4-H Club meeting this Monday, Oct. 7, at Village Hall

The Webberville 4-H Club is holding a club sign-up meeting on Monday, October 7 from 5:00 to 6:45 p.m. at the Webberville Village Hall. There will be a business meeting to follow at 7:00 p.m. Cost to participate is $13 per member and an additional $10 for shooting sports. Bring insurance card if interested in shooting sports. For more information, contact Suzie at 4496711 or Sandy at 388-1959.

Ingham County Genealogical Society to meet Oct. 10 at Vevay Township Hall The Ingham County Genealogical Society will meet on Thursday, October 10, 2013 at 7pm at the Vevay Township Hall, 780 Eden Road, one mile south of Mason. This monthâ&#x20AC;&#x2122;s program will be presented by Diane Oslund on the subject of â&#x20AC;&#x153;Effective Query and Letter Writing.â&#x20AC;? $ short business meeting and Induction of new OfÂżcers will follow the program. For more information call Diane Bishop, President at 517-676-7140.

WHITE OAK TOWNSHIP NOTICE OF PUBLIC HEARING The White Oak Township Board will conduct a Public Hearing on Thursday, October 24 2013, beginning at 7:00 p.m., at the White Oak Township Hall, 1002 S. M-52, Webberville, Michigan 48892. The subject of the public hearing will be to discuss and possibly pass the proposed amendment to the Township Ordinance. The amendment will delete the last sentence of, or change Section 4.3. Streets, Alleys, Railroad, and Pipeline Rights-of-Way, which states that, â&#x20AC;&#x153;No structure shall be constructed within 75â&#x20AC;&#x2122; from a pipeline carrying high-pressure gas or other volatile materials.â&#x20AC;? Written comments will be considered and may be forwarded to the White Oak Township OfÂżces until Tuesday, October 22, 2013 at 5:00 p.m. Please call (517) 851-8764 for further information. Leela A. Vernon, Clerk White Oak Township 10/06/2013

WEBBERVILLE COMMUNITY SCHOOLS

POSITIONS AVAILABLE Substitute Food Service Workers Â&#x201E;POSITION

DESCRIPTION: Work on an as-needed basis as a substitute in the food service department. Perform cooking duties under direction of supervisor.

Â&#x201E;QUALIFICATIONS:

High school diploma or general education degree *(' RURQHWRWKUHHPRQWKV¡UHODWHG experience and/or training; or equivalent combination of education and experience. Will be hired as an EduStaff employee.

CONTACT: Cindy Courter, Food Service Director

517-521-3422 ext: 349 ccourter@webbervilleschools.org

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 19

Capital Area Library Events

Michigan House Report Cindy Denby, 47th District

Michigan has many great programs aimed at keeping residents safe. One of these programs recently celebrated 28 years of success in auto theft prevention. Help Eliminate Auto Thefts, commonly known as H.E.A.T., is a partnership between Michiganâ&#x20AC;&#x2122;s auto insurance companies, law enforcement and residents of Michigan. H.E.A.T. helps reduce auto theft in Michigan through a 24/7 conÂżdential, toll-free tip line. Over the past 28 years, Michigan residents have helped H.E.A.T. recover more than $52 million in stolen property and assisted in arresting more than 3,400 suspects of auto theft-related crimes. If you witness a car theft or have information about a stolen vehicle or any other suspicious auto-related behavior including auto insurance fraud and carjacking, I encourage you to contact H.E.A.T.â&#x20AC;&#x2122;s conÂżdential tip line at 1-800-242HEAT. Rewards are determined by the H.E.A.T. Reward committee. Tipsters can potentially receive up to $1,000 for arrest and warrant of an individual suspected of auto theft, auto theft-related insurance fraud or identity theft. A person can receive up to $2,000 for arrest and warrant of a carjacking suspect and up to $10,000 for arrest and binding over for trial of suspected theft ring members and/or chop shop operators. In addition to these services, to help keep residents safe, H.E.A.T. has provided safety tips for residents of the 47th House District. H.E.A.T. reminds residents to always lock your car, take your keys, park in well-lit areas, donâ&#x20AC;&#x2122;t leave belongings in sight, completely close your windows and park in attended lots. H.E.A.T. also stresses not to leave your registration in your vehicle or hide spare keys in the car because thieves know where to look. Practicing auto theft prevention will keep your car and your family safe. Programs like H.E.A.T. are essential public-private partnerships that help keep our neighborhoods safe and lower our insurance rates, and I would like to commend H.E.A.T. for 28 years of success. Again I encourage local residents to report any suspicious auto-related behavior conÂżdentially to H.E.A.T. at 1-800-242-HEAT or online at www.1800242HEAT.com. Additional safety tips also are available on H.E.A.T.â&#x20AC;&#x2122;s website. Remember, auto theft is a crime of opportunityâ&#x20AC;&#x201D;so donâ&#x20AC;&#x2122;t give thieves the chance. The H.E.A.T. program is funded through and administered by the Michigan Automobile Insurance Placement Facility, an association of Michigan automobile insurers. The H.E.A.T. tip line is monitored by the Michigan State Police and funded by Michiganâ&#x20AC;&#x2122;s auto insurance companies. *** f you have any questions or need assistance with any state issues, please contact me toll free at 866-828-4863 or via e-mail at cindydenby@house.mi.gov.

WEBBERVILLE Mini-Terrarium Necklace (Ages 12-18)* Date: 10/8/2013 - Start Time: 3:30 PM Description: No place to put a terrarium? Make one you can wear! *Registration required; call 517-521-3643 House Genealogy (Adults) Date: 10/8/2013 - Start Time: 6:30 PM Description: Youâ&#x20AC;&#x2122;ve heard about researching family genealogy, but how about the genealogy of your house? CADLâ&#x20AC;&#x2122;s local history librarian will help you get started. *** WILLIAMSTON Drop-in LEGO Club (Ages 6-14)

Webberville Athletic Boosters holding Trivia Night on Oct. 12

Webberville Athletic Boosters are sponsoring Trivia Night on Saturday, October 12 at Oak Lane Golf Course. The doors open at 6:30 p.m. with the Trivia at 7:00 p.m. Tables of up to 8 people will compete with other groups to answer trivia questions in various categories. In all, there will be a total of 100 questions covering 10 areas of trivial knowledge. Cost is $10.00 per person, with option of purchasing more trivia games. Cash prizes awarded. Snacks and beverages â&#x20AC;&#x201C; Must be purchased from golf course. Please register your team. Contact Janell at 517-376-0671.

Holiday Craft Show at St. Mary of Williamston on Nov. 2-3

Show your crafts at the Holiday Craft show on Nov. 2 & 3 in the Activity Center of St. Mary Church, corner of Cedar & High Streets in Williamston. The show is sponsored by the Knights of Columbus Council 7545. In addition, a luncheon will be served on Saturday from noon to 2 p.m. and a Swiss Steak Dinner on Sunday from 12 to 3 p.m. St. Mary Church will also hold a bake sale and a quilt rafĂ&#x20AC;e. Contact Lynn Pitlanish at 517-490-3242 or Vicki Pulling at 517-214-7570 for additional information.

The Webberville United Methodist Church is holding their annual Harvest Dinner on Sat. Oct. 19th from 4:30-7 PM at 4215 E Holt Rd., corner of M-52. The menu includes turkey and all the trimmings including homemade rolls and pies. Take outs are available. Free will offering.

GORMLEY & JOHNSON LAW OFFICES, PLC

JOHN L. GORMLEY, ESQ

COUNSELORS

AT

LAW

OLD WEST TOWN

ALAMO MAZE

PANNING FOR GOLD

OLD FASHION FARMING

DRINK AND SNACK IN SPOOKY FOREST AND KIDS SALOON HEADLESS HORSEMAN PLAY FORTS WESTERN GAME SCAVENGER HUNTS

TEXAS ADVENTURE TEPEE FOR STORIES PETTING ZOO (FEED ARCHERY FOR KIDS INCLUDED) HORSE RIDES KIDS TRAIN PEDAL RACE TRACK

PUMPKIN PATCH

Plus Much More!!! HORSE RIDES, FOOD AND, HOMEMADE DONUTS AND CIDER WILL BE ADDITIONAL COSTS

Reservations Required, from 12:00am-6:00pm Pay at Arrival

$18.00 per Child 2 & UNDER FREE IF ACCOMPANIED BY $8.00 per Adult PAYING SIBLING

REGISTER NOW!!! CHECK OUT OUR WEBSITE FOR MORE INFORMATION 3637 Morrice Rd. Webberville

