Issuu on Google+

Tradução da 6ª Edição Americana

Manual de Bioquímica com Correlações Clínicas Thomas M. Devlin

Lançamento 2007 ISBN: 9788521204060 Páginas: 1216 Formato: 21x28 cm Peso: 2.948 kg

CONTEÚDO

|

VII

RESUMO DO CONTEÚDO PARTE I

|

ESTRUTURA DE MACROMOLÉCULAS

1 Estrutura da Célula Eucariótica, 1 2 DNA e RNA: Composição e Estrutura, 23 3 Proteínas I: Composição e Estrutura, 73

PARTE II

|

TRANSMISSÃO DA INFORMAÇÃO

4 Replicação, Recombinação e Reparo do DNA, 132 5 RNA: Transcrição e Processamento, 172 6 Síntese de Proteínas: Tradução e Modificações Pós-Tradução, 197 7 DNA Recombinante e Biotecnologia, 241 8 Regulação da Expressão Gênica, 287

PARTE III

9 10 11 12 13

|

FUNÇÕES DE PROTEÍNAS

Proteínas II: Relações Estrutura-Função em Famílias de Proteínas, 315 Enzimas: Classificação, Cinética e Controle, 358 Citocromos P450 e Óxido Nítrico Sintases, 407 Membranas Biológicas: Estruturas e Transporte em Membranas, 436 Fundamentos da Transdução de Sinal, 483

|

PARTE IV

VIAS METABÓLICAS E SEU CONTROLE

14 Bioenergética e Metabolismo Oxidativo, 521 15 Metabolismo de Carboidratos I: Principais Vias Metabólicas e Seu Controle, 572 16 Metabolismo de Carboidratos II: Vias Especiais e Glicoconjugados, 626 17 Metabolismo de Lipídeos I: Síntese, Armazenamento e Utilização de ácidos Graxos e Triacilgliceróis, 650 18 Metabolismo de Lipídeos II: Vias do Metabolismo de Lipídeos Especiais, 683 19 Metabolismo de aminoácidos, 725 20 Metabolismo de Purina e Pirimidina Nucletídeos, 770 21 Metabolismo do Heme e do Ferro, 803 22 Inter-Relações Metabólicas, 829

PARTE V

|

PROCESSOS FISIOLÓGICOS

23 Bioquímica de Hormônios, 870 24 Biologia Molecular das Células, 925 25 Ciclo Celular, Morte Celular Programada e Câncer, 987 26 Digestão e Absorção de Constituintes Nutricionais Básicos, 1009 27 Princípios de Nutrição I: Macronutrientes, 1043 28 Princípios de Nutrição II: Micronutrientes, 1063

APÊNDICE REVISÃO DE QUÍMICA ORGÂNICA, 1094 GLOSSÁRIO, 1107 ÍNDICE, 1134

BioQ.00 7

22.01.07 16:25:01

CONTEÚDO

|

IX

CONTEÚDO BIBLIOGRAFIA, 69 QUESTÕES E RESPOSTAS, 70 CORRELAÇÕES CLÍNICAS 2.1 Vacinas de DNA, 25 2.2 Uso Diagnóstico de Matrizes (Arrays) de DNA em Medicina e Genética, 38 2.3 Antibióticos Antitumorais que Mudam a Forma do DNA, 42 2.4 Persistência Hereditária de Hemoglobina Fetal, 45 2.5 Telomerase como Alvo para Agentes Anticâncer, 46 2.6 Expansão de Tripletes de DNA repetitivos em Doença Humana, 48 2.7 Topoisomerases no Tratamento de Doença, 52 2.8 Resistência de Staphylococcus à Eritromicina, 65

PREFÁCIO, XXI PREFÁCIO PARA A EDIÇÃO BRASILEIRA, XXIII AGRADECIMENTOS, XXV TRADUTOR E CO-AUTORES, XXVII

|

PARTE I ESTRUTURA DE MACROMOLÉCULAS 1 | ESTRUTURA DA CÉLULA EUCARIÓTICA, 1 1.1

VISÃO GERAL: CÉLULAS E COMPARTIMENTOS CELULARES, 2 1.2 ÁGUA, PH E SOLUTOS: O AMBIENTE AQUOSO DAS CÉLULAS, 3 1.3 COMPOSIÇÃO DE CÉLULAS EUCARIÓTICAS: PAPÉIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS, 11 1.4 INTEGRAÇÃO E CONTROLE DAS FUNÇÕES CELURES, 19 BIBLIOGRAFIA, 20 QUESTÕES E RESPOSTAS, 20 CORRELAÇÕES CLÍNICAS 1.1 Concentração Sangüínea de Bicarbonato na Acidose Metabólica, 10 1.2 Doenças Mitocondriais, 15 1.3 Enzimas Lisossomais e Gota, 16 1.4 Deficiência de Lipase Ácida Lisossomal, 18 1.5 Doenças da Biogênese de Peroxissomos (PBDs), 19

2

E RNA: COMPOSIÇÃO E ESTRUTURA, | DNA 23 2.1 2.2 2.3 2.4 2.5 2.6 2.7

BioQ.00 9

VISÃO GERAL, 24 COMPONENTES ESTRUTURAIS DOS ÁCIDOS NUCLÉICOS: NUCLEOBASES, NUCLEOSÍDEOS E NUCLEOTÍDEOS, 26 ESTRUTURA DO DNA, 28 ORDEM SUPERIOR DA ESTRUTURA DO DNA, 47 SEQÜÊNCIA E FUNÇÃO DO DNA, 57 ESTRUTURA DO RNA, 61 TIPOS DE RNA, 64

3

| 73PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA, 3.1

PAPÉIS FUNCIONAIS DE PROTEÍNAS NO HOMEM, 74 3.2 COMPOSIÇÃO EM AMINOÁCIDOS DE PROTEÍNAS, 75 3.3 PROPRIEDADES DE CARGAS E QUÍMICAS DE AMINOÁCIDOS E PROTEÍNAS, 81 3.4 ESTRUTURA PRIMÁRIA DE PROTEÍNAS, 88 3.5 NÍVEIS SUPERIORES DE ORGANIZAÇÃO PROTEÍCA, 90 3.6 OUTROS TIPOS DE PROTEÍNAS, 97 3.7 DOBRAMENTO (FOLDING) DE PROTEÍNAS DE ESTRUTURAS ALEATÓRIAS PARA SINGULARES: ESTABILIDADE DA PROTEÍNA, 108 3.8 ASPECTOS DINÂMICOS DA ESTRUTURA DE PROTEÍNAS, 115 3.9 CARACTERIZAÇÃO, PURIFICAÇÃO E DETERMINAÇÃO DA ESTRUTURA E ORGANIZAÇÃO DE PROTEÍNAS, 116 BIBLIOGRAFIA, 128 QUESTÕES E RESPOSTAS, 129 CORRELAÇÕES CLÍNICAS 3.1 Proteínas Plasmáticas no Diagnóstico de Doenças, 86

22.01.07 16:25:01

X

|

CONTEÚDO

3.2 Diferenças em Insulinas Usadas em Tratamento de Diabetes Mellitus, 89 3.3 Uma Mutação Não-Conservativa Ocorre em Anemia Falciforme, 90 3.4 Doenças de síntese de Colágeno, 98 3.5 Hiperlipidemias, 103 3.6 Hipolipoproteinemias, 105 3.7 Hemoglobina Glicosilada, HbA1c , 108 3.8 Proteínas Como Agentes Infecciosos: Príons e Encefalopatias Espongiformes Transmissíveis Humanas (TSEs), 110 3.9 Uso de Análise de Aminoácidos em Diagnóstico de Doenças, 121

5

|

5.1 5.2 5.3 5.4 5.5

VISÃO GERAL, 173 MECANISMOS DE TRANSCRIÇÃO, 173 TRANSCRIÇÃO EM EUCARIOTOS, 178 PROCESSAMENTO DE RNA, 184 EXPORTAÇÃO DO RNA E CONTROLE DE QUALIDADE, 191 5.6 RNAs PEQUENOS INIBITÓRIOS, 192 5.7 REPARO DO DNA ACOPLADO À TRANSCRIÇÃO, 192 5.8 NUCLEASES E TURNOVER DO RNA, 193 BIBLIOGRAFIA, 194 QUESTÕES E RESPOSTAS, 195 CORRELAÇÕES CLÍNICAS 5.1 Antibióticos e Toxinas Que Têm RNA Polimerase Como Alvo, 176 5.2 Síndrome do X Frágil: Uma Doença de RNA-Cromatina?, 179 5.3 Envolvimento de Fatores Transcripcionais em Carcinogênese, 182 5.4 Talassemia Devido a Defeitos na Síntese de RNA Mensageiro, 188 5.5 Auto-Imunidade em Doença do Tecico Conjuntivo, 189 5.6 Síndrome de Cockayne, 193

|

PARTE II TRANSMISSÃO DA INFORMAÇÃO 4

|

REPLICAÇÃO, RECOMBINAÇÃO E REPARO DO DNA, 132 CARACTERÍSTICAS COMUNS DA REPLICAÇÃO, RECOMBINAÇÃO E REPARO, 133 4.2 REPLICAÇÃO DO DNA, 133 4.3 RECOMBINAÇÃO, 151 4.4 REPARO, 156 BIBLIOGRAFIA, 169 QUESTÕES E RESPOSTAS, 169 CORRELAÇÕES CLÍNICAS 4.1 Quimioterapia Pode Ter Como Alvos Precursores da Síntese do DNA, 135 4.2 Topoisomerases Como Alvos Para Drogas, 144 4.3 Câncer e o Ciclo Celular, 149 4.4 Análogos de Nucleosídeos e Resistência a Drogas na Terapia do HIV, 149 4.5 Terapia Gênica, 156 4.6 Quimioterapia, Lesão do DNA e Reparo, 157 4.7 Análogos de Nucleosídeos Como Drogas: Tiopurinas, 158 4.8 Medicina Individualizada, 159 4.9 Xeroderma Pigmentoso, 162 4.10 Reparo de Pareamento Errado e Câncer, 164

4.1

BioQ.00 10

RNA: TRANSCRIÇÃO E PROCESSAMENTO, 172

6

|

SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO, 197 6.1 6.2

VISÃO GERAL, 198 COMPONENTES DO APARELHO DE TRADUÇÃO, 198 6.3 BIOSSÍNTESE DE PROTEÍNAS, 209 6.4 AMADURECIMENTO DE PROTEÍNAS: DOBRAMENTO, MODIFICAÇÃO, SECREÇÃO E DIRECIONAMENTO, 218 6.5 DIRECIONAMENTO PARA MEMBRANA E ORGANELAS, 224 6.6 MAIS MODIFICAÇÕES PÓS-TRADUÇÃO, 227 6.7 REGULAÇÃO DA TRADUÇÃO, 234 6.8 DEGRADAÇÃO E TURNOVER DE PROTEÍNAS, 235 BIBLIOGRAFIA, 237 QUESTÕES E RESPOSTAS, 239 CORRELAÇÕES CLÍNICAS 6.1 Mutações Com Sentido Errado: Hemoglobina, 202 6.2 Mutação Gerando Códon de Terminação, 202 6.3 α-Talassemia, 203 6.4 Mudança na Fase de Leitura (Frameshifting) Programada na Biossíntese das Proteínas de HIV, 204

22.01.07 16:25:02

CONTEÚDO

6.5

Mutação em RNA Ribossômico Mitocondrial Resulta em Surdez Induzida por Antibiótico, 217 6.6 Deleção de um Códon, Modificação Pós-Tradução Incorreta e de Gradação Prematura de Proteína: Fibrose Cística, 219 6.7 Dobramento Errado e Agregação de Proteína: Doença de Creuzfeldt-Jacob, Doença da Vaca Louca, Doença de Alzheimer e Doença de Huntington, 220 6.8 Doenças de Função de Lisossomos, 226 6.9 Hiperproinsulinemia Familiar, 229 6.10 Ausência de modificação Pós-Tradução: Deficiência Múltipla de Sulfatases, 230 6.11 Defeitos na Síntese de Colágeno, 233

7

7.1 7.2

BioQ.00 11

XI

7.2 Mapas de Restrição e Evolução, 246 7.3 Seqüenciamento Direto de DNA para o Diagnóstico de Doenças Genéticas, 248 7.4 Análise por PCR Multiplex de Defeitos no Gene de HGPRTase na Síndrome de Lesch-Nyhan, 252 7.5 Polimorfismo de Comprimento de Fragmentos de Restrição Determina a Origem Clonal de Tumores, 257 7.6 Polimorfismo de Conformação de Cadeia-Única para Detecção de Mutações Espontâneas que Podem Levar a SIDS, 259 7.7 Mutagênese Sítio-Dirigida de HSV IgD, 271 7.8 Inibição de HIV Mediada por RNA, 274 7.9 Terapia Gênica: Genes Normais Podem Ser Introduzidos em Células com Genes Defectivos, 276 7.10 Modelos de Animais Transgênicos, 277 7.11 Camundongos Knockout para Definir um Papel para o Purinoceptor P2Y1, 279 7.12 Análise por Microarray de Câncer de Mama, 280