517-881-9142

7KDQNV<RX <PM4MZWa<W_V[PQX.QZM:M[K]M _W]TLTQSM\W\PIVSITTWN \PMTWKIT UMZKPIV\[NWZ\PMQZLWVI\QWV[\PI\ UILMW]ZUMZKPIV\[LZI_QVOI P]OM[]KKM[[ ?MIT[W_W]TLTQSM\W \PIVSITT\PW[M_PWPMTXML][_Q\P [MZ^QVOIVL\PMXIZILM[?MKW]TL VW\LWQ\_Q\PW]\aW]  )VL\W\PMKWUU]VQ\a\PIVSaW] NWZUISQVO\PM\P.QMTL,Ia[ 7`:WI[\IP]OM[]KKM[[

CHRISTOPHER S. JOHNSON, ESQ

%DQNUXSWF\ â&#x20AC;&#x153;Our Bankruptcy Prices Include All Costs and Feesâ&#x20AC;?

f'LYRUFH)DPLO\/DZf(VWDWH3ODQQLQJ f&ULPLQDO'HIHQVHf3HUVRQDO,QMXU\f5HDO(VWDWHf0XQLFLSDO/DZ f3UREDWHf&RUSRUDWHf%XVLQHVVf=RQLQJf/DQG8VH 101 E. GRAND RIVER AVE., FOWLERVILLE FREE Initial Consultation

BUCKING, ROPING AND MILKING STATION

Webberville United Methodist Church holding Harvest Dinner on Oct. 19

Call (517)223-8760 Your Local Shopping Bazaar

AND

HAY RIDE TO INDIAN VILLAGE

northforkoutback.com

NEIGHBORHOOD CLASSIFIEDS

LOCAL ATTORNEYS

Date: 10/8/2013 - Start Time: 4:00 PM Description: Kids love getting creative with our LEGOÂŽ collection! Playing with imaginative toys builds skills used in reading. Retro Saturday Morning Cartoons Date: 10/12/2013 - Start Time: 9:30 AM Description: Kids can wear their pajamas to enjoy classic cartoons from the 1980s and 1990s and a cereal breakfast.

:HDUHDGHEWUHOLHIDJHQF\:HKHOSSHRSOHÂżOHIRU bankruptcy under the bankruptcy code.

517-223-3758

*''41;1905*+2

+4'n'5%7' 551%+#6+10

Page 20 – Fowlerville News & Views – Sunday, October 6, 2013

Leroy Township Fire & Rescue Field Days & Ox Roast draws large crowds

Nearly SerIect autuPn weatKer on tKe ¿rst two days, along witK a larger carnival and all oI tKe otKer traditional events drew large crowds to the Leroy Township Fire & Rescue Field Days & Ox Road held on Sept. 27-29. Lt. (rnie NiPs presented a plaTue and Àowers to Stacey Flynn in honor and PePory oI her husband, *reg Flynn, who served for 20 years on the Leroy Township Fire Department. With her, riding at the head of the parade were *reg¶s children and grandchildren. *reg was named as this year¶s *rand 0arshal for the Saturday afternoon parade that went through Downtown Webberville, starting at the high school and ¿nishing at the ¿re hall.

The Webberville High School Band entertained the parade spectators as they marched along *rand River.

Ron House brought his Farmall H tractor.

Nolan 0onroe, age 11, races at -acNson Speedway and holds the tracN record. He is the 2012 &hampion and is currently in ¿rst place for this season.

DominiN Hull tooN ¿rst place in the &hildren¶s Parade held Saturday morning with his decorated -ohn Deere gator.

Bill Wheeler drove this 1937 Oliver 70, owned by Bob Benjamin.

Webberville FF$ members rode in this Àoat and also advertised their &hicNen BB4 schedule for Sunday. Reports are that they sold out.

The Webberville *arden &lub had this Àoat in the Saturday afternoon parade.

0iNe and Barb StocN of Fowlerville made their annual visit to the event.

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 21

Âł,tÂśs a -ungle Out 7Kere :itKout -esus´ is tKe tKePe oI tKis Ă&#x20AC;oat brougKt by tKe Webberville United Methodist Church.

Jean Coe, left, and Jessica Wisuri were doing a brisk business at the /eroy FireĂ&#x20AC;ies booth, selling root beer Ă&#x20AC;oats.

Selling baked goods and crafts at the Webberville Garden Club booth were, from left, Barb Bridges, +elen (isele, and 5ene +oppe.

The Webberville Garden Club sponsored its annual Pumpkin Decorating Contest during the Field Dayâ&#x20AC;&#x2122;s celebration. Among those who entered was Addison Anway, age , of Williamston. +er parents are 5odney and Sharon Anway.

Andrea Nims, left, and +eather Derian, members of the Webberville (lementary Boosters, were selling rafĂ&#x20AC;e tickets at $5 each for an I-Pad. The drawing will be held during the +omecoming on Oct. . Money goes into the Boostersâ&#x20AC;&#x2122; general fund to purchase playground equipment, teaching supplies, and other similar items.

Serving the o[ burgers at the Âżre hall were these Webberville +igh School varsity cheerleaders. FroP leIt are Chelsea Curtis, Jenna Kingsley, Jordan Burrom, Taylor Chase, Taylor Mayville, and Paige Wilson. 5oy Miller of 5owley Wesleyan Church gave away free popcorn in the Community Barn.

Working at the Webberville United Methodist Womenâ&#x20AC;&#x2122;s booth were, from left, Cora Oesterle, +elen +ouse, and Barb Alchin.

Sherry Davis, who serves on the Leroy Fire Department and also drives the ambulance at the Williamston station, was among those who helped cook and grind the ox buger meat. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a group effort,â&#x20AC;? she noted. â&#x20AC;&#x153;At 4 a.m. the meat is loaded into the cooker and then the vegetables and spices are added. After itâ&#x20AC;&#x2122;s Âżnished, we grind it. On Friday we cooked 1,100 pounds of meat and on Saturday we were preparing 900 pounds.â&#x20AC;?

Page 22 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

<RXU+HDOWK LV2XU&RQFHUQ

0RVW,QVXUDQFH 3ODQV$FFHSWHG

)2:/(59,//(3+$50$&< (DVW*UDQG5LYHU)RZOHUYLOOH0, %ODLQH.XELDN 3+$50$&,67

%RE3KLSSV 2:1(53+$50$&,67

0LNH+HLGW

2:1(53+$50$&,67

  +RXUV0RQ)ULDPSP 6DWDPSP6XQ&ORVHG

83,&.RU72*2

581.(/$33/(6 DW

581.(/25&+$5'6 *UHDWIRU(DWLQJ %D %DNLQJ$SSOH6DXFH U & 'HH V &LGHUDQG:LQH OH

$SS

7XHVGD\ 7KXUVGD\ 1RRQSP PLOHVZHVWRI)RZOHUYLOOH RII*UDQG5LYHU PLOHQRUWKRQ6WRZ5RDG HQWHUDW´5XQNHO$SSOHV¾VLJQ

$SSOH8SGDWH UXQNHODSSOHFRP

Construction project to shut down )owOerYiOOeÂśs PDin Iour trDIÂżc intersection during next two weeks By Steve Horton The construction project that has closed North Grand $Yenue in )oZlerYille since earl\ -une is PoYinJ into its Âżnal two phases. Those phases, however, involve closing down the Pain Iour traIÂżc intersection Ior the ne[t twotothree weeks and then closing down the north lane of East Grand River from the Main 4 intersection east to Second Street. The closing of the main four intersection means that trafÂżc cannot pass through the downtown and much of it will be detoured to Frank Street from East Street on the east side of town and from Veteranâ&#x20AC;&#x2122;s Drive on the west side. Motorists coming into town from the north will continue to be detoured on North Street to North Collins Street, although its appears likely that North Grand Avenue will be opened to Mill Street where the Âżre hall is located to allow better access to local businesses on the north side of Grand River and on North Grand Avenue. A meeting was held last Wednesday morning at the Village of Fowlerville council chambers to inform downtown businesses and the school about the plans and timetable and to answer questions. About two dozen owners and managers along with two school ofÂżcials were in attendance. Joe White, the Villageâ&#x20AC;&#x2122;s engineer from Wolverine Engineering, chaired the meeting and provided most of the information. Another ofÂżcial from Wolverine and two ofÂżcials from Joe Raica E[cavating, ,nc., the project contractor, were also present. ÂłAll three of the utilities water, sewer, and storm drain are located under the trafÂżc light and we need to connect these lines to the new ones on North Grand Avenue,â&#x20AC;? said White. ÂłAfter that we have to rebuild the intersection, install curb and gutter, and pour the remaining sidewalk. ,t takes three days for the concrete to cure enough for it to be used. â&#x20AC;&#x153;Once that work is completed, then North Grand Avenue will be open for motor trafÂżc and the detours will end,â&#x20AC;? he added White said the estimate by the contractor is that this phase will take around two weeks, but noted that rainy weather could delay completion. After that, the Âżnal phase will start. This will involve tearing up part of the sidewalk, the curb and gutter and the north lane of Grand River from the main four intersection to North Second Street and then digging a trench and putting in a new storm drain. Afterwards, a new sidewalk and curb and gutter will be poured, and decorative brick, identical to what is now in place on North Grand Avenue, will be installed for the parking lane. During this phase two