RECOMBINANTE E BIOTECNOLOGIA, | DNA 241 VISÃO GERAL, 242 A REAÇÃO DE POLIMERASE EM CADEIA (POLYMERASE CHAIN REACTION), 243 7.3 ENDONUCLEASES DE RESTRIÇÃO E MAPAS DE RESTRIÇÃO, 243 7.4 SEQÜENCIAMENTO DE DNA, 245 7.5 DNA RECOMBINANTE E CLONAGEM, 248 7.6 SELEÇÃO DE UM DNA ESPECÍFICO CLONADO EM BIBLIOTECAS, 252 7.7 DETECÇÃO E IDENTIFICAÇÃO DE ÁCIDOS NUCLÉICOS E PROTEÍNAS QUE LIGAM DNA, 254 7.8 DNA COMPLEMENTAR E BIBLIOTECAS DE DNA COMPLEMENTAR, 260 7.9 BACTERIÓFAGO, COSMÍDEO E VETORES DE CLONAGEM EM LEVEDURA, 262 7.10 ANÁLISE DE LONGAS SEQÜÊNCIAS DE DNA, 265 7.11 VETORES DE EXPRESSÃO E PROTEÍNAS DE FUSÃO, 265 7.12 VETORES DE EXPRESSÃO EM CÉLULAS EUCARIÓTICAS, 267 7.13 MUTAGÊNESE SÍTIO-DIRIGIDA, 269 7.14 APLICAÇÕES DA TECNOLOGIA DO DNA RECOMBINANTE, 272 7.15 GENÔMICA, PROTEÔMICA E ANÁLISE MICROARRAY, 279 BIBLIOGRAFIA, 283 QUESTÕES E RESPOSTAS, 284 CORRELAÇÕES CLÍNICAS 7.1 Reação de Polimerase em Cadeia (Polymerase Chain Reaction), 245

|

8 | REGULAÇÃO DA EXPRESSÃO GÊNICA, 287 8.1 8.2

VISÃO GERAL, 288 UNIDADE DE TRANSCRIÇÃO EM BACTÉRIAS: O OPERON, 288 8.3 OPERON LACTOSE DE E. COLI, 288 8.4 OPERON TRIPTOFANO DE E. COLI, 293 8.5 OUTROS OPERONS BACTERIANOS, 297 8.6 TRANSPOSONS BACTERIANOS, 299 8.7 EXPRESSÃO GÊNICA EM EUCARIOTOS, 300 8.8 COMPLEXO DE PRÉ-INICIAÇÃO EM EUCARIOTOS: FATORES DE TRANSCRIÇÃO, RNA POLIMERASE II E DNA, 303 8.9 REGULAÇÃO DA EXPRESSÃO GÊNICA EUCARIÓTICA, 308 BIBLIOGRAFIA, 312 QUESTÕES E RESPOSTAS, 312 CORRELAÇÕES CLÍNICAS 8.1 Resistência Transmissível a Múltiplas Drogas, 300 8.2 Síndrome de Rubstein-Taybi, 302 8.3 Tamoxifeno e Receptor de Estrógeno como Alvo, 309 8.4 Fatores de Transcrição e Doença Cardiovascular, 310

22.01.07 16:25:02

XII

|

CONTEÚDO

PARTE III | FUNÇÕES DE PROTEÍNAS 9

|

CORRELAÇÕES CLÍNICAS 10.1 Mutação de um Sítio de Ligação de Coenzima Resulta em Doença Clínica, 371 10.2 Um Caso de Gota Demonstra Duas Fases no Mecanismo de Ação Enzimática, 382 10.3 Efeito Fisiológico de Mudanças nos Valores de Km de Enzimas, 383 10.4 Labilidade Térmica da Glicose-6Fosfato Desidrogenase Resulta em Anemia Hemolítica, 386 10.5 Isoenzimas da Álcool Desidrogenase com Diferentes pHs Ótimos, 386 10.6 Inibidores de Xantina Oxidase Isolados de Plantas, 388 10.7 Planejamento de um Inibidor Seletivo, 390 10.8 Um Caso de Envenenamento, 393 10.9 Cogumelos e Metabolismo de Álcool, 393 10.10 Um Caso de Gota Demonstra a Diferença entre um Sítio Alostérico e um Sítio de Ligação de Substrato, 394 10.11 Identificação e Tratamento de uma Deficiência Enzimática, 400 10.12 Ambigüidade no Ensaio de Enzimas Mutadas, 401

PROTEÍNAS II: RELAÇÕES ESTRUTURAFUNÇÃO EM FAMÍLIAS DE PROTEÍNAS, 315 9.1 9.2

VISÃO GERAL, 316 MOLÉCULAS DE ANTICORPOS: SUPERFAMÍLIA DE PROTEÍNAS IMUNOGLOBULINAS, 316 9.3 PROTEÍNAS COM UM MECANISMO CATALÍTICO COMUM: SERINO PROTEASES, 324 9.4 HEMOGLOBINA E MIOGLOBINA, 334 9.5 O COMPLEXO PROTÉICO DA LÂMINA BASAL, 347 BIBLIOGRAFIA, 355 QUESTÕES E RESPOSTAS, 355 CORRELAÇÕES CLÍNICAS 9.1 As Proteínas do Complemento, 319 9.2 Funções de Diferentes Classes de Anticorpos, 319 9.3 Imunização, 320 9.4 Formação de Fibrina em um Infarto do Miocárdio e Uso de Ativador de Plasminogênio Tecidual Recombinante (rt-PA), 326 9.5 Envolvimento de Serino Proteases em Metástase de Células Tumorais, 326 9.6 Hemoglobinopatias, 335

10

ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E | CONTROLE, 358 10.1 VISÃO GERAL, 359 10.2 CLASSIFICAÇÃO DE ENZIMAS, 360 10.3 CONCEITOS GERAIS DE MECANISMOS ENZIMÁTICOS, 363 10.4 SÍTIO ATIVO DE UMA ENZIMA, 368 10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES, 371 10.6 CINÉTICA DE REAÇÕES QUÍMICAS, 376 10.7 CINÉTICA ENZIMÁTICA DE REAÇÕES DE UM SUBSTRATO, 379 10.8 CINÉTICA DE REAÇÕES DE DOIS SUBSTRATOS, 387 10.9 INIBIDORES, 388 10.10 REGULAÇÃO DE ATIVIDADE ENZIMÁTICA, 394 10.11 REGULAÇÃO DE VIAS METABÓLICAS, 398 10.12 APLICAÇÕES CLÍNICAS DE ENZIMAS, 399 BIBLIOGRAFIA, 404 QUESTÕES E RESPOSTAS, 404

BioQ.00 12

11

CITOCROMOS P450 E ÓXIDO NÍTRICO | SINTASES, 407 11.1 VISÃO GERAL, 408 11.2 CITOCROMOS P450: PROPRIEDADES E FUNÇÃO, 408 11.3 CICLO DE REAÇÃO DO CITOCROMO P450, 409 11.4 SISTEMAS DE TRANSPORTE DE ELÉTRONS DOS CITOCROMOS P450, 410 11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS, 412 11.6 CITOCROMOS P450: SUBSTRATOS E FUNÇÕES FISIOLÓGICAS, 413 11.7 CITOCROMOS P450 PARTICIPAM DE SÍNTESE DE HORMÔNIOS ESTERÓIDES E DE OXIGENAÇÃO DE COMPOSTOS ENDÓGENOS, 414 11.8 INDUÇÃO E INIBIÇÃO DE CITOCROMO P450, 423 11.9 AS ÓXIDO NÍTRICO SINTASES: PROPRIEDADES E FUNÇÃO, 425 11.10 ISOFORMAS DE ÓXIDO NÍTRICO SINTASES E FUNÇÕES FISIOLÓGICAS 428 BIBLIOGRAFIA, 432 QUESTÕES E RESPOSTAS, 434

22.01.07 16:25:03

CONTEÚDO

CORRELAÇÕES CLÍNICAS 11.1 Hiperplasia Adrenal Congênita: Deficiência de CYP21A2, 416 11.2 Produção de Hormônios Esteróides Durante a Gestação, 418 11.3 Inibição de Citocromo P450: Interações Droga-Droga e Efeitos Adversos, 420 11.4 Papel de CYP2E1 em Toxicidade Hepática Induzida por Acetaminofen, 422 11.5 Indução de Citocromo P450: Interações Droga-Droga e Efeitos Adversos, 423 11.6 Polimorfismos Genéticos das Enzimas P450, 426 11.7 Mecanismo de Ação de Sildenafil, 430 11.8 Aspectos Clínicos da Produção de Óxido Nítrico, 431 11.9 História da Nitroglicerina, 432

12

MEMBRANAS BIOLÓGICAS: ESTRUTURA E | TRANSPORTE EM MEMBRANAS, 436 12.1 VISÃO GERAL, 437 12.2 COMPOSIÇÃO QUÍMICA DE MEMBRANAS, 438 12.3 MICELAS, BICAMADAS LIPÍDICAS E LIPOSSOMOS, 445 12.4 ESTRUTURA DE MEMBRANAS BIOLÓGICAS, 447 12.5 MOVIMENTO DE MOLÉCULAS ATRAVÉS DE MEMBRANAS, 456 12.6 CANAIS DE MEMBRANAS, 458 12.7 TRANSPORTADORES DE MEMBRANA, 466 12.8 TRANSPORTE PASSIVO, 468 12.9 TRANSPORTE ATIVO, 469 12.10 IONÓFOROS, 478 BIBLIOGRAFIA, 479 QUESTÕES E RESPOSTAS, 480 CORRELAÇÕES CLÍNICAS 12.1 Lipossomos como Carregadores de Drogas e Enzimas, 447 12.2 Anomalias na Fluidez de Membranas Celulares em Doenças, 454 12.3 Fibrose Cística e o Canal de Cl –, 460 12.4 O Rim de Mamíferos e Aquaporinas, 462 12.5 Doenças Envolvendo a Superfamília de Transportadores ABC, 475 12.6 Doenças que se Devem à Perda de Sistemas de Transporte de Membranas, 476

BioQ.00 13

13

|

XIII

FUNDAMENTOS DA TRANSDUÇÃO DE | SINAL, 483 13.1 VISÃO GERAL, 484 13.2 TRANSDUÇÃO DE SINAL INTERCELULAR, 485 13.3 RECEPTORES PARA MOLÉCULAS SECRETADAS, 487 13.4 TRANSDUÇÃO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFÍCIE CELULAR, 488 13.5 RECEPTORES CANAIS IÔNICOS LIGANTEDEPENDENTES, 493 13.6 RECEPTORES LIGADOS A ENZIMAS, 496 13.7 RECEPTORES DE CITOCINAS, 500 13.8 RECEPTORES ACOPLADOS A PROTEÍNA G, 500 13.9 TRANSDUÇÃO DE SINAL BASEADA EM AMP CÍCLICO, 506 13.10 TRANSDUÇÃO DE SINAL BASEADA EM GMP CÍCLICO, 509 13.11 TRANSDUÇÃO DE SINAL BASEADA EM CÁLCIO, 512 13.12 TRANSDUÇÃO DE SINAL BASEADA EM FOSFOLIPÍDEOS, 514 BIBLIOGRAFIA, 517 QUESTÕES E RESPOSTAS, 518 CORRELAÇÕES CLÍNICAS 13.1 Família de Receptores Tirosina Quinases ErbB/HER como Alvos para Quimioterapia do Câncer, 498 13.2 Receptores de Quimiocinas Acoplados a Proteína G como Alvos para o Vírus da Imunodeficiência Humana (HIV), 502 13.3 Mutações em Proteína G Gsα em Tumores de Glândula Pituitária e Doenças Endócrinas, 504 13.4 Alterações em Proteínas Sinalizadoras de Receptor βAdrenérgico em Insuficiência Cardíaca Congestiva, 507 13.5 Eixos Sinalizadores Óxido Nítrico/ cGMP como Alvos Terapêuticos em Doenças Cardíacas e Vasculares, 511

22.01.07 16:25:03

XIV

|

CONTEÚDO

|

PARTE IV VIAS METABÓLICAS E SEU CONTROLE 14

E METABOLISMO | BIOENERGÉTICA OXIDATIVO, 521 14.1 SISTEMAS DE PRODUÇÃO E DE UTILIZAÇÃO DE ENERGIA, 522 14.2 RELAÇÕES TERMODINÂMICAS E COMPONENTES RICOS EM ENERGIA, 524 14.3 FONTES E DESTINOS DA ACETILCOENZIMA A, 529 14.4 CICLO DOS ÁCIDOS TRICARBOXÍLICOS, 534 14.5 ESTRUTURA E COMPARTIMENTALIZAÇÃO POR MEMBRANAS MITOCONDRIAIS, 540 14.6 CADEIA DE TRANSPORTE DE ELÉTRONS, 542 14.7 FOSFORILAÇÃO OXIDATIVA, 553 14.8 MEMBRANA MITOCONDRIAL INTERNA CONTÉM SISTEMAS DE TRANSPORTE DE SUBSTRATO 559 14.9 GENES MITOCONDRIAIS E DOENÇAS, 563 14.10 ESPÉCIES REATIVAS DE OXIGÊNIO (ROS), 565 BIBLIOGRAFIA, 568 QUESTÕES E RESPOSTAS, 569 CORRELAÇÕES CLÍNICAS 14.1 Deficiência de Piruvato Desidrogenase, 533 14.2 Deficiência de Fumarase, 537 14.3 Envenenamento por Cianeto, 552 14.4 Neuropatia Óptica Hereditária de Leber, 564 14.5 Miopatias Mitocondriais Devido a Mutações em Genes de tRNA, 564 14.6 Intolerância a Exercício em Pacientes com Mutações no Citocromo b, 565 14.7 Lesão por Isquemia/Reperfusão, 567