lanes of trafÂżc will remain open on Grand River and parking will be available on the south side of the street. However, access to the front entrances of the stores and ofÂżces on the north side of Grand River will be restricted and at times closed. White said the timetable for this phase to be Âżnished is around four weeks. All but one of the businesses and ofÂżces has back door access. Edward Jones is the lone e[ception. Most of the questions and discussion involved the detouring of trafÂżc away from the downtown businesses during the closing of the main four intersection and the closing of the front entrances of the businesses on the north side of Grand River. White said he would talk with the police chief, Tom Couling, who issues the trafÂżc control orders, about these suggestions to make access less restrictive during the closing of the intersection. The eastwest detour will be East Street to Frank Street to Veteranâ&#x20AC;&#x2122;s Drive. TrafÂżc coming in from the south would be detoured at Frank Street, while trafÂżc coming in from the north would continue to use the current detour. While those in attendance understood that this was the best option for trafÂżc passing through town, most urged that trafÂżc be allowed to pass around barricades for people wishing to shop downtown rather than them having to use side streets. Asked about delaying the remainder of the work until ne[t year, White said he understood the difÂżculty this posed after businesses have spent the summer with North Grand Avenue being closed, but said the best option was to move ahead and Âżnish the project. The Village is receiving a matching grant from the State of Michigan that covers a large amount of the overall cost. The reopening of North Grand Avenue had, at the start of work, been scheduled for Labor Day. White was asked â&#x20AC;&#x2DC;whyâ&#x20AC;&#x2122; the project was â&#x20AC;&#x153;so far behind.â&#x20AC;? â&#x20AC;&#x153;We had a number of rain days when work could not be done and when muddy conditions caused further problems, plus we had some other unforeseen problems,â&#x20AC;? he said. â&#x20AC;&#x153;,t is a month behind. Every project is unique. Unfortunately, when youâ&#x20AC;&#x2122;re dealing with yearold utilities, dealing with the limited spaces you have in a downtown area, and having a lot of variables that occur, the timetable can get delayed. â&#x20AC;&#x153;, know this is a major inconvenience to your,â&#x20AC;? he said. â&#x20AC;&#x153;,tâ&#x20AC;&#x2122;s no fun to sit up here and tell you itâ&#x20AC;&#x2122;s going to take at least another si[ weeks. %ut weâ&#x20AC;&#x2122;re doing the best we can do to Âżnish it as quickly as possible.â&#x20AC;?

Construction project to cause delay in school bus drop-off times

Attention parents of students who ride Fowlerville school buses please note that bus dropoff times will be appro[imately  minutes later than usual for most students who live south of Grand River Avenue the center of town . %eginning this Monday, the intersection of Grand River and Grand Street will be closed for two to four weeks. The alternate routing caused by the construction and detour will result in delayed dropoffs. 3ickup times should remain fairly consistent.

ASK THE REAL ESTATE BROKERS! 6DOO\$:LWW%URNHU

3UXGHQWLDO+HULWDJH5HDO(VWDWH with more than 40 years of experience in the business of real estate and oÎ&#x20AC;ces in Fowlerville, Brighton and Howell

$SULO6HHEXUJHU6DOHV0DQDJHU )RZOHUYLOOH2Î&#x20AC;FH²6*UDQG$YH  April Seeburger has more than 20 years of real estate experience in Metro Detroit and Fowlerville

Question::HDUHWU\LQJWREX\DKRPHDQGMXVWPDGHDQDSSOLFDWLRQ IRU DQ )+$ ORDQ $UH ZH JRLQJ WR EH DÍżHFWHG E\ WKH JRYHUQPHQW VKXWGRZQ"Pete from Pinckney. Answer: :H KDYH UHFHLYHG ZRUG WKDW )+$+8' DQG 5XUDO GHYHORSPHQW RÎ&#x20AC;FHV DUH FORVHG ,I \RX MXVW PDGH DQ DSSOLFDWLRQ \RX PD\ ZDQW WR FRQVLGHU RWKHU PHWKRGV RI Ă&#x20AC;QDQFLQJ )+$ ORDQV UHTXLUH D PLQLPXP RI  GRZQ 7KHUH DUH VRPH FRQYHQWLRQDO ORDQV WKDW RÍżHU D PLQLPXP RI  GRZQ 6RPH XQGHUZULWHUV FRQWDFW WKH ,56 IRU WUDQVFULSWV UHODWLYH WR ORDQ DSSOLFDQWV 7KHVH UHTXHVWV DUH QRW EHLQJ SURFHVVHG &DOO RQH RI RXU RÎ&#x20AC;FHV WRGD\ IRU PRUH LQIRUPDWLRQ 6DOO\:LWW²2Î&#x20AC;FHÂ&#x2021;&HOO $SULO6HHEXUJHU²2Î&#x20AC;FHÂ&#x2021;

Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013 â&#x20AC;&#x201C; Page 23

Gladiators lose hard-fought Homecoming game against Ionia

Fowlervilleâ&#x20AC;&#x2122;s varsity football team gave the Homecoming crowd quite a show on Friday, Sept.27, but came up short from pulling out a win in the closing seconds of the game. The Gladiators, who came into the game with only one win, gave a great effort to make it two wins, coming back from being down by 2 points late in the Âżrst half, taking the lead in the third quarter, losing it, and then rallying again. In the end, though, Ionia answered each challenge, and the Glads lost to their CAAC Red Division rival, 26-24. The Bulldogs, combining an effective running game and passing attack, took a 2- lead in the Âżrst quarter. That looked like it would be the score at halftime, but Fowlerville, with only 30 seconds left on the clock and having the ball at the Ionia 7-yard line, did a Ă&#x20AC;ea Ă&#x20AC;icker play with running back Jake Kollek connecting with Cameron Bronikowski for the touchdown. Nick Gullet split the uprights to make it a 12-7 game. The Gladiators then executed a successful onside kick to open the second half. The gamble paid dividends when two plays later Kollek ran into the end zone from 36 yards out. Gulletâ&#x20AC;&#x2122;s PAT gave the team a 14-12 lead. Fortune seemed to be smiling on Fowlervilleâ&#x20AC;&#x2122;s chances even more when Court Langham recovered a Bulldog fumble on the ensuing series. The offense moved the ball to the Ionia 30-yard line where Gullett connected on a Âżeld goal, giving the Glads a 17-12 advantage with 8:09 remaining in the third period. But the optimism faded when Ionia took the kickoff and drove the length of the Âżeld, scoring on a Âżve-yard TD run.

6W-XGHÂśV)XQGUDLVHU 7KH )RZOHUYLOOH $UHD )LUH 'HSDUWPHQW LV KRVWLQJDERRWGULYH6DWXUGD\2FWWKIURP DPSP$OOSURFHHGVDUHWREHQHÂżW 6W -XGH &KLOGUHQÂśV 5HVHDUFK +RVSLWDO )LUHÂżJKWHU-XOLH'DLOH\KDVFRPPLWWHGWR UXQ:DOW'LVQH\:RUOGÂśVPDUDWKRQDQGD KDOI *RRI\&KDOOHQJH -DQXDU\WKDQGWK DVD6W-XGH+HUR3OHDVHFRPHRXWDQGVXSSRUW RXUHIIRUWV

The two-point conversion made it 20-17. The excitement quickly returned when three minutes later Kollek broke loose and scampered 77 yards for the score. Again Gullett kicked the PAT. But once again Ionia answered the bell. On the next series they went 15 plays culminating their drive with a 12-yard pass play. The point-after play failed though, leaving the game at 26-24. Fowlerville made one last attempt to gain the victory. Regaining possession at their own three-yard marker and with only a little over a minute-and-a-half to play, the offense, led by quarterback Brody Shrader, reached the Ionia 33. Two long passes by Shrader to Jake Shroyer highlighted this brief drive. The comeback ended when Shraderâ&#x20AC;&#x2122;s pass was intercepted with 40 seconds left. Ball control proved to be Ioniaâ&#x20AC;&#x2122;s big asset. They rushed for 332 yards and gained another 65 yards in the air, completing 12 of 23 passes. Their time of possession was 31:23. Fowlerville, meanwhile, ran for 183 yards, but gained another 182 in the air with 15 completions on 29 tries. Time of possession for the Glads was 16:37. Shrader, who came in near the end of the Âżrst half when starting quarterback Austin Harvey was injured, hit 10 of 18

Oak Grove United Methodist holding dinner & holiday bazaar Oct. 19 Oak Grove United Methodist Women invite you to our delicious, home-style Swiss Steak Dinner on Saturday, October 19, 2013. Our menu includes Swiss Steak, mashed potatoes and gravy, corn, green beans, coleslaw, rolls and homemade pies. The meal will be served from 4:30-7 p.m. The women are also having a Holiday Craft Bazaar and Bake Sale from 4-7:30 p.m. Donations for the dinner are taken at the door, no reservations are necessary. Plan to come early or stay late to shop the handmade crafts and delicious baked goods while you are there. Oak Grove United Methodist Church is located at 6686 Oak Grove Road, Howell (5 miles north of M-59). For more information, please call the church ofÂżce at 517-546-3942.

passes for 128 yards. Kollek gained 186 yards on 16 carries. Shroyer caught Âżve passes for 124 yards, while Jason Ludwig made Âżve catches for 12 yards and Tucker Gibbons 3 catches for 32 yards. Fowlerville was at Owosso this past Friday (past the newspaper deadline). They host Haslett this Friday for Senior Parent Night and the Âżnal league game.