15

|

METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE, 572 15.1 VISÃO GERAL, 573 15.2 GLICÓLISE, 574 15.3 VIA GLICOLÍTICA, 577 15.4 REGULAÇÃO DA GLICÓLISE, 584 15.5 GLUCONEOGÊNESE, 597

BioQ.00 14

15.6 GLICOGENÓLISE E GLICOGÊNESE, 609 BIBLIOGRAFIA, 623 QUESTÕES E RESPOSTAS, 623 CORRELAÇÕES CLÍNICAS 15.1 Álcool e Barbituratos, 584 15.2 Envenenamento por Arsênico, 585 15.3 Intolerância à Frutose, 587 15.4 Diabetes Mellitus, 589 15.5 Acidose Láctica, 591 15.6 “Picles” de Porco e Hipertermia Maligna, 592 15.7 Angina Pectoris e Infarto do Miocárdio, 593 15.8 Deficiência de Piruvato Quinase e Anemia Hemolítica, 598 15.9 Hipoglicemia e Crianças Prematuras, 599 15.10 Hipoglicemia e Intoxicação Alcoólica, 608 15.11 Doenças de Armazenamento de Glicogênio, 612

16

|

METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS, 626 16.1 VISÃO GERAL, 627 16.2 VIA DAS PENTOSES FOSFATO, 627 16.3 INTERCONVERSÕES DE AÇÚCARES E FORMAÇÃO DE NUCLEOTÍDEOAÇÚCAR, 631 16.4 BIOSSÍNTESE DE CARBOIDRATOS COMPLEXOS, 637 16.5 GLICOPROTEÍNAS, 638 16.6 PROTEOGLICANOS, 642 BIBLIOGRAFIA, 647 QUESTÕES E RESPOSTAS, 647 CORRELAÇÕES CLÍNICAS 16.1 Glicose 6-Fosfato Desidrogenase: Deficiência Genética ou presença de Variantes Genéticas em Eritrócitos, 629 16.2 Síndrome de Wernicke-Korsakoff: Deficiência ou Presença de Variantes Genéticos de Transcetolase, 629 16.3 Síndromes de Glicoproteínas Deficientes em Carboidratos (CDGS), 632 16.4 Frutosúria Essencial e Intolerância à Frutose: Deficiência de Frutoquinase e de Frutose 1-Fosfato Aldolase, 633 16.5 Galactosemia: Incapacidade de Transformar Galactose em Glicose, 634

22.01.07 16:25:04

CONTEÚDO

16.6 Pentosúria: Deficiência de Xilitol Desidrogenase, 635 16.7 Ácido Glucurônico: Significado Fisiológico da Formação de Glucuronídeos, 635 16.8 Substâncias dos Grupos Sangüíneos, 638 16.9 Carboidrato Marcador Comum do Direcionamento Lisossomal e Doença da Célula I, 640 16.10 Aspartilglicosilaminúria: Ausência de 4-L-Aspartilglicosamina Amidohidrolase, 641 16.11 Doenças de Glicolipídeos, 642 16.12 Heparina é um Anticoagulante, 643 16.13 Condrodistrofias Devidas a Defeitos de Sulfatação, 645 16.14 Mucopolissacaridoses, 646

17

|

METABOLISMO DE LIPÍDEOS I: SÍNTESE, ARMAZENAMENTO E UTILIZAÇÃO DE ÁCIDOS GRAXOS E TRIACILGLICERÓIS, 650 17.1 VISÃO GERAL, 651 17.2 NATUREZA QUÍMICA DE ÁCIDOS GRAXOS E ACILGLICERÓIS, 652 17.3 TRANSPORTE INTERÓRGÃOS DE ÁCIDOS GRAXOS E SEUS PRODUTOS PRIMÁRIOS, 656 17.4 SÍNTESE DE ÁCIDOS GRAXOS: LIPOGÊNESE, 657 17.5 ARMAZENAMENTO DE ÁCIDOS GRAXOS COMO TRIACILGLICERÓIS, 665 17.6 UTILIZAÇÃO DE ÁCIDOS GRAXOS PARA PRODUÇÃO DE ENERGIA, 667 17.7 REGULAÇÃO DO METABOLISMO DE LIPÍDEOS, 679 BIBLIOGRAFIA, 680 QUESTÕES E RESPOSTAS, 681 CORRELAÇÕES CLÍNICAS 17.1 Obesidade, 654 17.2 Papel do Metabolismo de Ácidos Graxos em Diabetes Tipo 2, 655 17.3 Ciclo Triacilglicerol/Ácido Graxo, 668 17.4 Deficiências Genéticas no Transporte por Carnitina ou na Carnitina Palmitoil Transferase, 670 17.5 Deficiências Genéticas das Acil-CoA Desidrogenases, 672 17.6 Doença de Refsum, 675 17.7 Corpos Cetônicos como Combustíveis: A Dieta Atkins, 677

BioQ.00 15

18

|

|

XV

METABOLISMO DE LIPÍDEOS II: VIAS DO METABOLISMO DE LIPÍDEOS ESPECIAIS, 683 18.1 18.2 18.3 18.4 18.5

VISÃO GERAL, 684 FOSFOLIPÍDEOS, 684 COLESTEROL, 694 ESFINGOLIPÍDEOS, 706 PROSTAGLANDINAS E TROMBOXANES, 714 18.6 LIPOXIGENASE E ÁCIDOS OXIEICOSATETRAENÓICOS, 718 BIBLIOGRAFIA, 721 QUESTÕES E RESPOSTAS, 722 CORRELAÇÕES CLÍNICAS 18.1 Síndrome do Desconforto Respiratório, 687 18.2 Tratamento da Hipercolesterolemia, 703 18.3 Aterosclerose, 704 18.4 Diagnóstico da Doença de Gaucher em um Adulto, 713

19 | METABOLISMO DE AMINOÁCIDOS, 725 19.1 VISÃO GERAL, 726 19.2 INCORPORAÇÃO DE NITROGÊNIO EM AMINOÁCIDOS, 727 19.3 TRANSPORTE DE NITROGÊNIO PARA FÍGADO E RIM, 732 19.4 CICLO DA URÉIA, 733 19.5 SÍNTESE E DEGRADAÇÃO DE AMINOÁCIDOS INDIVIDUAIS, 736 BIBLIOGRAFIA, 766 QUESTÕES E RESPOSTAS, 767 CORRELAÇÕES CLÍNICAS 19.1 Deficiências de Carbamoil Fosfato Sintetase e N-Acetilglutamato Sintetase, 736 19.2 Deficiências de Enzimas do Ciclo da Uréia, 738 19.3 Doenças do Metabolismo de Prolina, 739 19.4 Selenoproteínas, 740 19.5 Hiperglicinemia Não-Cetótica, 741 19.6 Deficiência de Ácido Fólico, 743 19.7 Fenilcetonúria, 745 19.8 Doenças do Metabolismo de Tirosina, 747 19.9 Mal de Parkinson, 748 19.10 Hiper-homocisteinemia e Aterogênese, 751 19.11 Doenças de Aminoácidos que Contêm Enxofre, 752 19.12 Acidúria Glutárica, 756 19.13 Esquizofrenia e Outras Doenças Associadas a Neurotransmissores Derivados de Triptofano, 757

22.01.07 16:25:04

XVI

|

CONTEÚDO

19.14 Doenças do Metabolismo de Aminoácidos de Cadeia Ramificada, 757 19.15 Doenças do Metabolismo de Propionato e Metilmalonato, 760 19.16 Doenças Envolvendo Lisina e Ornitina, 762 19.17 Histidinemia, 762 19.18 Doenças do Metabolismo de Folato, 764

20

DE PURINA E PIRIMIDINA | METABOLISMO NUCLEOTÍDEOS, 770 20.1 VISÃO GERAL, 771 20.2 FUNÇÕES METABÓLICAS DOS NUCLEOTÍDEOS, 771 20.3 METABOLISMO DE PURINA NUCLEOTÍDEOS, 772 20.4 METABOLISMO DE PIRIMIDINA NUCLEOTÍDEOS, 783 20.5 FORMAÇÃO DE DESOXIRRIBONUCLEOTÍDEOS, 786 20.6 NUCLEOSÍDEO E NUCLEOTÍDEO QUINASES, 789 20.7 ENZIMAS QUE METABOLIZAM NUCLEOTÍDEOS COM UMA FUNÇÃO EM CICLO CELULAR E TAXA DE DIVISÃO CELULAR, 790 20.8 SÍNTESE DE COENZIMAS NUCLEOTÍDEOS, 791 20.9 SÍNTESE E UTILIZAÇÃO DE 5-FOSFORRIBOSIL-1-PIROFOSFATO, 791 20.10 AGENTES QUIMIOTERÁPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS, 793 BIBLIOGRAFIA, 799 QUESTÕES E RESPOSTAS, 800 CORRELAÇÕES CLÍNICAS 20.1 Gota, 777 20.2 Síndrome de Lesch-Nyhan, 779 20.3 Atividade Aumentada da 5’Nucleotidase Citosólica, 781 20.4 Doenças com Imunodeficiências Associadas com Defeitos na Degradação de Purina Nucleosídeos, 782 20.5 Pacientes com Câncer em Tratamento por Radiações ou Quimioterapia, 783 20.6 Subclasses de Pacientes com Autismo, 783 20.7 Acidúria Orótica Hereditária, 785

BioQ.00 16

21

METABOLISMO DO HEME E DO FERRO, | 803 21.1 METABOLISMO DO FERRO: VISÃO GERAL, 804 21.2 PROTEÍNAS QUE CONTÊM FERRO, 804 21.3 ABSORÇÃO INTESTINAL DE FERRO, 807 21.4 REGULAÇÃO MOLECULAR DA UTILIZAÇÃO DE FERRO, 808 21.5 DISTRIBUIÇÃO E CINÉTICA DO FERRO, 811 21.6 BIOSSÍNTESE DE HEME, 813 21.7 CATABOLISMO DE HEME, 821 BIBLIOGRAFIA, 826 QUESTÕES E RESPOSTAS, 827 CORRELAÇÕES CLÍNICAS 21.1 Sobrecarga de Ferro e Infecção, 805 21.2 Patogenicidade Microbiana e Ferro, 805 21.3 Síntese do Grupo Ferro-Enxofre e Doença Humana, 807 21.4 Ataxia de Friedreich, 807 21.5 Absorção Duodenal de Ferro, 809 21.6 Elementos de Resposta ao Ferro Mutante, 811 21.7 Deficiência de Ceruloplasmina, 812 21.8 Anemia por Deficiência de Ferro, 812 21.9 Hemocromatose Tipo I: Genética Molecular e a Questão das Dietas Enriquecidas em Ferro, 814 21.10 Hemocromatose Tipo III, 814 21.11 Porfiria Intermitente Aguda, 817 21.12 Papel Citoprotetor de Heme Oxigenase, 822 21.13 Hemólise Isoimune Neonatal, 824 21.14 Deficiência de Bilirrubina UDPGlucuronosiltransferase, 824 21.15 Elevação de Bilirrubina Conjugada no Soro, 825

22 | INTER-RELAÇÕES METABÓLICAS, 829 22.1 VISÃO GERAL, 830 22.2 CICLO JEJUM-ALIMENTAÇÃO, 830 22.3 MECANISMOS ENVOLVIDOS NA MUDANÇA DO METABOLISMO HEPÁTICO ENTRE OS ESTADOS BEMALIMENTADO E DE JEJUM, 843 22.4 INTER-RELAÇÕES METABÓLICAS DE TECIDOS EM VÁRIOS ESTADOS NUTRICIONAIS E HORMONAIS, 852 BIBLIOGRAFIA, 866 QUESTÕES E RESPOSTAS, 868

22.01.07 16:25:05

CONTEÚDO

CORRELAÇÕES CLÍNICAS 22.1 Obesidade, 831 22.2 Subnutrição Protéica, 832 22.3 Jejum, 833 22.4 Síndrome de Reye, 837 22.5 Coma Hiperglicêmico, Hiperosmolar, 841 22.6 Hiperglicemia e Glicação de Proteínas, 841 22.7 Diabetes Mellitus Tipo 2, 855 22.8 Diabetes Mellitus Tipo 1, 857 22.9 Via do Poliol e Complicações do Diabetes, 857 22.10 Caquexia do Câncer, 858

PARTE V

|

PROCESSOS FISIOLÓGICOS

23 | BIOQUÍMICA DE HORMÔNIOS, 870 23.1 VISÃO GERAL, 871 23.2 HORMÔNIOS E O SISTEMA DE CASCATA HORMONAL, 872 23.3 SÍNTESE DE HORMÔNIOS POLIPEPTÍDICOS E HORMÔNIOS DERIVADOS DE AMINOÁCIDOS, 875 23.4 PROTEÍNAS DE SINALIZAÇÃO HORMONAL, 883 23.5 RECEPTORES DE HORMÔNIOS DE MEMBRANA, 891 23.6 CASCATA HORMONAL INTRACELULAR: PROTEÍNAS QUINASES, 894 23.7 HORMÔNIOS ESTERÓIDES, 902 23.8 RECEPTORES DE HORMÔNIOS ESTERÓIDES, 914 BIBLIOGRAFIA, 921 QUESTÕES E RESPOSTAS, 922 CORRELAÇÕES CLÍNICAS 23.1 Testando a Atividade da Pituitária Anterior, 875 23.2 Hipopituitarismo, 879 23.3 Atividade Reduzida do Receptor de Insulina Quinase no Diabetes Mellitus Gestacional, 897 23.4 Contracepção Oral, 913 23.5 Síndrome do Excesso Aparente de Mineralocorticóide, 917 23.6 Mutação no Receptor de Mineralocorticóide Resulta em Hipertensão e Toxemia da Gravidez, 919

BioQ.00 17

24

|

XVII

BIOLOGIA MOLECULAR DAS CÉLULAS, | 925 24.1 VISÃO GERAL, 926 24.2 TECIDO NERVOSO: METABOLISMO E FUNÇÃO, 926 24.3 OLHO: METABOLISMO E VISÃO, 938 24.4 MOTORES MOLECULARES E PROTEÍNAS ASSOCIADAS, 952 24.5 MECANISMO DA COAGULAÇÃO DO SANGUE, 967 BIBLIOGRAFIA, 983 QUESTÕES E RESPOSTAS, 984 CORRELAÇÕES CLÍNICAS 24.1 Síndrome Miastênica de LambertEaton, 933 24.2 Miastenia Gravis: Uma Doença Neuromuscular, 935 24.3 Degeneração da Mácula e Perda de Visão, 942 24.4 Doença de Niemann-Pick e Retinite Pigmentosa, 942 24.5 Retinite Pigmentosa por Mutação do Gene da Periferina, 944 24.6 Amaurose Congênita de Leber: Distrofia da Retina Levando a Cegueira, 949 24.7 Glicação e Estrutura e Função de Miosina, 956 24.8 Cardiomiopatias Hipertróficas Familiares e Mutações em Proteínas Musculares, 957 24.9 Cardiomiopatia Dilatada e Mutações em Actina, 958 24.10 Subunidades da Troponina como Marcadores de Infarto do Miocárdio, 961 24.11 Canelopatias de Íons VoltagemDependentes, 962 24.12 Canais Iônicos e Doença do Músculo Cardíaco, 962 24.13 Mutações Afetando Pigmentação: Existe uma Conexão com Motor Molecular?, 965 24.14 Defeitos da Via Intrínseca: Deficiência de Pré-calicreína, 970 24.15 Hemofilia Clássica, 974 24.16 Uso de Fator VIIa Recombinante para Controlar Sangramento, 975 24.17 Trombose: Defeitos na Via da Proteína C e Níveis Aumentados de Fatores da Coagulação, 979

22.01.07 16:25:05

XVIII 25

|

CONTEÚDO

CELULAR, MORTE CELULAR | CICLO PROGRAMADA E CÂNCER, 987

27

25.1 VISÃO GERAL, 988 25.2 CICLO CELULAR, 988 25.3 APOPTOSE: MORTE CELULAR PROGRAMADA, 993 25.4 CÂNCER, 997 BIBLIOGRAFIA, 1005 QUESTÕES E RESPOSTAS, 1007 CORRELAÇÕES CLÍNICAS 25.1 Vírus Oncogênicos de DNA, 999 25.2 Droga Anti-Câncer Molecularmente Dirigida, 1002 25.3 Causa Ambiental de Cânceres Humanos, 1003

26

|

27.1 27.2 27.3 27.4

VISÃO GERAL, 1044 METABOLISMO ENERGÉTICO, 1044 METABOLISMO DE PROTEÍNAS, 1045 DESNUTRIÇÃO PROTÉICO-ENERGÉTICA, 1048 27.5 EXCESSIVA INGESTÃO PROTÉICOENERGÉTICA, 1050 27.6 CARBOIDRATOS, 1051 27.7 GORDURAS, 1051 27.8 FIBRAS, 1052 27.9 COMPOSIÇÃO DOS MACRONUTRIENTES DA DIETA, 1054 BIBLIOGRAFIA, 1059 QUESTÕES E RESPOSTAS, 1060 CORRELAÇÕES CLÍNICAS 27.1 Dietas Vegetarianas e Necessidades Protéico-Energéticas para Crianças, 1047 27.2 Ingestão de Proteínas na Dieta e Doença Renal, 1048 27.3 Oferecendo Proteínas e Calorias Adequadas a Pacientes Hospitalizados, 1049 27.4 Carga de Carboidratos e Resistência Atlética, 1052 27.5 Dietas Ricas em Carboidratos Versus Dietas Ricas em Gorduras para Diabéticos, 1053 27.6 Ácidos Graxos Poliinsaturados e Fatores de Risco para Doença Cardíaca, 1055 27.7 Adaptação Metabólica: Relação entre Ingestão de Carboidratos e Triacilgliceróis no Soro, 1059

DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS, 1009 VISÃO GERAL, 1010 CONSIDERAÇÕES GERAIS, 1012 TRANSPORTE EPITELIAL, 1016 DIGESTÃO E ABSORÇÃO DE PROTEÍNAS, 1024 26.5 DIGESTÃO E ABSORÇÃO DE CARBOIDRATOS, 1028 26.6 DIGESTÃO E ABSORÇÃO DE LIPÍDEOS, 1031 26.7 METABOLISMO DE ÁCIDOS BILIARES, 1037 BIBLIOGRAFIA, 1040 QUESTÕES E RESPOSTAS, 1040 CORRELAÇÕES CLÍNICAS 26.1 Cloridorréia Familiar Causa Alcalose Metabólica, 1017 26.2 Fibrose Cística, 1020 26.3 Diarréias Toxigênicas Bacterianas e Terapia de Reposição de Eletrólitos, 1021 26.4 Aminoacidúria Neutra: Doença de Hartnup, 1026 26.5 Deficiência de Dissacaridases, 1030 26.6 Intervenções Farmacológicas para Evitar Absorção de Gordura e Obesidade, 1033 26.7 Cálculos de Colesterol, 1036 26.8 A-β-Lipoproteinemia, 1038

26.1 26.2 26.3 26.4

BioQ.00 18

DE NUTRIÇÃO I: | PRINCÍPIO MACRONUTRIENTES, 1043

28

DE NUTRIÇÃO II: | PRINCÍPIO MICRONUTRIENTES, 1063 28.1 VISÃO GERAL, 1064 28.2 AVALIAÇÃO DE MÁ NUTRIÇÃO, 1064 28.3 INGESTÃO DIETÉTICAS DE REFERÊNCIAS, 1064 28.4 VITAMINAS LIPOSSOLÚVEIS, 1066 28.5 VITAMINAS HIDROSSOLÚVEIS, 1073 28.6 VITAMINAS HIDROSSOLÚVEIS LIBERADORAS DE ENERGIA, 1074 28.7 VITAMINAS HIDROSSOLÚVEIS HEMATOPOIÉTICAS, 1079 28.8 OUTRAS VITAMINAS HIDROSSOLÚVEIS, 1082 28.9 MACROMINERAIS, 1084 28.10 MINERAIS TRAÇOS, 1084

22.01.07 16:25:05

CONTEÚDO

28.11 DIETA AMERICANA: FATO E FALÁCIA, 1087 28.12 AVALIAÇÃO DO ESTADO NUTRICIONAL NA PRÁTICA CLÍNICA, 1087 BIBLIOGRAFIA, 1089 QUESTÕES E RESPOSTAS, 1091 CORRELAÇÕES CLÍNICAS 28.1 Considerações Nutricionais na Fibrose Cística, 1068 28.2 Osteodistrofia Renal, 1069 28.3 Considerações Nutricionais em Recém-Nascidos, 1073 28.4 Drogas Anticonvulsivantes e Necessidades Vitamínicas, 1074

BioQ.00 19

|

XIX

28.5 Considerações Nutricionais em Alcoólatras, 1076 28.6 Necessidades de Vitamina B6 em Usuários de Contraceptivos Orais, 1078 28.7 Polimorfirmos Genéticos e Necessidades de Ácido Fólico, 1081 28.8 Dieta e Osteoporose, 1085 28.9 Necessidades Nutricionais de Idosos, 1089

APÊNDICE REVISÃO DE QUÍMICA ORGÂNICA, 1094 GLOSSÁRIO, 1107 ÍNDICE, 1134

22.01.07 16:25:06

CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA

|

1

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS �–

O

H �+

104.5o

H �+

1

ESTRUTURA DA CÉLULA EUCARIÓTICA Thomas M. Devlin

1.1

VISÃO GERAL: CÉLULAS E COMPARTIMENTOS CELULARES, 2

1.2 ÁGUA, pH E SOLUTOS: O AMBIENTE AQUOSO DAS CÉLULAS, 3 Pontes de hidrogênio formam-se entre moléculas de água, 3 Água tem propriedades singulares como solvente, 4 Algumas moléculas dissociam-se formando cátions e ânions, 5 Água é um eletrólito fraco, 6 Muitas moléculas biologicamente importantes são ácidos ou bases fracos, 6 Ácido carbônico, 7 Equação de Henderson-Hasselbalch define a relação entre pH e concentrações de ácido e base conjugados, 8 Tamponamento é importante para controlar o pH, 9 1.3 COMPOSIÇÃO DE CÉLULAS EUCARIÓTICAS: PAPÉIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS, 11 Composição química geral das células, 12 Papel funcional de organelas subcelulares e sistemas de membranas, 13 Membrana Plasmática é a fronteira de uma célula, 13 Núcleo é local de síntese de DNA e RNA, 13

BioQ.01 1

Retículo endoplasmático participa da síntese protéica e de muitas vias de síntese, 13 Complexo de Golgi está envolvido na secre��ão de proteínas, 14 Mitocôndria fornece a maior parte do ATP de que a célula necessita, 14 Lisossomos são necessários para digestão intracelular, 15 Peroxissomos desempenham papel importante no metabolismo de lipídeos, 17 Citoesqueleto organiza o conteúdo intracelular, 18 Citosol contém componentes celulares solúveis, 18 1.4 INTEGRAÇÃO E CONTROLE DAS FUNÇÕES CELULARES, 19 BIBLIOGRAFIA, 20 QUESTÕES E RESPOSTAS, 20 CORRELAÇÕES CLÍNICAS 1.1 Concentração Sangüínea de Bicarbonato na Acidose Metabólica, 10 1.2 Doenças Mitocondriais, 15 1.3 Enzimas Lisossomais e Gota, 16 1.4 Deficiência de Lipase Ácida Lisossomal, 18 1.5 Doenças da Biogênese de Peroxissomos (PBDs), 19

22.01.07 16:09:40

|

CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA

1.3 COMPOSIÇÃO DE CÉLULAS EUCARIÓTICAS: PAPÉIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS Células eucarióticas contêm organelas celulares bem definidas, como núcleo, mitocôndrias, lisossomos e peroxissomos, todos delimitados por uma membrana (Figura 1.9). Membranas formam uma rede tubular por toda a célula, o retículo endoplasmático e o complexo de Golgi, englobando um espaço interconectado ou cisternas, respectivamente. A natureza lipídeo-proteína das membranas celulares (ver p. 455) impede rápido movimento de muitas moléculas, incluindo água, de um compartimento para outro. Mecanismos específicos para deslocamento de moléculas pequenas e grandes, carregadas ou não-carregadas, permitem que as várias membranas modulem concentrações de substâncias em seus compartimentos. Citosol e compartimento fluido de organelas têm composição distinta em íons inorgânicos, moléculas orgânicas, proteínas e ácidos nucléicos.

|

11

Partição de atividades e componentes em espaços delimitados por membranas tem muitas vantagens para a economia da célula, incluindo (a) seqüestro de substratos, cofatores e enzimas para maior eficiência metabólica e (b) ajuste de pH e composição iônica para máxima atividade de processos biológicos. As atividades e a composição de estruturas e organeER las celulares são determinadas em células intactas por métodos histoquímicos, imunológicos Pe de coloração fluorescente. Observações contínuas em tempo real de eventos celulares em células intactas viáveis são possíveis. Por exemplo, mudanças de pH e de concentração M de íon cálcio podem ser estudadas no citosol pelo uso de indicadores íon-específicos. Organelas individuais, ER membranas e componentes do citosol podem ser isolados eG analisados após rompimento da membrana plasLy mática. Técnicas para romper membranas Núcleo incluem uso de detergentes, choque osmótico ou homogeneização de tecidos, onde o atrito quebra a membrana plasmática. Em meios de isolamento apropriados, organelas celulaNucléolo res e sistemas de membranas podem ser separados por centrifugação, graças a diferenças em tamanho e densidade. Essas técnicas permitiram isolamento de frações celulares da maioria dos tecidos de mamíferos. Além M disso, componentes de organelas, como mitocôndrias e peroxissomos, podem ser isolados após rompimento da membrana da organela. Pelo uso dessas várias técnicas, as atividades e as funções dos vários compartimentos (a) celulares foram estudadas. Membrana nuclear

Centríolos

Núcleo

Complexo de Golgi

Nucléolo Cromatina

ER P

Ribossomos livres Retículo endoplasmático

M

Vacúolo

Mitocôndria

ER G Ly

(b)

Núcleo

Nucléolo

M

(a)

Membrana nuclear BioQ.01 11

Núcleo

Lisossomos

Membrana celular

FIGURA 1.9 (a) Micrografia eletrônica de uma célula de fígado de rato, marcada para indicar os principais componentes estruturais de células eucarióticas e (b) desenho esquemático de uma célula animal. Note o número e a variedade de organelas subcelulares e a rede de membranas interconectadas que delimitam canais ou cisternas. Nem todas as células eucarióticas são tão complexas em sua aparência, mas a maioria contém as principais estruturas mostradas. ER, retículo endoplasmático; G, zona do Golgi; Ly, lisossomo; P, peroxissomo; M, mitocôndria. Fotografia (a) reimpressa com permissão de Dr. K. R. Porter de Porter, K. R., e Bonneville, M. A. Em: Fine Structure of Cells and Tissues. Philadelphia: Lea & Febiger, 1972; esquema (b) reimpresso com permissão de Voet, D., e Voet, J. G. Biochemistry, 2ª ed., New York, Wiley, 1995. © (1995) John Wiley & Sons, Inc.