%%'55146*'%10&64''661 +..64''6$;6*'+$4#4;

74 411/+0)4+%'5+0%.7&'6*'16#.#%-#)' 2SHQ0RQ6DWDPSP&ORVHG7XHV

1*UDQG 6XLWH

:($5(

6 7 , / / 23(1

:($5(23(1

681'$<6 DPSP

&KHFNXVRXWRQWKHZHE ZZZVXG]SHWJURRPLQJFRP

0DUN·V'HHU3URFHVVLQJ 21/<  5(*8/$5 &87

9DFXXP3DFNHG $YDLODEOH Â&#x2021;+XQWHU6WLFNVÂ&#x2021;6XPPHU6DXVDJH Â&#x2021;&RUQHG%HHI9HQVRQ

Â&#x2021; <RXU'HHUZLOOEHKXQJEHIRUH\RXOHDYH QHYHUSLOHGRQWKHJURXQG

Â&#x2021; $OZD\VUHFHLYH\RXURZQPHDWEDFN Â&#x2021; KRXUGURSRII

0DUN,YHV   &RUQHURI0RKUOH )RZOHUYLOOH5RDGV

15%O<F2F2.> 



.-;.74 / O<>4.oo-rr;...... .74 74. 2.-; .741/2OFF

((SSaam mee ppaacckkaagg ee,, ssaam mee cclliieenntt))

20%OFF

 4 9 4   8   F 6 F O  > O % 6 50 OF9O -8 .4    4   9 /O .-;.74   4 8  O  .> 9 9 > F. F 9 O6O O % 25 94 OF /O

7.34 Offers good through 10/31/2013

Page 24 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

NEIGHBORHOOD CLASSIFIED SECTION Call (517)223-8760

Office Located at 226 E. Grand River, Fowlerville MI Fowlerville News & Views

-DEADLINE THURSDAY BY 4PMOFFICE AREA FOR RENT. 5 rooms, 1000 square feet near I-9, customer parking, 800. per month. Call (517) 81-127. *** FOREST & LAND MANAGEMENT: Buyer of standing timber. For a FREE NO obligation estimate please call (517) 243-499. Registered Forester 015. *** MECHANIC WILL WORK on cars, vans, pickupsâ&#x20AC;&#x201D;cheap! (517) 223-8219. *** DIRECT CARE STAFF NEEDED: To take care of disabled adults in Howell. Valid driverâ&#x20AC;&#x2122;s license required with clean driving record. (810) 30-0832 *** COTTAGE HOUSE near downtown Fowlerville. $795 per month 3 bedroom, 1 bath. Resident pays utilities. $795 security deposit, lawn service included. 1st Ă&#x20AC;oor living, dining, ofÂżce, large bath, laundry hook-up. 2nd Ă&#x20AC;oor: 3 small bedrooms walk in closet, custom shelving. Non-smoking/ pet free home. Please call 517294-9453. Can also be viewed on Craigslist. *** $5 BUCKS A FOOT TREES. 3 foot to 1 foot spruce & pine & maples & oaks. NEW 7 foot 3 inches wide, 7 foot tall, 5 ò foot deep hunting/Âżshing/ storage shed. Firewood $40. Howell. 989-984-481. *** LADIES ESCAPE MASSAGE THERAPY CMT. Sharon Elkins call for new location and specials Regular Fee 1 hour $40. 1 ½ hour $0. 517-304-3232 *** PREMIUM SEASONED HARDWOOD: Stored inside. Delivery $0. Face cord. (517) 81-1459 *** FOR SALE: Recliner dark red, $20. IBM Selectric typewriter, $10; Three large boxes of scraps suitable for lap quilts, free to good home 517-521-371

Buying & Selling Antiques Buying: Gold, Silver and Guns

Corner of Grand River & Fleming Rd.,

East of Fowlerville

Outdoor Flea Market 3rd Weekend Monthly Friday, Saturday & Sunday October 19-20

(517) 223-4855 â&#x20AC;&#x153;Vendors Welcome - No Chargeâ&#x20AC;?  

   

VHQLRU IDPLO\SRUWUDLWV VSRUWVVSHFLDOHYHQWV

NOTICE OF DISPOSAL The following individuals have until the 15th of October 2013 to pay in full their accounts at the Mini Storage or forfeiture of the unit they rented will result: Jim Sylvaste Kate Kujawski Jeff Reeder Chelsea Albin

Mark Westmoreland Julie Davis Carmen Offaryl Chris Coltrain Beth Albin Don Tinchel Robin Stevens Robert Sanderson

WEBBERVILLE MINI STORAGE 517-521-3078

NOTICE OF SALE

All items belonging to: Gerri

& Gene Williams

Unit #52 & #53

at Oaktree Mini Storage will be sold after

October 15, 2013 to the â&#x20AC;&#x2DC;highest bidder.â&#x20AC;&#x2122; Oaktree Mini Storage II LLC 6300 Lange Rd., Howell, MI 48843

 Â&#x2021; Hodgins6300@yahoo.com

HELP WANTED. Experienced Service Writer at Champion Cheverolet of Fowlerville. 880 S. Grand Ave. Fowlerville. Apply in person. *** EVANS GARAGE DOOR REPAIR and installation. Spring replacement. Wayne Dalton garage doors and Lift Master garage openers. Call anytime 517-223-9905. *** I BUY FIREARMS: RiĂ&#x20AC;es, Shotguns or Handguns. If you have Âżrearms you no longer neend â&#x20AC;&#x201C; Call me! (517) 223-8781. *** FOWLERVILLE FEED & PET IS LOOKING FOR STORE HELP: Part time 10-15 hours per week. Must be able to work Saturdays. Must be able to lift and carry up to 50lbs. Some computer and retail sales experience required. Applications being accepted now at 120 Hale Street Fowlerville, MI. *** MOVING SALE: Furniture, tools, household goods, adult clothing, riding lawn mower, power washer, huge model railroad HO scale (locamotives, rolling stock, buildings, and electronics). Saturday & Sunday, 10am to 5pm. 3250 Hogback Rd., Fowlerville. South of Grand River. *** GYM EQUIPMENT INSTALLER: Treadmills, elliptical and stationary bikes, some heavy, lifting Part time, may lead into full time. Send resume to gymequip@charter.net. *** SPRUCE TREES: 8 footers, Buy 2, $5 each. Planting Fowlerville, Howell, etc. 1-810-333-094.