Centríolos Complexo

22.01.07 16:09:57

CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA

pendência mútua. Estima-se que esse evento possa ter ocorrido há cerca de três bilhões de anos. A herança mitocondrial ocorre por transmissão materna e tem sido possível estudar o movimento global humano por avaliação das variações em mtDNA. Mitocôndrias também têm os RNAs (ver p. 66) e enzimas necessárias para catalisar a síntese de algumas proteínas. A maioria das proteínas mitocondriais, entretanto, derivaram de genes presentes no DNA nuclear e são sintetizadas em ribossomos livres no citosol, depois importadas para a organela. Há várias centenas de doenças genéticas de atividades mitocondriais; algumas resultam de mutações no DNA nuclear que codifica proteínas mitocondriais, enquanto outras resultam de mutações no DNA mitocondrial (ver Corr. Clín. 1.2).

Lisossomos São Necessários para Digestão Intracelular Lisossomos são responsáveis pela digestão intracelular de substâncias extracelulares e intracelulares. Com uma única membrana delimitante, mantêm uma matriz com pH ácido de cerca de 5. Encapsulada nessas organelas está uma classe de enzimas glicoprotéicas – hidrolases – que catalisam clivagem hidrolítica de ligações carbono-oxigênio, carbono-nitrogênio, carbo-

|

15

no-enxofre e oxigênio-fósforo em proteínas, lipídeos, carboidratos e ácidos nucléicos. Uma lista parcial das enzimas lisossomais é apresentada na Tabela 1.7. Hidrolases lisossomais são mais ativas em pHs ácidos e quebram moléculas complexas em compostos simples de baixo peso molecular que podem ser reutilizados. A relação entre pH e atividade enzimática é discutida na p. 368. O conteúdo enzimático dos lisossomos varia em diferentes tecidos e depende das funções específicas do tecido. A membrana lisossomal contém mediadores e receptores protéicos específicos, bem como transportadores para deslocamento de substâncias através dela. Lisossomos isolados só catalisam hidrólise de substratos adicionados quando a membrana lisossomal é rompida. Rompimento da membrana em células leva à digestão celular. Várias condições patológicas têm sido atribuídas à liberação de enzimas lisossomais, incluindo artrite, respostas alérgicas, várias doenças musculares e destruição tecidual induzida por drogas (ver Corr. Clín. 1.3).

CORRELAÇÃO CLÍNICA 1.2

Doenças Mitocondriais A primeira doença (doença de Luft) envolvendo especificamente transdução de energia mitocondrial foi relatada em 1962. Uma paciente de 30 anos de idade apresentava fraqueza generalizada, transpiração excessiva, alta ingesta calórica sem ganho de peso e taxa de metabolismo basal muito elevada (uma medida da utilização de oxigênio). Ela tinha um defeito no mecanismo que controla a utilização de oxigênio pela mitocôndria (ver Capítulo 14). Desde então, várias centenas de anomalias genéticas foram identificadas que levam a alterações em enzimas, ácidos ribonucléicos, componentes do transporte de elétrons e sistemas de transporte de membranas mitocondriais. Mutações no mtDNA bem como no DNA nuclear levam a doenças genéticas mitocondriais. A primeira doença identificada que se deve a uma mutação no mtDNA foi Neuropa-

tia Óptica Hereditária de Leber, que leva a cegueira súbita no início da idade adulta. Muitas doenças mitocondriais envolvem músculo esquelético e sistema nervoso central. Lesões no DNA mitocondrial podem ocorrer, devido a radicais livres (superóxidos) formados nas mitocôndrias. Anomalias nas mitocôndrias têm sido implicadas na patofisiologia de esquisofrenia, doença bipolar e doenças degenerativas relacionadas com idade, como a doença de Parkinson, de Alzheimer e cardiomiopatias. Recentemente, sugeriu-se que uma única mutação em um tRNA mitocondrial levaria a uma constelação de sintomas, incluindo hipertensão, colesterol elevado no sangue e níveis baixos de Mg 2+ no plasma. Ver as seguintes Correlações Clínicas para detalhes de doenças mitocondriais: 6.5, p. 217; 14.4, p. 564; 14.5, p. 564; 14.6, p. 565; e 14.7, p. 567.

Fonte: Luft, R. The development of mitochondrial medicine. Proc. Natl. Acad. Sci. USA 91:8731, 1994; Chalmers, R.M. e Schapira, A.H.V. Clinical, biochemical and molecular genetic features of Leber’s hereditary optic neuropathy. Biochim. Biophys. Acta 1410:147, 1999; Wallace, D.C. Mitochondrial DNA in aging and disease. Sci. Am. 280:40, 1997; e Wallace, D.C. Mitochondrial diseases in man and mouse. Science 283:1482, 1999.

BioQ.01 15

22.01.07 16:10:00

CAPÍTULO 1 ESTRUTURA DA CÉLULA EUCARIÓTICA

|

19

CORRELAÇÃO CLÍNICA 1.5

Doenças de Biogênese de Peroxissomos (PBDs) Peroxissomos são responsáveis por várias reações metabólicas importantes, incluindo síntese de glicerol éteres, encurtamento de ácidos graxos de cadeia muito longa para que as mitocôndrias possam oxidá-los completamente, e oxidação da cadeia lateral do colesterol necessária à síntese de ácidos biliares. Doenças de biogênese de peroxissomos (PBDs) compreendem mais de 25 doenças genética e fenotipicamente relacionadas que envolvem atividades enzimáticas de peroxissomos. São doenças autossômicas recessivas raras que se caracterizam por níveis diminuídos de lipídeos glicerol-éteres (plasmalogênios), níveis aumentados de ácidos graxos de cadeias muito longas (C24 e C26) e de derivados do ácido colestanóico (precursores de ácidos biliares). As

doenças podem afetar fígado, rim, cérebro e sistema esquelético. A mais grave é síndrome de Zellweger, que se deve à ausência de peroxissomos funcionais; morte freqüentemente ocorre por volta dos 6 meses de idade. Nessa condição, o defeito genético está no mecanismo para importar enzimas para a matriz dos peroxissomos. Algumas condições PBD são causadas por mutações de splice doador ou de sentido errado (missense) (ver p. 158); em algumas, há ausência de uma única enzima metabólica ou defeito em um componente do transporte de membranas. Em alguns casos, a doença pode ser diagnosticada antes do nascimento por ensaio de enzimas de peroxissomos ou de ácidos graxos em células do líquido amniótico.

Fonte: Wanders, R. J., Schutgens, R. B., e Barth, P. G. Peroxissomal disorders: A review. J. Neuropathol. Exp. Neurol. 54: 726, 1995; FitzPatrick, D. R., Zellweger syndrome and associated phenotypes. J. Med. Genet. 33:863, 1996; e Warren, D.S., Wolfe, B. D. e Gould, S. J. Phenotype-genotype relationships in PEX10-deficient peroxisome biogenesis disorder patients. Hum. Mutat. 15:509, 2000.

|

1.4 INTEGRAÇÃO E CONTROLE DAS FUNÇÕES CELULARES Uma célula eucariótica é uma estrutura complexa que mantém um ambiente intracelular que permite que muitas reações complexas e funções ocorram com a máxima eficiência possível. Células de organismos multicelulares também participam da manutenção do bemestar de todo o organismo, exercendo influências umas sobre as outras para manter equilíbrio entre atividades tissulares e celulares. Processos intracelulares e vias metabólicas são muito bem controlados e integrados para conseguir esse equilíbrio. Pouquíssimas funções operam de modo totalmente independente; mudanças em uma função podem exercer uma influência, positiva ou negativa, sobre outras funções. Como será descrito ao longo deste livro, controles de função são mediados em muitos níveis, desde a expressão de um gene para alterar a concentração de uma enzima ou proteína efetora, até mudanças em níveis de substrato ou coenzima para ajustar a velocidade de uma reação enzimática específica. A integração de muitos processos celulares é controlada por proteínas que funcionam como ativadores ou inibidores, que mantêm homeostase celular. Muitos processos celulares são programados para ocorrerem em condições específicas; por exemplo, divisão

BioQ.01 19

celular em células normais só ocorre quando os processos necessários à divisão celular são ativados (ver p. 989). Então, e somente então, ocorre uma série de reações ordenadas e integradas, culminando na divisão de uma célula em duas células filhas. Um processo fascinante é apoptose, morte celular programada, também chamada suicídio celular (ver p. 993). Esse processo cuidadosamente regulado ocorre em células de todos os tecidos de mamíferos, mas etapas individuais do processo variam de tecido para tecido. Muitas doenças devem-se a erro em mecanismos específicos de controle. À medida que alguém amplia sua compreensão da complexidade de células biológicas, esse alguém fica admirado de que não ocorram muito mais erros e de que não existam muito mais indivíduos com condições anormais. Assim, à medida que prosseguimos para o estudo de componentes químicos separados e atividades de células em capítulos subseqüentes, é importante não esquecer as atividades concomitantes e vizinhas, limitações e influência do ambiente. Só conciliando todas as partes e atividades de uma célula – isto é, montando o quebra-cabeça – é que apreciaremos a maravilha das células vivas.

22.01.07 16:10:03

CAPÍTULO 2 DNA E RNA: COMPOSIÇÃO E ESTRUTURA

|

23

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS

2

DNA E RNA: COMPOSIÇÃO E ESTRUTURA Stephen A. Woski e Francis J. Schmidt

2.1 VISÃO GERAL, 24 Dogma central da biologia molecular, 24 DNA pode transformar células, 24 Capacidade de informação do DNA é enorme, 25 2.2 COMPONENTES ESTRUTURAIS DOS ÁCIDOS NUCLÉICOS: NUCLEOBASES, NUCLEOSÍDEOS E NUCLEOTÍDEOS, 26 Propriedades físicas de nucleosídeos e nucleotídeos, 26 Propriedades estruturais de nucleosídeos e nucleotídeos, 27 2.3 ESTRUTURA DO DNA, 28 Estrutura polinucleotídica, 28 Conformações dos polinucleotídeos, 29 Estabilidade do Esqueleto polinucleotídico, 30 DNA dupla-hélice, 31 Fatores que estabilizam DNA dupla-hélice, 34 Desnaturação e renaturação, 35 Hibridização, 36 Conformações do DNA dupla-hélice, 39 Estruturas não-canônicas de DNA, 40 DNA dobrado, 41 DNA cruciforme, 41 DNA tripla-fita, 43 DNA quatro-fitas, 44 DNA deslocado, 46 2.4 ORDEM SUPERIOR DA ESTRUTURA DO DNA, 47 DNA genômico pode ser linear ou circular, 47 DNA é super-hélice, 49 Topoisomerases, 50

BioQ.02 23

Empacotamento do DNA procariótico, 51 Organização da cromatina eucariótica, 54 Nucleossomos e polinucleossomos, 55 Empacotamento de polinucleossomos em estruturas superiores, 56 2.5 SEQÜÊNCIA E FUNÇÃO DO DNA, 57 Endonucleases de restrição e palíndromes, 57 A maior parte do DNA procariótico codifica proteínas específicas, 58 Apenas uma pequena percentagem do DNA eucariótico consisde de genes funcionais, 59 Seqüências repetidas, 60 2.6 ESTRUTURA DO RNA, 61 RNA é um polímero de ribonucleosídeos 5-mono fosfato, 61 Estrutura secundária do RNA envolve pareamento de bases intramolecular, 61 Moléculas de RNA têm estruturas terciárias, 62 2.7 TIPOS DE RNA, 64 RNA transportador tem duas funções: ativar aminoácidos e reconhecer códons no mRNA, 64 RNA ribossômico é parte do aparelho de síntese protéica, 65 RNAs mensageiros carregam a informação para a estrutura primária de proteínas, 66 Mitocôndrias contêm espécies peculiares de RNA, 66 RNA em partículas ribonucleoprotéicas, 67 RNA catalítico: ribozimas, 67 RNAs podem ligar outras moléculas, 68 RNAs controlam tradução, 69