Haunted Inn murder mystery being presented by Community Theatre

Take a walk on the spooky side when Fowlerville Community Theatre presents Polter-Heist, an audience participation murder mystery by Tony Schwartz and Marylou Ambrose. The curtain rises on Nov. 1, at Woodshire Place Banquet Facility. What can you expect from an audience participation murder mystery? Fun the minute you walk in the door! Doors open at :00 p.m. when youâ&#x20AC;&#x2122;ll get a chance to mingle with Madam Zelda Von Schpookum, Professor Lionel Specter, and other cast members as they drop hints about themselves and the show and give you a chance to ask questions. At :30 p.m. youâ&#x20AC;&#x2122;ll enjoy a delicious lasagna buffet (Cash Bar), while the cast keeps a low proÂżle. The main show starts after dinner, at around 7:30 p.m. The action takes place at The Mouldering Pines Inn, where the Bogeyman Outreach Organization (BOO), a support group for ghosts, is holding its annual convention. As BOO members, youâ&#x20AC;&#x2122;ll observe a sĂŠance, meet the Innâ&#x20AC;&#x2122;s ghoul-inresidence, and learn dark secrets about every cast member. Besides Madam Zelda and the Professor, youâ&#x20AC;&#x2122;ll also meet Phyllis and Jim Lodge, the Innâ&#x20AC;&#x2122;s squabbling owners, Dana Skullery and Fox Smolder, from BOOâ&#x20AC;&#x2122;s Washington, D.C., chapter (or are they?), and Janet from Another Planet, a DJ with a past. Will Madam Zelda help the ghost relocate? Will the Lodges stop arguing long enough to get their hands on the treasure map? Is the Professor who he claims to be? And who committed the murder? The murder? Thatâ&#x20AC;&#x2122;s rightâ&#x20AC;&#x201D;the murder! Someone will be ruthlessly murdered at the end of the show, and itâ&#x20AC;&#x2122;s up to you to solve the crime! Prizes will be awarded to the Âżrst people to correctly guess both the murderer and the motive. Tickets for the dinner and show are $25 and can be purchased at Dr. Timâ&#x20AC;&#x2122;s ofÂżce at 74 S. Grand Ave, Fowlerville, or by emailing fowlervillecommunitytheatre@gmail.com. For information call Diana at 517 223-9409. Seating is limited, so get your tickets today! No tickets will be sold at the door.

The Original Dulcimers Playersâ&#x20AC;&#x2122; Club to hold jam session Oct. 10

The Original Dulcimers Playersâ&#x20AC;&#x2122; Club: (ODPC) will have their next â&#x20AC;&#x153;all dayâ&#x20AC;? Jam Session on October 10. They are held the 2nd Thursdays of the month at the Fowlerville Church of the Nazarene, 8040 Country Corner Dr., Fowlerville, in the strip mall just south of the I-9 (over pass) bridge on Fowlerville Rd. The sessions start at 10 a.m. and go into evening (9 p.m. last month). All acoustic instruments are welcome. Come and spend an hour or all day. It has evolved to include singers and pot luck snacks around the coffee pot during the day and a restaurant supper break, with more Jamming `til we quit..

)<:05,:::,9=0*,: DUMPSTER RENTALS: Plus junk removal services, free loading, great rates! Locally owned & operated Call Kevin: (517) 375-3478. *** S I G N S â&#x20AC;&#x201C; BANNERS-TRUCKS: Over 35 years experience. SIGNS ON THE SPOT (formerly Smithâ&#x20AC;&#x2122;s Sign Shop) Eugene SmithWebberville (517) 521-3333. www.SignsOnTheSpot.com. *** BRENDAâ&#x20AC;&#x2122;S PET GROOMING & BOARDING: â&#x20AC;&#x153;Quiet Home Settingâ&#x20AC;? available ANY DAY by appointment only. 517-294-0209 *** SEWING MACHINE REPAIR: Free pick-up and delivery. Oneyear guarantee. 30 years experience. Call for estimate. Ph: 517-5524000. *** ALTERATIONS, REPAIRS FOR THE WHOLE FAMILY: From play to special occasions. Lloydine at 517-521-4388. *** D&R ROOFING & SIDING: New homes, tear-offs, recovers, gutters, Ă&#x20AC;at roofs. Call Don at (517) 548-3570 or (517) 37-204. *** GARAGE DOORS, OPENERS & SERVICE: Brand names. 5eplace broken springs. DOO5-TECH: (517) 37-4200. *** MEDICAL MARIJUANA CARD: For questions or information call (517) 304-9405. *** COMPUTER PROBLEMS? CALL DR. D. for ALL your computer needs. Repair, Install, Upgrades, Networking. Virus Removal and Backups. Repairing computers since 1989. Available 7 days a week, 9 am â&#x20AC;&#x201C; 9 pm for your convenience, CALL 517-223-8217 *** SMALL ENGINE MOWER & TRACTOR REPAIR. 15 years experience. Fast turn around time with reasonable rates 517-404770. *** ALL HANDYMAN SERVICES: RooÂżng, siding, remolding, decks, property maintenance, plumbing, electrical. Dependable. No job too small! Very reasonable rates. Call Ryan for free estimates 810-923-992 *** EARTHSHINE MASSAGE: Sad, Sore, get headaches, canâ&#x20AC;&#x2122;t sleep, pregnant got chronic pain or tension? Experience what massage can do for you. Schedule on-line: earthshine. massagetherapy.com 517304-5151 or 223-8552 *** ACOUSTIC GUITAR REPAIR/ SELL NEW BO WILLIAMS GUITARS, 8810 W. Allen Rd., Fowlerville. (517) 37-1580. Free set of strings, 25 percent off all guitars. *** FARRIER SERVICE: Craig Horton, Fowlerville, Graduate of Wolverine Farrier School. (865) 816-7848

LIMITATIONS

What are our limitations Are they as individuals or as nations I stepped back and listened recently To what in this country we hear and see I miss what I thought we strive to be I miss this terribly, the way it could be I miss what we wanted most It seems gone from coast to coast We hear some boast We see and hear them roast The things we hear become our fears Ringing quite clear in our ears Is it the economy that chooses Who wins and who loses Does success you see Have to be at the cost of you and me BJ (BJ is the pen name of a lady from the Fowlerville area who writes poetry.)

Fowlerville News & Views – Sunday, October 6, 2013 – Page 25

/ivingston $FoustiF 0usiF 6oFiet\ holding Mam session on 2Ft 

   7KH /LYLQJVWRQ $FRXVWLF 0XVLF 6RFLHW\ /$06  -DP 6HVVLRQV DUH RSHQ WR LQWHUHVWHG PXVLFLDQV VLQJHUV DQG OLVWHQHUV  :H LQFOXGH PDQ\ GLIIHUHQW LQVWUXPHQWV VW\OHV RI PXVLF DQG OHYHOV IURP EHJLQQHUV WR DFFRPSOLVKHG 7LPH 7KH WKLUG UG 6DWXUGD\ RI WKH PRQWK  SP 3ODFH )RZOHUYLOOH &KXUFK RI WKH 1D]DUHQH  &RXQWU\ &RUQHU 'U )RZOHUYLOOH 0, ,Q WKH VWULS PDOO MXVW VRXWK RI WKH , RYHUSDVV EULGJH RQ )RZOHUYLOOH 5G :H DUH D IXQ QR REOLJDWLRQ IDPLO\ IULHQGO\ PXVLF VKDULQJ UHOD[HG LQIRUPDO JURXS 2XU QH[W -DP 6HVVLRQ LV 6DWXUGD\ 2FWREHU  VWDUWLQJ DW  SP

Fowlerville Equestrain Team heading to state ¿nals aIter SlaFing nd in regionals     7KH )RZOHUYLOOH (TXHVWULDQ 7HDP ¿QLVKHG 5HJLRQDO FRPSHWLWLRQDV5HVHUYH&KDPSLRQDQGLVQRZKHDGHGWRWKH 6WDWH ¿QDOV  &RPSHWLWLRQ ZLOO EH KHOG LQ 0LGODQG RQ 2FW 7KH\ZLOOFRXQWRQWKHH[SHULHQFHRIVHQLRUV$PEHU *HWFKHOODQG6DPDQWKD%ODFNWRKHOSOHDGWKHWHDP%RWKDUH PHPEHUVIURPWKH6WDWH)LQDOLVWWHDP )RZOHUYLOOHZLOOEHFRPSHWLQJLQWKH%'LYLVLRQDJDLQVW QLQHRWKHUWHDPVDWWKLVVWDWHFRPSHWLWLRQWKLV\HDUDQGWKHWKH ¿QLVKZLOOEHGHWHUPLQHGRQWKHDFFXPXODWLRQRISRLQWVRYHU WKHFRXUVHRIWKHIRXUGD\PHHW7KHLUPDLQIRFXVZLOOEHWR EULQJKRPHWKH&KDPSLRQVKLS7URSK\      5HJLRQDO FRPSHWLWLRQ RQ IRXQG WKH ULGHUV XSSLQJ WKH EDU6WLIIHUFRPSHWLWLRQDQGPRUHWHDPVWKDQ'LVWULFWVIRUFHG WKHHQWLUHWHDPWRIRFXVDOLWWOHKDUGHU&RDFKHVVWUDWHJL]HG DQGPRYHGULGHUVWRGLIIHUHQWFODVVHVLQRUGHUWRJHWRSWLPDO SHUIRUPDQFHDQGSRLQWVIURPWKHULGHUV