22.01.07 16:20:49

28

|

PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

os átomos de carbono desse arranjo lembram a letra S; por isso, essa conformação é às vezes chamada conformação-Sul. Na segunda torção comum, C3’ é deslocada em direção à face endo e é chamada C3’-endo. Os carbonos da pentose desenham uma letra N, produzindo a conformação-Norte. É notável que os grupos ligados ao açúcar fiquem em orientações muito diferentes em cada uma dessas conformações. Por exemplo, grupos 5’- e 3’-fosfatos ficam muito mais afastados na torção C2’-endo do que na C3’-endo. A orientação da ligação glicosídica também muda significativamente nas duas conformações. Conformações C2’-endo e C3’-endo estão em rápido equilíbrio. Um substituinte eletronegativo na posição 2’ da pentose favorece a conformação C3’-endo. Portanto, ribonucleosídeos em RNA preferem essa torção do açúcar. Fatores adicionais como pontes de hidrogênio entre o grupo 2’-OH e o átomo O4’ do resíduo vizinho deslocam o equilíbrio para a conformação C3’-endo. Entretanto, os 2’-desoxinucleosídeos do DNA contêm um hidrogênio em lugar do grupo 2’-OH, e a conformação C2’-endo é preferida. As bases em nucleosídeos são planas. Embora rotação livre em torno da ligação glicosídica seja possível, duas orientações da base em relação ao açúcar predominam (Figura 2.7). Em purinas, a conformação anti coloca H8 sobre o açúcar, enquanto a conformação syn posiciona esse átomo longe do açúcar e a maior parte da purina bicíclica sobre o açúcar. Em pirimidinas, o átomo H6 fica acima do anel de pentose na conformação anti, e o átomo O2, maior, fica acima do anel na conformação glicosídica syn. Pirimidinas, portanto, mostram uma grande preferência pela conformação com menos impedimento estérico anti. Purinas rapidamente se interconvertem entre as duas conformações, mas favorecem a orientação anti. Contudo, guanina 5’-nucleotídeos são exceções. Nesses casos, interações favoráveis entre o grupo 2-NH2 e o grupo 5’-fosfato estabilizam a conformação syn. 2’-Desoxiguanosina 5’-monofosfato (dGMP), por exemplo, prefere a conformação glicosíP O

base

O

7.0 Å

C-2� ���� “Sul”

P O

P O 5.9 Å

O

base

P O C-3� ���� “Norte”

FIGURA 2.6 Conformações preferenciais de açúcares pentoses. Duas conformações produzem variações na orientação relativa da base (com relação ao açúcar) e na distância entre os grupos 3’- e 5’-fosfato (P). Finalmente, essas diferenças afetam a conformação geral do complexo dupla-hélice.

BioQ.02 28

H H

HO

NH2

6

N N

O

2

O

HO

H N

O

O

anti

syn H O

H HO

O

HO

H

OH

OH

8

NH2

N

N N

N N

O

N H

H 2N

N

N NH2

HO

OH anti

N

O

HO

H

OH

syn

FIGURA 2.7 Conformações glicosídicas de purinas e pirimidinas. Em pirimidinas, fatores estéricos entre o açúcar e O2 da base desfavorecem fortemente a conformação syn. Em purinas, as conformações anti e syn se interconvertem facilmente, com anti sendo mais estável na maioria dos casos. A conformação syn é estabilizada em guanosina 5’-fosfato, devido a interações favoráveis entre o grupo 2-NH2 e os oxigênios do fosfato.

dica syn. Essa preferência também foi observada em DNA fita-dupla com seqüências de Gs e Cs alternados. A conformação syn dos resíduos G nesses DNAs resulta na formação de uma hélice pouco usual, que gira para a esquerda (ver p. 40).

2.3 | ESTRUTURA DO DNA Estrutura Polinucleotídica Ácidos nucléicos são fitas de nucleotídeos ligados por ligações fosfodiéster (Figura 2.8). O comprimento dessas fitas varia consideravelmente, de dois resíduos a centenas de milhões de resíduos. Tipicamente, fitas de ácidos nucléicos contendo ≤50 nucleotídeos são chamados oligonucleotídeos, enquanto os mais longos são polinucleotídeos. A ligação fosfodiéster liga o grupo 5’-hidroxila de um resíduo ao grupo 3’-hidroxila do seguinte. Ligações entre dois 5’-OHs ou dois 3’-OHs não são vistas em DNA de ocorrência natural. A direcionalidade dessa ligação significa que oligo- e polinucleotídeos lineares têm uma extremidade que termina em um 5’-OH e outra que termina em 3’-OH. Essas extremidades são extremidade 5’ e extremidade 3’, respectivamente. Em muitos polinucleotídeos, uma ou ambas as extremidades são quimicamente modificadas com resíduos de grupos fosfatos ou aminoácidos. Polinucleotídeos circulares não têm nenhuma extremidade livre, e são formados unindo-se a extremidade 5’ de um polinucleotídeo linear com sua própria extremidade 3’ por uma ligação fosfodiéster.

22.01.07 16:20:54

42

|

PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

CORRELAÇÃO CLÍNICA 2.3

Antibióticos Antitumorais que Mudam a Forma do DNA A estrutura local tridimensional do DNA é importante em interações com proteínas envolvidas em reparo, transcrição, recombinação e condensação da cromatina. Foi proposto que antibióticos possam induzir formação de estruturas de DNA que podem recrutar essas proteínas com resultados citotóxicos. O exemplo melhor estudado é a droga antitumoral cisplatina, um complexo tetracoordenado de platina [cis-Pt(NH2)2CL2]. Cisplatina é usada sozinha ou em combinação com outros agentes antitumorais para tratar uma variedade de tumores, incluindo câncer testicular, ovariano, ósseo e pulmonar. Forma ligações cruzadas inter- e intra-fitas em DNA dupla-fita com o último aducto compreendendo 90% das lesões do DNA. Essas ligações surgem do deslocamento de cloretos ligados à platina por átomos N7 de duas guaninas vizinhas. Estudos estruturais de DNA com aducto fazendo ligação cruzada intra-fita mostra que a dupla hélice é fortemente dobrada em direção à fenda maior. Estruturas dobradas de aductos DNA-cisplatina são reconhecidas especificamente por várias proteínas que se ligam ao DNA, tais como proteínas do reparo por excisão de nucleotídeos (NER) e proteínas não-histonas que se ligam ao DNA como HMG-1. A

citotoxicidade da cisplatina é um processo complicado mediado por interações específicas com essas proteínas. Processos celulares como transcrição e apoptose são afetados e os complexos aducto-proteína provavelmente interferem com transcrição. Proteínas NER são recrutadas para reparar a lesão, mas reparo por excisão está sujeito a introduzir quebras de fita no DNA. Acúmulo dessas quebras induzirá, finalmente, apoptose, quando o DNA se tornar danificado demais para funcionar. Mecanismos semelhantes foram propostos como responsáveis pela citotoxicidade de outras drogas que ligam ao DNA, como ditercalinium, uma molécula bifuncional que forma aductos não-covalentes com DNA que também fica fortemente dobrado. Acredita-se que citotoxicidade surja da indução da via de reparo abortivo, que leva a quebras da fita de DNA. Interações do aducto cisplatina-DNA com proteínas HMG também podem contribuir para sua citotoxicidade. Ligação de proteínas HMG pode sinalizar incorretamente que a região danificada do DNA é transcripcionalmente ativa e impedir condensação em estruturas de cromatina enovelada. Esses complexos também perpetuam a lesão, porque bloqueiam o aducto DNAcisplatina impedindo reparo.

��

���

���

Fonte: Zamble, D.B. e Lippard, S.J. The response of cellular proteins to cisplatin-damaged DNA. In: B. Lippert (Ed.) Cisplatin: Chemistry and Biochemistry of a Leading Anticancer Drug. New York: Wiley-VCH, 1999, pp. 73134; e Lambert, B., Segal-Bendirjian, E., Esnault, C., Le Pecq, J.-B., Roques, B.P., Jones, B. e Yeunf, A.T. Recognition by the DNA repair system of DNA structural alterations induced by reversible drug-DNA interactions. Anti-Cancer Drug Des. 5:43, 1990.

BioQ.02 42

22.01.07 16:21:15

CAPÍTULO 2 DNA E RNA: COMPOSIÇÃO E ESTRUTURA

mente 300 pb de comprimento e são repetidas mais de 500.000 vezes. As estruturas das repetições dispersas curtas, incluindo família Alu, são remanescentes de transposons. Aproximadamente 1-15% do DNA genômico eucariótico consiste de seqüências tipicamente menores do que 20 nucleotídeos reiteradas milhares ou milhões de vezes. A maioria das seqüências altamente reiteradas tem uma composição em bases característica, e elas podem ser isoladas fragmentando-se o DNA em segmentos de algumas centenas de nucleotídeos e separando-se os fragmentos por centrifugação em gradiente de densidade. Esses fragmentos são chamados DNA satélite, porque aparecem como satélites das bandas que contêm a maior parte do DNA após centrifugação. Outras seqüências altamente reiteradas, que não podem ser isoladas por centrifugação, podem ser identificadas por sua propriedade de rápido reanelamento. Esses DNAs altamente reiterados são também chamados DNAs de seqüência simples. Seqüências simples estão tipicamente presentes no DNA da maioria dos eucariotos, se não de todos. Em algumas espécies, uma seqüência principal está presente, enquanto em outras, várias seqüências simples são repetidas até um milhão de vezes. DNAs de seqüência simples podem freqüentemente ser isolados, como DNA satélite. O encontrado no centrômero de eucariotos superiores consiste de milhares de cópias em seqüência de uma ou de algumas poucas seqüências curtas. Seqüências satélites têm apenas 5-10 pb de comprimento e são um constituinte dos telômeros, onde têm um papel bem definido na replicação do DNA. Alguns DNAs de seqüência simples mais longos foram identificados. Por exemplo, no genoma do macaco verde africano, um segmento de 172 pb que contém algumas repetições de seqüências é altamente reiterado. Repetições invertidas são motivos estruturais do DNA. Repetições invertidas curtas, consistindo de até seis nucleotídeos de comprimento (p. ex., a seqüência palindrômica GAATTC), ocorrem por acaso uma vez a cada 3.000 nucleotídeos. Tais repetições curtas não podem formar uma estrutura cruciforme estável, como a formada por seqüências palindrômicas mais longas. Seqüências repetitivas invertidas que são suficientemente longas para formar cruciformes estáveis, é pouco provável que ocorram por acaso, e deveriam ser classificadas como uma classe separada de seqüências eucarióticas. No DNA humano, cerca de dois milhões de repetições invertidas estão presentes, com um comprimento médio de cerca de 200 pb; entretanto, seqüências invertidas com mais de 1.000 pb já foram detectadas. A maioria das seqüências repetidas invertidas é repetida 1.000 ou mais vezes por célula.

|

61

2.6 | ESTRUTURA DO RNA RNA é um Polímero de Ribonucleosídeo 5’-Monofosfatos RNA é um polímero linear de ribosídeos monofosfatos. As bases púricas do RNA são adenina e guanina; as pirimídicas são citosina e uracil. Exceto por uracil, que substitui timina, são as mesmas bases encontradas no DNA. Nucleotídeos de A, C, G e U são incorporados no RNA durante transcrição. Muitos RNAs também contêm nucleotídeos modificados, que são produzidos por processamento. Nucleotídeos modificados são especialmente característicos de espécies de RNAs estáveis (i.é, tRNA e rRNA); contudo, alguns nucleotídeos metilados estão também presentes em mRNA eucariótico. Na sua maior parte, nucleotídeos modificados no RNA têm papel no “ajuste fino”, e não funções indispensáveis na célula. As ligações 3’,5’-fosfodiéster do RNA formam um esqueleto, a partir do qual as bases se estendem (Figura 2.51). RNAs eucarióticos variam de aproximadamente 20 nucleotídeos de comprimento a mais de 200.000 nucleotídeos. Cada RNA é complementar à seqüência de bases de porções específicas de apenas uma das fitas do DNA. Portanto, ao contrário da composição em bases do DNA, as relações molares (A + U) e (G + C) no RNA não são iguais. RNA celular é linear e de fita-única, mas RNA fita-dupla está presente em certos genomas virais. Quimicamente, RNA é semelhante a DNA. Ambos contêm ligações fosfodiéster carregadas negativamente, e as bases são quimicamente muito semelhantes. As diferenças químicas entre DNA e RNA devem-se principalmente a dois fatores. Primeiro, RNA contém ribose em lugar de 2’-desoxirribose como açúcar componente do nucleotídeo, e segundo, RNAs geralmente são fitaúnica em lugar de dupla-fita. O grupo 2’-hidroxila torna as ligações fosfodiéster de uma molécula de RNA mais susceptível à hidrólise química, especialmente em soluções alcalinas, do que as do DNA. A instabilidade química do RNA reflete-se em sua instabilidade metabólica. Alguns RNAs, como mRNA bacteriano, são sintetizados, usados e degradados em minutos. Outros, como rRNA humano, são mais estáveis metabolicamente, com tempo de vida medido em dias. Entretanto, mesmo os RNAs mais estáveis, são menos estáveis que o DNA.

Estrutura Secundária do RNA Envolve Pareamento de Bases Intramolecular Como moléculas de RNA são fita-única, geralmente não formam extensas duplas-hélices. Em vez disso, a estrutura secundária de uma molécula de RNA resulta de regiões relativamente curtas com pareamento de

BioQ.02 61

22.01.07 16:21:40

CAPÍTULO 3 PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA

|

73

PARTE 1 ESTRUTURAS DE MACROMOLÉCULAS

3

PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA Richard M. Schultz e Michael N. Liebman

3.1 PAPÉIS FUNCIONAIS DE PROTEÍNAS NO HOMEM, 74 3.2 COMPOSIÇÃO EM AMINOÁCIDOS DE PROTEÍNAS, 75 Aminoácidos comuns, 75 Cadeias laterais definem a natureza química e as estruturas de α-aminoácidos, 76 Cistina é um aminoácido derivado, 78 Aminoácidos têm um centro de assimetria, 78 Aminoácidos São Polimerizados em Peptídeos e Proteínas, 78 3.3 PROPRIEDADES DE CARGAS E QUÍMICAS DE AMINOÁCIDOS E PROTEÍNAS, 81 Grupos ionizáveis de aminoácidos e proteínas são críticos para a função biológica, 81 Forma iônica de um aminoácido ou uma proteína pode ser determinada em dado pH, 82 Titulação de um ácido monoamino-monocarboxílico: determinação do pH isoelétrico, 82 Titulação de um ácido monoamino-dicarboxílico, 83 Relação geral entre as propriedades de carga de aminoácidos e proteínas, e pH, 83 Aminoácidos e proteínas podem ser separados com base em valores de pI, 84 Cadeias laterais de aminoácidos têm propriedades polares e apolares, 84 Aminoácidos sofrem várias reações químicas, 87

3.5 NÍVEIS SUPERIORES DE ORGANIZAÇÃO PROTÉICA, 90 Estrutura secundária, 90 Estrutura em α-hélice, 91 Estrutura-β, 92 Motivos estruturais e dobras das proteínas, 92 Estrutura terciária, 93 Estrutura quaternária, 94 Bioinformática relaciona estrutura e função das proteínas como produtos gênicos, 95 Estruturas de dobras homólogas são freqüentemente formadas a partir de seqüências de aminoácidos não-homólogas, 96 3.6 OUTROS TIPOS DE PROTEÍNAS, 97 Proteínas fibrosas: colágeno, elastina, queratina e tropomiosina, 98 Colágeno, 98 Composição em aminoácido do colágeno, 98 Seqüência de aminoácido do colágeno, 98 Estrutura do colágeno, 99 Formação de ligações covalentes cruzadas no colágeno, 100 Elastina é uma proteína fibrosa com ligações cruzadas geradas por alisina, 100 Queratina e tropomiosina, 102 Lipoproteínas plasmáticas são complexos de lipídeos com proteínas, 102 Glicoproteínas contêm carboidratos ligados covalentemente, 107 Ligações covalentes carboidrato-proteína, 107

3.4 ESTRUTURA PRIMÁRIA DE PROTEÍNAS, 88

BioQ.03 73

22.01.07 16:30:59

CAPÍTULO 3 PROTEÍNAS I: COMPOSIÇÃO E ESTRUTURA

|

3.3 PROPRIEDADES DE CARGAS E QUÍMICAS DE AMINOÁCIDOS E PROTEÍNAS Grupos Ionizáveis de Aminoácidos e Proteínas São Críticos para a Função Biológica Grupos ionizáveis comuns a proteínas e aminoácidos são mostrados na Tabela 3.3. As formas ácidas estão à esquerda do sinal de equilíbrio, e as formas básicas do lado direito. Ao formar sua base conjugada, a forma ácida libera um próton. Ao contrário, a forma básica associa-se com um próton para formar o respectivo ácido. A dissociação de um ácido é caracterizada por uma constante de dissociação ácida (Ka) e seu valor de pKa : pKa = log10 (1/Ka). Tabela 3.3 mostra a faixa de valores de pK’a para cada grupo ácido, porque o pKa real depende do meio no qual o grupo ácido está colocado. Por exem-

|

81

plo, quando um grupo amônio carregado positivamente (−NH3+) é colocado perto de um grupo carregado negativamente em uma proteína, a carga negativa estabiliza a forma ácida carregada positivamente, tornando mais difícil a dissociação do seu próton. O pKa do −NH3+ terá um valor maior do que o normal para um grupo amônio na ausência de uma estabilização por uma carga negativa próxima. Outros fatores, além da carga, que afetam o pKa incluem polaridade do meio, ausência ou presença de água e potencial para formação de pontes de hidrogênio. Além disso, grupos ácidos (α-COOH ou α-NH3+) nas extremidades dos polipeptídeos tipicamente têm um valor de pKa mais baixo do que os mesmos tipos de grupos ácidos nas cadeias laterais (Tabela 3.4). Os aminoácidos cujos grupos R contêm átomos de nitrogênio (Lys e Arg) são os aminoácidos básicos, uma vez que suas cadeias laterais têm valores relativamente altos de pKa e funcionam como bases em pH fisiológico. Eles estão geralmente em sua forma ácida e carregada positivamente em pH fisiológico. Aminoácidos cujas cadeias laterais contêm um grupo carboxílico têm valores de pKa relativamente baixos que facilmente perdem seus prótons e são aminoácidos acídicos. Estão predomi-

TABELA 3.3 Valores de pKa característicos para os Grupos Ácidos Comuns em Proteínas Onde o Grupo Ácido É Encontrado

Forma Ácida

Forma Básica

Faixa Aproximada de pKa Para o Grupo

R—NH3 + Amônia

R—NH2 + H + Amina

7,6–10,6

COOH-terminal ou cadeias laterais de glutamato e aspartato

R—COOH Ácido carboxílico

R—COO – + H + Carboxilato

3,0–5,5

Cadeia lateral de arginina

R—NH—C — … NH2 | NH2 Guanidínio

R—NH—C= NH + H | NH2 Guanidino

11,5–12,5

Cadeia lateral de cisteína

R—SH Tiol

R—S – + H + Tiolato

8,0–9,0

Cadeia lateral de histidina

R—C=CH | | + HN NH C H

NH2-terminal ou cadeia lateral de lisina

+

R—C=CH | | HN N+H + C H

Imidazólio

6,0–7,0

Imidazol

Cadeia lateral de tirosina R—

—OH Fenol

TABELA 3. 4 pKa da Cadeia Lateral e Grupos Ácidos Terminais em Ribonuclease

BioQ.03 81

—NH3 +

—COOH

Cadeia lateral

Lisina  10,2

Glu e Asp  4,6

Final da cadeia

N-terminal = 7,8

C-terminal = 3,8

R—

—OH – +H +

9,5–10,5

Fenolato

nantemente em sua forma desprotonada e carregada negativamente em pH fisiológico. Proteínas nas quais a razão (∑Lys + ∑Arg)/(∑Glu + ∑Asp) é maior do que 1 são proteínas básicas. Proteínas, nas quais a razão é menor do que 1, são proteínas ácidas.

22.01.07 16:31:12

98

|

PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

Proteínas Fibrosas: Colágeno, Elastina, Queratina e Tropomiosina

Composição em Aminoácidos do Colágeno

Proteínas fibrosas caracteristicamente têm quantidades maiores de estrutura secundária regular, uma forma cilíndrica longa (tipo bastão), baixa solubilidade em água e uma função estrutural em lugar de um papel dinâmico. Exemplos de proteínas fibrosas com essas características são colágeno, queratina e tropomiosina.

A composição do colágeno tipo I de pele e das proteínas globulares ribonuclease e hemoglobina são dadas na Tabela 3.10. Colágeno de pele é rico em glicina (33% de seus aminoácidos), prolina (13%) e aminoácidos derivados 4-hidroxiprolina (9%) e 5-hidroxilisina (0,6%) (Figura 3.37). Hidroxiprolina é exclusiva de colágenos, sendo formada enzimaticamente a partir de prolina. A maior parte das hidroxiprolinas tem o grupo hidroxila na posição 4 (carbono γ), embora uma pequena quantidade de 3-hidroxiprolina também seja formada (Tabela 3.10). Colágenos são glicoproteínas com carboidratos ligados a 5-hidroxilisina por uma ligação O-glicosídica por meio do grupo hidroxila do carbono-δ.

Colágeno Colágeno é uma família de proteínas presente em todos os tecidos e órgãos e fornece o arcabouço que dá aos tecidos sua forma e resistência. A porcentagem de colágeno por peso para alguns tecidos e órgãos humanos representativos é: fígado 4%, pulmão 10%, aorta 12-24%, cartilagem 50%, córnea 64%, osso cortical total 23% e pele 74% (ver Corr. Clín. 3.4).

CORRELAÇÃO CLÍNICA 3.4

Doenças de Síntese de Colágeno Colágeno está presente em praticamente todos os tecidos e é a mais abundante proteína do corpo. Certos órgãos dependem muito dele para funcionar fisiologicamente. Síntese ou estrutura anormal de colágeno causa disfunção em órgãos cardiovasculares (aneurisma da aorta e arterial e defeitos de válvulas cardíacas), ossos (fragilidade e fratura fácil), pele (cicatrização difícil e distensibilidade incomum), articulações (hipermobilidade e artrite) e olhos (deslocamento do cristalino). Doenças causadas por síntese anormal de colágeno incluem síndrome de Ehlers-Danlos, osteogênese imperfeita e escorbuto. Essas doenças podem resultar de genes anormais de colágeno, modificações pós-tradução anormais do colágeno ou deficiência de cofatores necessários às enzimas responsáveis por modificações póstradução de colágeno.

Seqüência de Aminoácidos do Colágeno A família colágeno é composta por polipeptídeos derivados de 40 genes conhecidos de cadeias de colágeno, que produzem cerca de 20 tipos de colágeno. Cada molécula de colágeno maduro ou tropocolágeno contém três cadeias polipeptídicas. Alguns tipos de colágeno contêm três cadeias polipeptídicas idênticas. No tipo I (Tabela 3.11), há duas cadeias α1(I) e uma α2(I). Colágeno tipo V contém α1(V), α2(V) e α3(V). Colágenos diferem em seqüência de aminoácidos, mas há grandes regiões de seqüências homólogas entre todos os diferentes tipos de colágeno. Em todos os tipos de colágeno há regiões com os tripeptídeos Gly-Pro-Y e Gly-X-Hyp (onde X e Y são quaisquer aminoácidos) repetidos em seguida vá-

H2C

H N

CH

H2C

COOH

CH2

HC

H N

CH

H2C

COOH

CH

OH

OH

4-Hidroxiprolina

3-Hidroxiprolina

OH NH2

CH2

CH

NH2 CH2

C

CH2

H

COOH 5-Hidroxilisina

Fonte: Aronson, D. Cross-linking of glycated collagen in the pathogenesis of arterial and myocardial stiffening of aging and diabetes. J. Hypertens. 21:3, 2003. Byers, P. H. Disorders of collagen biosynthesis and structure. In: C. R. Scriver, et al. (Eds.), The Metabolic and Molecular Bases of Inherited Disease, 8th ed. McGraw-Hill, 2001, Chapter 205. Hudson, B. G., et al., Alport’s syndrome, Goodpasture’s syndrome and type IV collagen, N. Engl J Med 348:2543, 2003.

BioQ.03 98

NH2 O

C

CH2

CH2

CH2

C

H

COOH

H Alisina

FIGURA 3.37 Aminoácidos derivados encontrados no colágeno. Carboidrato é ligado a 5-OH de hidroxilisina por uma ligação glicosídica tipo III (ver Figura 3.45).

22.01.07 16:31:51

|

PARTE 1 ESTRUTURA DE MACROMOLÉCULAS

tos de domínios e mudanças de estrutura quaternária, como os observados em hemoglobina após ligação de O2 (ver p. 344). O comportamento dinâmico de proteínas é a base para (a) mudanças conformacionais induzidas por substrato, inibidor ou droga quando se liga a uma enzima ou receptor, (b) geração de efeitos alostéricos em hemoglobinas, (c) transferência de elétrons em citocromos, e (d) a formação de montagens supramoleculares como vírus. Os movimentos também podem ter um papel funcional na ação catalítica de enzimas.

|

3.9 CARACTERIZAÇÃO, PURIFICAÇÃO E DETERMINAÇÃO DA ESTRUTURA E ORGANIZAÇÃO DE PROTEÍNAS Separação de Proteínas com Base em Carga Em eletroforese, proteína dissolvida em uma solução tampão em um pH em particular é colocada num campo elétrico. Dependendo da relação entre o pH do tampão e o pI da proteína, a proteína move-se em direção ao cátodo (–) ou ao ânodo (+) ou permanece estacionária (pH = pI). Suportes como géis poliméricos (p. ex., poliacrilamida), amido ou papel são usados. Os suportes inertes são saturados com solução tampão, uma amostra de proteína é colocada sobre o suporte, um campo elétrico é aplicado ao suporte, e a proteína carregada migra no suporte em direção ao pólo de carga oposta. Uma técnica de resolução extremamente alta é a focalização isoelétrica, na qual misturas de anfolitos poliamino-ácidos policarboxílicos com uma faixa definida de valores de pI são usadas para estabelecer um gradiente de pH ao longo do campo elétrico aplicado. Uma proteína carregada migra pelo gradiente de pH no campo elétrico até alcançar uma região de pH no gradiente igual ao seu valor de pI. Nesse ponto, a proteína torna-se estacionária e pode ser visualizada (Figura 3.55). Proteínas que diferem por tão pouco quanto 0,0025 em seus valores de pI são separadas no gradiente apropriado de pH. Cromatografia de troca-iônica em colunas é usada para separação preparativa de proteínas por carga. Resinas de troca-iônica consistem de materiais insolúveis (agarose, poliacrilamida, celulose e vidro) que contêm grupos carregados (Figura 3.56). Resinas carregadas negativamente ligam cátions fortemente e são resinas de troca catiônica. Resinas carregadas positivamente ligam ânions fortemente e são resinas de troca aniônica. O grau de retardo de uma proteína (ou um aminoácido) por uma resina depende da magnitude da carga da proteína no pH particular do experimento. Moléculas

BioQ.03 116

0.05

S

Absorbância (415 nm)

116

F

A1c

A

A F

A1c

A2

S A2 0 14

15

16

17

Tempo (min) (a)

(b)

FIGURA 3.55 Focalização isoelétrica de hemoglobinas de um paciente heterozigoto para HbS e β-talassemia. Figura mostra separação por focalização isoelétrica de HbA1c (HbA glicosilada na extremidade NH2, ver Corr. Clín. 3.7), HbA de adulto normal, HbF fetal, HbS de anemia falciforme (ver Corr. Clín 3.3) e HbA 2 minoritária de adulto. (a) Focalização isoelétrica realizada por eletroforese capilar com anfólito na faixa de pH entre 6,7 e 7,7 e detecção de bandas a 415 nm. (b) Focalização isoelétrica realizada em gel com Pharmacia Phast System; anfólito na faixa de pH entre 6,7 e 7,7. De Molteni, S., Frischknecht, H. e Thormann, W. Electrophoresis 15:22, 1994 (Figura 4, partes A e B).