.reeger Elementar\ 6Fhool 1ews

,mSortant ,nIormation Ior the 6Fhool <ear 1RYHPEHU st ± 1R 6FKRRO 3URIHssLRQDO /HDUQLQJ 'D\ 1RYHPEHU th- )XOO 'D\ RI 6FhRRO 3DUHQt7HDFhHU &RQIHUHQFHs - SP 1RYHPEHU th ± ò GD\ RI 6FhRRO 3DUHQt7HDFhHU &RQIHUHQFHs - - SP 1RYHPEHU -th ± 7hDQNsJLYLQJ 5HFHss *** %o[ ToSs 9* 5eFeiSts &amSEell 6ouS /aEels 5HPHPEHU tR NHHS FROOHFtLQJ 7\sRQ $ ODEHOs 9J¶s UHFHLSts DQG &DPSEHOO¶s ODEHOs LQ DGGLtLRQ tR %R[ 7RSs *** 0eiMer¶s &ommunit\ 5ewards and Target 3rogram .UHHJHU (OHPHQtDU\ Ls HQUROOHG LQ thH 0HLMHU¶s &RPPXQLt\ 5HZDUGs 3URJUDP :hHQ \RX DSSO\ IRU D 0HLMHU¶s &UHGLt &DUG RU 0HLMHU¶s *XHst &DUG EH sXUH tR XsH thH .UHHJHU QXPEHU  7hH 0HLMHU¶s &RUSRUDtLRQ sXSSRUts sFhRROs E\ UHtXUQLQJ D SRUtLRQ RI TXDOL¿HG FXstRPHU SXUFhDsHs tR thH sFhRRO :hHQ XsLQJ thH 7DUJHt SURJUDP UHPHPEHU tR PHQtLRQ .UHHJHU (OHPHQtDU\ 5HPHPEHU ³(YHU\ OLttOH ELt hHOSs´ 7hDQNs IRU \RXU sXSSRUt *** 0E$3 TE6T,1* 6&+E'8/E 5HDGLQJ 0($3 7Hst IRU *UDGHs - ZLOO EH 2FtoEer th  ±  5HDGLQJ 6HssLRQ , 5HDGLQJ 0($3 7Hst IRU *UDGHs  ±  ZLOO EH 2FtoEer th ±  5HDGLQJ 6HssLRQ ,, :ULtLQJ 0($3 7Hst IRU *UDGH  RQO\ ZLOO EH 2FtoEer th  ±  :ULtLQJ 6HssLRQ ,  ± 0Dth 0($3 7Hst IRU *UDGHs - ZLOO EH 2FtoEer th  ±  0Dth 6HssLRQ :ULtLQJ 0($3 7Hst IRU *UDGH  2FtoEer th  ±  :ULtLQJ 6HssLRQ ,,  ± 6FLHQFH 0($3 7Hst IRU *UDGH  2FtoEer th  ±  6FLHQFH 6HssLRQ *** $ttention Sarents oI students ZhR ULGH )RZOHUYLOOH sFhRRO EXsHs SOHDsH QRtH thDt EXs GURS-RII tLPHs ZLOO EH DSSUR[LPDtHO\ - PLQXtHs ODtHU thDQ XsXDO IRU PRst stXGHQts ZhR OLYH sRXth RI *UDQG 5LYHU $YHQXH thH FHQtHU RI tRZQ  %HJLQQLQJ 0RQGD\ thH LQtHUsHFtLRQ RI *UDQG 5LYHU DQG *UDQG 6tUHHt ZLOO EH FORsHG IRU tZR tR IRXU ZHHNs 7hH DOtHUQDtH URXtLQJ FDXsHG E\ thH FRQstUXFtLRQ DQG GHtRXU ZLOO UHsXOt LQ GHOD\HG GURS-RIIs 3LFN-XS tLPHs shRXOG UHPDLQ IDLUO\ FRQsLstHQt 7hDQN \RX IRU \RXU XQGHUstDQGLQJ thURXJhRXt thLs FRQstUXFtLRQ SURMHFt

)RZOHUYLOOHIRXQGWKHPVHOYHVEDWWOLQJIRUWKHWRSSRVLWLRQ DOOZHHNHQGZLWKDYDULHW\RIVFKRROVEXWUHPDLQHGFRQVLVWHQW DVDGRPLQDWHIRUFH,QWKHHQGWKH\¿QLVKHGRQO\SRLQWV EHKLQGWKHFKDPSLRQVIURP3RUW+XURQ1RUWK2QFHDJDLQ WKHWHDPZLOOHYDOXDWHDQGIRFXVDOLWWOHPRUHDVWKH\PRYHRQ WR6WDWHFRPSHWLWLRQ      7KH  )RZOHUYLOOH +LJK 6FKRRO (TXHVWULDQ 7HDP PHPEHUV LQFOXGH $PEHU *HWFKHOO $OO $URXQG ULGHU DQG JDPHV 6DPDQWKD %ODFN $OO $URXQG ULGHU DQG JDPHV VRSKRPRUH /H[D (O]HUPDQ $OO $URXQG ULGHU DQG JDPHV VRSKRPRUH 3ULVFLOOD 6DGGOHVHDW VRSKRPRUH .D\OD 7ZDUR]\QVNLJDPHVIUHVKPDQ5DFKHO/RQJKL$OO$URXQG ULGHU  JDPHV IUHVKPDQ$YHULH /DWVRQJDPHV DQG MXQLRU 6DEULQD'DLOH\    7KHVH ULGHUV KDYH EHHQ SUHSDULQJ WKHPVHOYHV DQG WKHLU PRXQWV VLQFH $SULO WKLV \HDU ZLWK OHVVRQV WHDP SUDFWLFHV RSHQ KRUVH VKRZV DQG FRQGLWLRQLQJ 7KH WHDP LV FRDFKHG E\6WDFH\)RXQWDLQDQG&KULV:HVWSKDO%HVWRIOXFNDWVWDWH DQG*R*ODGV

&rossroads *rouS oI the 6ierra &luE holding Fall &olor 3hoto :orNshoS -RLQ thH &URssURDGs *URXS RI thH 6LHUUD &OXE RQ 6DtXUGD\ 2FtREHU  IRU D )DOO FRORU GLJLtDO QDtXUH ShRtRJUDSh\ ZRUNshRS ZLth QDtXUDOLst DQG H[SHUt QDtXUH ShRtRJUDShHU 7hRPDs 6FhQHLGHU RQ D )DOO &RORU GULYLQJ tRXU LQ :DtHUORR 6tDtH 5HFUHDtLRQ $UHD 7hLs IXQ IUHH DQG LQIRUPDtLYH RXtLQJ Ls RSHQ tR PHPEHUs QRQPHPEHUs IDPLOLHs stXGHQts EHJLQQHUs DQG H[SHULHQFHG ShRtRJUDShHUs 0HHt Dt thH *HUDOG ( (GG\ 'LsFRYHU\ &HQtHU SDUNLQJ ORt ORFDtHG RQ 3LHUFH 5RDG ZHst RI &hHOsHD Dt $0 )RU PRUH LQIRUPDtLRQ DQG tR 5693 FRQtDFt 7hRPDs 6FhQHLGHU Dt ZLOGEOXHH[SORUDtLRQs#JPDLOFRP

.:1,)A;85 October Happenings

2FW7KH)RZOHUYLOOH&KDSWHU%R\6FRXWV

ZLOO EH DWWHQGLQJ WKH 0DUNHW 3OHDVH FRPH GRZQ DQG MRLQ XV LQ VXSSRUWLQJWKH%R\6FRXWV 2FW3XPSNLQ %DNHRII &RPH GRZQ WR WKH 0DUNHW DQG EULQJ \RXU SXPS NLQFRQFRFWLRQVIRUEUDJJLQJULJKWV DQG ULEERQVFHUWLÀFDWHV 5HJLV WUDWLRQ LV RSHQ XQWLO P -XGJLQJ DQG7DVWLQJZLOOEHJLQSURPSWO\DW SP&RPHMRLQLQWKH)DOO)XQ 2FW7KH/DVW'D\RIWKH0DUNHW6HDVRQ &RPH RXW WR SDUWLFLSDWH LQ RQH RI PDQ\HYHQWVSODQQHGIRUDJUDQGÀ QDOH.LGV·7UHDWLQJWKURXJKRXWWKH 0DUNHW 3XPSNLQ 3DLQWLQJ FRQWHVW DQGPRUH  )RZOHUYLOOH )DUPHUV· 0DUNHW  6XUYH\V ZLOO VRRQ EH UHOHDVHG 3OHDVH EH RQ WKH ORRNRXW IRU WKHVH SDFNHWV IRU \RXU RSSRUWXQLW\ WR YRLFH \RXU RSLQLRQV DQG IHHGEDFN UHJDUGLQJWKH0DUNHW

:illiamston *ruE &rawl Foming 2Ft  tiFNets now on sale

*Ht \RXU tLFNHts tRGD\ IRU thH  :LOOLDPstRQ *UXE &UDZO sFhHGXOHG IRU 2Ft  IURP  tR  SP <RX ZLOO stDUt Dt D UHstDXUDQt LQGLFDtHG RQ \RXU tLFNHt DQG ZLOO thHQ ZDON tR HDFh RI thH RthHU UHstDXUDQts 7hLs *UXE &UDZO HYHQt shRZFDsHs EHDXtLIXO GRZQtRZQ :LOOLDPstRQ DQG Ls D JUHDt RSSRUtXQLt\ IRU IULHQGs IDPLOLHs DQG FR-ZRUNHUs tR JHt tRJHthHU DQG HQMR\ D IXQ-¿OOHG HYHQLQJ ZLth JUHDt IRRG )RU SHUsRQ RU FRXSOH \RX ZLOO EH DEOH tR sDPSOH sLJQDtXUH GLshHs 7hH SDUtLFLSDtLQJ UHstDXUDQts ZLOO DOsR EH RIIHULQJ GULQN sSHFLDOs 7LFNHts DUH DYDLODEOH Dt /LPQHU 3UHss --  6L[ 6tULQJ 3ODFH --  DQG thH &hDPEHU RI¿FH -  &DOO QRZ TXHstLRQs -- LQIR# ZLOOLDPstRQRUJ

Support your Local

Businesses Advertise in the...

FOWLERVILLE NEWS & VIEWS Call

(517) 223-8760 226 E. Grand River Downtown Fowlerville

Do-it-yourself energy. Right in your backyard. If you choose to heat with wood, you know the value of having a readily-available heat source right in your back yard. With the E-Classic’s efficient design and operation, you can heat your entire home, shop and more with up to 70% less wood than other wood-burning appliances.

Westmoreland Construction +LHSLYZOPW5HTL Webberville, *P[`:[H[L MI 517-468-3685 7OVUL5\TILY All E-Classic outdoor wood furnaces adapt easily to new or existing heating systems. It’s important that your outdoor furnace and system be properly sized and installed. See your local dealer for more information. 13-0508

*LU[YHS)VPSLYJVT

If You Want An Experienced, Aggressive & Effective Attorney

NEAL D. NIELSEN & Associates

                      

                       

www.livingstonlawoffices.com SPECIAL DISCOUNTS FOR FOWLERVILLE AREA RESIDENTS

    !   

 

+   2000 Grand River Annex, Suite 200, Brighton

Page 26 â&#x20AC;&#x201C; Fowlerville News & Views â&#x20AC;&#x201C; Sunday, October 6, 2013

Fowlerville Fire U-14 Boys SoccerTeam thanks local businesses for donations

New â&#x20AC;&#x2DC;Rotary Mileâ&#x20AC;&#x2122; sign at Community Park

The start of the â&#x20AC;&#x2DC;Rotary Mileâ&#x20AC;&#x2122; at the Fowlerville Community Park has a new sign, made of aluminum. Signature Signs, a Fowlerville-based business, replaced the original one at no cost to the local club. The blacktop track that circles the park has proven to be a popular spot for runners and walkers and is used daily. Shown here next to the new sign are, from left, Carrie Newstead, president of the club, and Mike Powers and Ben Nekola, both of Signature Signs.

Michigan Senate Report By Joe Hune, 22nd District

Breast Cancer Awareness Month October is Breast Cancer Awareness Month. In view of this I would like to take the opportunity to draw your attention to an organization that helps out victims of cancer wherever they may live. I am talking about Fans for a Cure. Fans for a Cure is an organization that began in 2012 to help Livingston County families with loved ones suffering

CONWAY TOWNSHIP SYNOPSIS OF MEETING APPROVED MINUTES AUGUST 20, 2013

Motions: 1. Call to Order 2. Approve agenda. 3. Approve minutes of July16, 2013 Board meeting. 4. Contact attorney for clariÂżcation on clean-up escrow funds distribution 5. Authorize water test at hall 6. Accept Âżnancial report 7. Reimburse clerk cost of photocopies 8. Approve contract with Pfeffer Hanniford Palka audit company 9. Advertise for snow removal bids 10. Approve disbursements 11. Authorize members to attend MTA conference including reimbursement for appropriate expenses, and require attendee to submit follow-up report 12. Adjourn meeting Meeting adjourned at 8:47 pm. Next meeting October 15, 2013 at 7:30 pm. Complete minutes are available at the Conway Township Hall during regular ofÂżce hours, 8015 N Fowlerville Road, Fowlerville, MI 48836. Cindy Dickerson Conway Township Clerk 10/6/2013

The Fowlerville Fire U-14 Boys Soccer team would like to thank all the local businesses for their donations. The donations helped the boys get new uniforms. Thank you Dukes Pizza, Save-On Foods, Nelsonâ&#x20AC;&#x2122;s Collision, EFC Carpentry, Midtown Services, Kern Road Vet Clinic, Heartland Machine, RLJ Services, SignARama and Sports Apparel for their printing of uniforms. Team members are, front row (L to R): Josh Cecelon, Wyatt Birmingham, Nick Longni, Tanner Mosteller, Payton Johnson, Grant Hibbard; Back row (L to R): Coach Mike Ellerholz, Scout Berry, Nathan Beauchamp, Jacob Crawford, Trevor Hunt, Alex Bowers, Tyler Jenks, Andrew Goodwin, and Hunter McGuire.

from breast cancer, lung cancer and other cancers. The organization helps families by assisting with emotional, moral and Âżnancial support. Fans for a Cure started out as a team name for a local American Cancer Society Relay for Life team in 2010. The team was formed in honor of Cindy Litâ&#x20AC;&#x2122;s late mother, Carol A. McLellan, who lost her battle with breast cancer on Feb. 20, 1993, and Cindyâ&#x20AC;&#x2122;s sister-in-law, Connie McLellan, who at that time was battling breast cancer for the second time in 13 years. On Feb 20, 2013, â&#x20AC;&#x153;Fansâ&#x20AC;? was registered as a 501(c)(3) non-proÂżt organization. This allows them to do much more to help make lives better. Any and all support is very much appreciated in order to keep such a great cause going. Since its inception more than 25 years ago, the National Breast Cancer Awareness Month (NBCAM) is a collaboration of national public service organizations, professional medical associations, and government agencies working together to promote breast cancer awareness, share information on the disease, and provide greater access to services. Although October is designated as National Breast Cancer Awareness Month, NBCAM is dedicated to raising awareness and educating individuals about breast cancer throughout the year. I urge all of my constituents to do all that you can to support those suffering from breast cancer and any other form of the disease. Financial support may not always be possible, but I can guarantee that emotional support in the form of prayers and a hug can encourage individuals facing this battle. For more information or to donate to Fans for a Cure, please visit their website at www.fansforacure.org. For more information on Breast Cancer Awareness Month, please visit www.nbcam.org. As always, feel free to contact my ofÂżce at 1-55--O(+8N(, or email us at Sen-+une#senate.michigan.gov. My staff will be happy to assist you. *** Sen. Joe Hune is chair of the Senate Agriculture Committee. He represents the 22nd state Senate District, which includes Livingston and Shiawassee counties, and the southern part of Ingham County. The Ingham County portion includes Bunkerhill, Leslie, Stockbridge and Vevay townships, and the cities of Leslie and Mason.

9LOODJHRI)RZOHUYLOOH &RQVWUXFWLRQ8SGDWH %HJLQQLQJ0RQGD\2FWREHU WKHLQWHUVHFWLRQRI*UDQG$YHQXHDQG *UDQG 5LYHU $YHQXH ZLOO FORVHG IRU DSSUR[LPDWHO\ZHHNV 3OHDVHIROORZWKH GHWRXUVLJQV$OO EXVLQHVVHVDUHRSHQ GXULQJFRQVWUXFWLRQ

Card of Thanks THANK YOU!! to all who come out on a beautiful fall day, Sept. 29, for the Lisa Hoag Borchard Scholarhship â&#x20AC;&#x2DC;Fun Run & Walkâ&#x20AC;&#x2122;. Your support allows us to give a graduating senior from Webberville High School a $1,000 scholarhship each spring in Lisaâ&#x20AC;&#x2122;s honor. Special thanks to: Carol Stowe of Foolâ&#x20AC;&#x2122;s Gold, Larry Arneth of Wooden Nickel and Gwen Baughman for the delicious breakfast in the high school cafetorium. Also thanks to Webberville Schools and Brian Friddle, superintendent as well as Brad Hitchock, village president of Webberville; Ray and -ayann Ryan, Troy 3erkins, -osh 'e3ue, -anell 3erkins, Nancy 'uncan, the Ingham County Sheriff 'ept.chief, and Signature Signs.

7 Foils for $21

Hair Discoucuts nted $ to

OPEN:

Military &

146 N. Grand Ave.

DAILY

8

Wed & F ri

Tues. through Sat. Senior Discounts

517.223.3320

USE OUR REAR ENTRANCE & CONVENIENT PARKING DURING THE STREET CONSTRUCTION

BIDS FOR SNOW REMOVAL SEASON 2013/2014 Conway Township is now taking bids for the 2013/2014 Snow Removal Season for the Conway Township Parking lot and sidewalks, removal of snow and salting as needed All bids MUST be on Conway Township Snow Removal Bid forms, any bids turned into Conway Township that are not on the Bid Forms will not be considered. Forms can be picked up at the Conway Township OfÂżce during regular ofÂżce hours. Bids will be accepted starting October 8 until October 15th. All bids submitted on Conway Township Snow Removal Bid Form will be reviewed and a decision will be made during the October 15th Board of Trustees meeting. Please contact Cindy Dickerson the Township Clerk during regular business hours, Tuesday 9 am to 3 pm or Wednesday 9 am to 5 pm. Conway Township 8015 N Fowlerville Road Fowlerville Mi 48836 517-223-0358 Cindy Dickerson Conway Township Clerk 10/6/13

Fowlerville News & Views – Sunday, October 6, 2013 – Page 27

)RZOHUYLOOH+LJK+RPHFRPLQJFODVVÀRDWV The Fowlerville High School Àoat building theme for 2013 was Favorite Holidays.

The Float Building Competition was won by the Sophomore class who selected Christmas as their theme. Front Row (L to R) Class Advisor Angie Brown, Josh Bartig, (van ClarN, 0aggie Pritchett, Ja] Reynolds. BacN Row (L to R) *riI¿n Leslie, Hannah Powell, Bailey Brown, Katie Dotson (top), Maya Ludtke (bottom) and Jayni Navarro.

The Freshmen Class picked Thanksgiving as their favorite holiday and won second place with it. Front Row (L to R) Maddie Clough, Tommy Quaine, Carra Burnie, Nate Leonard, Daniel Judd, Braden Shrader.

The Junior Class took third place with their pick of Halloween as their favorite holiday. From (L to R) Class Sponsor Amanda Tomassi, Drew Vielbig, Devin Long and Class Sponsor Jessica Masserant.

The Senior Class took fourth place with their favorite holiday of Veteran’s Day. Front Row (L to R) Kelly Klebba (class sponsor), Sydney Stewart, Emily Quigley, Elaine Kolarchick. Standing in the Back is Jessica Henning. Back Row (L to R) Jade Bennett, Jessica England, Ashley Hammill, Kody Korow, Benson Perry, Shane Harrington.

“Our family serving your family” ‹>H[LY:VM[LULYZService & Installation ‹>H[LY/LH[LYZ(Standard & Tankless) ‹>LSS;HURZ‹:\TW7\TWZ ‹5L^*VUZ[Y\J[PVU‹9LTVKLSPUN

6HQLRU'LVFRXQWV‡+RXU5HSDLUV ED FAIRFIELD MASTER PLUMBER

517-521-3221 Cell 517-404-4150 LICENSED & INSURED

Page 28 – Fowlerville News & Views – Sunday, October 6, 2013

Dick Scott

ALL NEW 2014 JEEP CHEROKEE NOW AVAILABLE TO ORDER

MOTOR MALL

2014 DODGE JOURNEY SXT

Pitch Black, premium cloth seats, auto., air, p/w, p/l, p/mirrors, alum. wheels, Sirius radio, keyless entry. Stk. #D68501 WAS $25,285

Now Only

19,877*

$

OR 36 Month Lease Only

$

ALL NEW 2014 JEEP CHEROKEE NOW AVAILABLE TO ORDER

249

11

mo.**

With $1,999 due at signing • 10,000 miles/year

2014 RAM 1500 BIGHORN CREW CAB 4x4 2013 DODGE DART SXT

True Blue, premium cloth buckets, Rallye Appearance group, SXT Special Edition group, 6 spd. auto., Sirius radio, alum. wheels, keyless entry, loaded. Stk. #D64083. WAS $21,425

Now Only

$

Bright White, 40/20/40 premium cloth bench, remote start and security group, 8 spd. auto., 3.6 V6, alum. chrome clad wheels, p/w, p/l, p/mirrors, p/seat, keyless entry, loaded. Stk. #45302. WAS $39,740

Now Only

16,930*

OR 36 Month Lease Only

29,992*

$

18543 mo.**

$

OR 24 Month Lease Only

With $1,999 due at signing • 10,000 miles/year

21605 mo.**

$

With $1,999 due at signing 10,000 miles/year

2014 JEEP PATRIOT LATITUDE

Bright Silver, premium cloth seats, 6 spd. auto., remote start, heated seats, p/windows, p/locks, p/mirrors, cruise, tilt, alum. wheels, Sirius radio. Stk. #J16017 WAS $23,255

Now Only

$

18,972*

OR 24 Month Lease Only

18103 mo.**

$

With $1,999 due at signing • 10,000 miles/year

2013 CHRYSLER 200 LIMITED

2014 JEEP GRAND CHEROKEE LAREDO 4x4

Brilliant Black, premium cloth seats, 8 spd. auto., 3.6 V6, p/w, p/l, p/mirrors, cruise, tilt, keyless entry, Sirius, alum. wheels, much more. Stk. #J74124 WAS $33,690

Now Only

Dune Clear Coat, cloth seats, 6 spd. manual, Connectivity group, Black Appearance group, air conditioning, Sirius XM radio, much more. Stk. #J70431 WAS $25,745

29,982*

$

OR 36 Month Lease Only

269

$

55

mo.**

$

19,679*

OR 27 Month Lease Only

192

$

83

mo.**

With $1,999 due at signing • 10,000 miles/year

Now Only

22,743*

$

OR 36 Month Lease Only

27817 mo.**

$

With $1,999 due at signing • 10,000 miles/year

With $1,999 due at signing 10,000 miles/year

2014 CHRYSLER TOWN & COUNTRY

Billet Silver, leather 7-passenger seating with Stow & Go, p/sliding Deep Cherry Red, leather seats, 6 spd., auto., 3.6 V6, power doors, p/liftgate, p/seat, p/w, p/l, p/mirrors, keyless entry, alum. sunroof, 18” polished alum. wheels, p/seat, p/w, p/l, p/mirrors, wheels, rear DVD player, touch screen radio w/backup camera, cruise, tilt, heated seats, remote start, much more. Stk. #C26773 loaded. Stk. #C51915 WAS $27,070 WAS $32,055

Now Only

2013 JEEP WRANGLER SPORT 4x4

Now Only

26,849*

$

OR 24 Month Lease Only

24932 mo.**

$

With $1,999 due at signing • 10,000 miles/year

2013 CHRYSLER 300 C

Luxury Brown, leather heated & cooled seats, auto., 5.7 Hemi V8, chrome plated wheels, p/seats w/memory, Navigation, 8.4” touch screen radio w/backup camera, absolutely loaded. Stk. #C28539 WAS $39,190

Now Only

$

31,309*

OR 27 Month Lease Only

26628 mo.**

$

With $1,999 due at signing • 10,000 miles/year

*Plus tax, title, plate, DOC fee and destination charge. Must qualify for returning lessee or Conquest lessee when applicable. 2013 Ram 1500 must qualify for Conquest Trade Assist Bonus. Must qualify for Military Appreciation Bonus. Must provide valid Chrysler employee control #. All rebates to dealer. See dealer for details. **36, 27 & 24 month closed end lease, 10,000 miles per yr. w/approved credit through Chrysler Capital Tier 1 or 2. $1,999 due at inception includes 1st payment, plate transfer & title, DOC fee. Must qualify for select returning lessee on Conquest Lease Cash where applicable. Must qualify for Military Appreciation Bonus. Must provide valid Chrysler employee control #. All payments plus 6% use tax. All rebates to dealer. See dealer for details.

www.DickScott.com

Dick Scott

MOTOR MALL

I-96 and Fowlerville Road, Exit 129 • 3030 Fowlerville Road

1-877-467-4201

SHOWROOM OPEN: Mon. & Thurs. 9 a.m. to 9 p.m. • Tues., Wed. & Fri. 9 a.m. to 6 p.m. • Sat. 10 a.m. to 3 p.m. SERVICE DEPARTMENT OPEN: Mon. & Thurs. 7 a.m. to 8 p.m. • Tues., Wed. & Fri. 7 a.m. to 6 p.m.; Sat. 8 a.m. to 3 p.m. BODY SHOP OPEN: Mon. thru Fri. 8am-6pm


Fowlerville News and Views Online