R

CH2

COO–

Ligante carregado negativamente: carboximetil R

+

N H

C2H5 C2H5

Ligante carregado positivamente: dietilamino FIGURA 3.56 Dois exemplos de ligantes carregados usados em cromatografia de troca-iônica.

de mesma carga que a resina são eluídas primeiro, em uma única banda, seguidas das que têm carga oposta à da resina, em uma ordem baseada na densidade de cargas da proteína (Figura 3.57). Quando é difícil remover uma molécula da resina, devido à força de interação atrativa entre a molécula ligada e a resina, mudanças sistemáticas no pH ou na força iônica são usadas para enfraquecer a interação. Por exemplo, um gradiente crescente de pH em uma resina de troca catiônica reduz a diferença entre o pH da solução e o pI da proteína ligada. Essa diminuição entre pH e pI reduz a magnitude da carga final da proteína e diminui a força da interação de cargas entre a proteína e a resina. Um gradiente crescente de força iônica também diminui a interação de cargas e elui eletrólitos fortemente ligados à resina.

22.01.07 16:32:44

132

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

4

REPLICAÇÃO, RECOMBINAÇÃO E REPARO NO DNA Howard J. Edenberg 4.1 CARACTERÍSTICAS COMUNS DA REPLICAÇÃO, RECOMBINAÇÃO E REPARO, 133 4.2 REPLICAÇÃO DO DNA, 133 O básico, 133 A química da elongação da cadeia, 134 DNA polimerases, 135 Separando as fitas parentais: a forquilha de replicação, 137 Resolvendo o problema da polaridade: síntese de DNA semidescontínua, 138 Movimento da forquilha de replicação, 138 Início, 138 Elongação da fita, 138 Remoção do primer, 138 Preenchimento da falha, 138 Ligação, 139 Desenrolando as fitas parentais, 141 Braçadeiras corrediças (sliding clamps) e processividade, 142 Coreografia em três dimensões: o replissomo, 142 Enzimas procarióticas de replicação, 142 Enzimas eucarióticas de replicação, 144 Início da replicação, 146 O ciclo celular, 147 Término da replicação em genomas circulares, 150 Término da replicação em genomas lineares: telômeros, 150 Telomerase, 151 Replicação de genomas de RNA, 151

BioQ.04 132

4.3 RECOMBINAÇÃO, 151 Modelos de recombinação homóloga, 152 Modelo Holliday, 152 Modelo de Meselson e Radding, 153 Modelo de quebra da dupla fita, 153 Enzimas-chaves da recombinação em E. coli, 153 RecA, 153 RecBCD, RuvA, RuvC, 155 Recombinação não-homóloga, 155 Recombinação sítio-específica, 155 Transposição, 155 Ligação de extremidades não-homólogas, 155 4.4 REPARO, 156 Lesão no DNA, 156 Mutações, 158 Reparo por excisão, 160 Reparo por excisão de base, 160 Reparo por excisão de nucleotídeo, 161 Reparo acoplado à transcrição, 162 Reparo de pareamento errado, 162 Desmetilação direta, 165 Fotorreativação, 165 Lesões podem bloquear a replicação, 165 Síntese bypass (translesão), 166 Reparo de falha na fita filha, 166 Enrolamento e reparo de forquilhas de replicação, 167 Reparo de quebra na dupla fita, 167 Regulação do reparo do DNA: o regulon SOS, 168

22.01.07 16:37:06

CAPÍTULO 4 REPLICAÇÃO, RECOMBINAÇÃO E REPARO NO DNA

|

151

Telomerase

Replicação de Genomas de RNA

Telômeros são mantidos por telomerases, enzimas que adicionam novas repetições de seis nucleotídeos à extremidade 3’ dos telômeros. Telomerases são complexos ribonucleoprotéicos contendo um pequeno RNA que serve de molde para adição de uma nova repetição de seis nucleotídeos (Figura 4.18). Uma telomerase liga-se à extremidade da fita 3’, como parte do RNA da telomerase ligado por pontes de hidrogênio aos últimos nucleotídeos do cromossomo. Uma repetição de seis nucleotídeos é sintetizada, usando o RNA como molde. Então, a telomerase pode se dissociar e reassociar para adicionar outro hexâmero. Telômeros não precisam permanecer exatamente do mesmo tamanho; algum encurtamento não é problema porque essas repetições não codificam proteínas. Telômeros passam por ciclos de encurtamento das fitas tardias devido a incapacidade de síntese completa (Figura 4.17a) e adição de novas repetições de seis nucleotídeos à extremidade 3’ pela telomerase (Figura 4.18). Embora o comprimento dos telômeros não permaneça constante, encurtamento progressivo é evitado por adição de repetições. Telomerases também restabelecem os excessos 3’, característicos dos telômeros. Células que diferenciaram e se dividirão apenas um número limitado de vezes, não expressam telomerase. Assim, os telômeros encurtam a cada divisão subseqüente; isso limita o número de vezes que tais células podem se dividir antes que a perda dos telômeros dispare apoptose – isto é, morte celular programada (ver p. 1020). Expressão de telomerase é geralmente reativada em células tumorais, o que lhes permite continuar as divisões indefinidamente, sem encurtamento cromossômico. Isso torna a telomerase um alvo atraente para quimioterapia do câncer. Deve-se notar que inativação da telomerase em um tumor não levaria a uma parada rápida no crescimento do tumor; o efeito seria retardado por muitos ciclos celulares, até que as extremidades cromossômicas fossem encurtadas significativamente. Portanto, é provável que inibidores da telomerase sejam úteis apenas em combinação com outras terapias.

Alguns vírus têm um genoma de RNA. Tais genomas são replicados com muito menor precisão e eles podem acumular variações em período relativamente curto. Um exemplo particularmente importante disso é o vírus da imunodeficiência humano (HIV), que causa AIDS (síndrome da imunodeficiência adquirida). O RNA viral do HIV é reversamente transcrito em DNA e, depois, o DNA integra-se ao cromossomo. A transcriptase reversa do HIV é um alvo para quimioterapia antiviral (Corr. Clín. 4.4). Transcrição reversa do RNA genômico do HIV é muito menos precisa que síntese de DNA, e a precisão diminuída leva à rápida geração de uma coleção de vírus variantes em um indivíduo. É provável que uma pequena fração desses variantes seja resistente a qualquer droga única que esteja sendo usada para tratar a infecção. Essa fração pode continuar a replicar na presença do agente terapêutico até se tornar a variante dominante, o que leva à perda de eficácia da droga. Atuais terapias combinadas são projetadas para reduzir a probabilidade de um vírus ser resistente simultaneamente a todas as drogas da combinação. Terapias combinadas atuais têm como alvos tanto a transcriptase reversa do HIV como a protease do HIV.

��� �

� ������������������

�–

�� ��

3��

Recombinação é a troca de informação genética. Há dois tipos básicos: recombinação homóloga e recombinação não-homóloga. Recombinação homóloga (também chamada recombinação geral) ocorre entre seqüências idênticas ou quase idênticas – por exemplo, entre os cromossomos paterno e materno de um par. Cromossomos não são passados intactos de geração para geração (Figura 4.19); em vez disso, cada cromossomo que você herda de seu pai contém porções de ambos os pais e, da mesma forma para os cromossomos herdados de sua mãe. Esta é uma parte normal do processo de alinhamento cromossômico e segregação

������������������

��

[TTAGGG]nTTAGGGTTAGGGTTAGGG 3� ��������� [AATCCC]nAATCCC 5�

4.3 | RECOMBINAÇÃO

5�

FIGURA 4.18 Telomerase. Telomerase é um complexo ribonucleoprotéico com uma fita curta de RNA, como parte integral; catalisa a adição de novas repetições teloméricas de 6-nt à extremidade 3’ de uma cadeia de DNA. O RNA da telomerase pareia parcialmente pelas bases com a repetição telomérica e serve de molde para a reação, enquanto o componente protéico funciona como uma transcriptase reversa, sintetizando DNA usando o RNA como molde. Depois da adição de uma repetição de seis nucleotídeos, a enzima pode se dissociar e se ligar novamente e adicionar novas repetições de 6-nt.

BioQ.04 151

���������� k l m n o p q r

� � � � � � � � � � KLMNOPQR

FIGURA 4.19 Recombinação homóloga. (a) O cromossomo paterno é mostrado em cinza com os alelos mostrados por letras maiúsculas. O cromossomo homólogo materno é mostrado em preto com os alelos mostrados por letras minúsculas. (b) Depois da recombinação homóloga entre os genes j e k, ambos os cromossomos contêm DNA de ambos os pais. Houve uma troca igual, recíproca entre eles.

22.01.07 16:37:33

158

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Mutações As mutações são alterações hereditárias na seqüência do DNA. Podem resultar de erros na replicação, de lesões no DNA ou de erros durante o reparo de lesões. Mutações que são trocas de um único par de bases são chamadas mutações puntuais. Mutações puntuais podem ser classificadas pela natureza das bases alteradas. Transições são mutações puntuais, nas quais uma purina é substituída por outra (p. ex., A por G ou G por A) ou uma pirimidina é substituída por outra (p. ex., T por C ou C por T). Deaminação de C, se não reparada, levaria a uma transição. A freqüência de transições é aumentada por análogos de bases, incluindo 2-amino purina (Corr. Clín. 4.7). Transversões são mutações puntuais, nas quais uma purina é substituída por uma pirimidina ou vice versa (p. ex., A por C ou C por A). Mutações puntuais também podem ser caracterizadas por seu efeito sobre uma seqüência codificadora. Mutações de sentido errado (missense) são mutações puntuais que trocam um único par de bases em um códon, de modo que o códon agora codifica um aminoácido diferente (Figura 4.24a). Mutações sem sentido (nonsense) são mutações puntuais que trocam um único par de bases em um códon para um códon de terminação (stop codon) que termina a tradução (Figura 4.24b). Mutações sem sentido geralmente têm efeitos mais graves do que mutações de sentido errado porque levam à síntese de polipeptídeos truncados (e geralmente instáveis). Mutações silenciosas ou sinônimos não alteram o aminoácido codificado; estas incluem muitas mudanças no terceiro nucleotídeo de um códon.

Inserções ou remoções de um ou mais pares de bases podem levar a mudanças na estrutura de leitura ( frameshifts) (se o número de pares de bases não for múltiplo de 3), destruindo o código de uma proteína (Figura 4.24c,d). Tradução de um mRNA não tem pontuação; ao contrário, uma vez que o código de iniciação tenha sido determinado, tripletes sucessivos são lidos como códons. Portanto, adição (ou deleção) de um múltiplo de três pares de bases em uma região codificadora adicionaria (ou subtrairia) aminoácidos a uma proteína, mas adição de outros números de pares de bases deslocaria a estrutura da leitura daquele ponto em diante. Mudança na estrutura de leitura ( frameshift) muda os aminoácidos codificados a partir do ponto de inserção ou remoção. Frameshifts geralmente levam à terminação prematura (ou, mais raramente, à elongação) da cadeia polipeptídica codificada, quando códons de terminação (stop codons) são gerados ou removidos pela mudança na estrutura de leitura. Alguns agentes químicos, incluindo acridinas e proflavina, intercalam-se no DNA; isto é, inserem-se entre pares de bases adjacentes. Isso geralmente leva a inserções ou remoções de um único par de bases. Mutações também podem resultar de alterações em larga escala, incluindo inserção de transposons. Embora raras em uma geração qualquer, mutações acumularam-se em populações ao longo de milhões de anos, de modo que duas pessoas diferem em cerca de 1 pb por 1000 ao longo de seus genomas. Muitas dessas diferenças genéticas não têm efeito, mas outras afetam nossa fisiologia, susceptibilidade a doenças e resposta a tratamentos (Corr. Clín. 4.8).

CORRELAÇÃO CLÍNICA 4.7

Análogos de Nucleosídeos como Drogas: Tiopurinas 6-Mercapto purina (6-MP) é um análogo de purina administrado oralmente que é útil na quimioterapia de leucemias agudas e para imunossupressão após transplante de órgãos. Age por vários mecanismos, incluindo inibição da biossíntese de purinas e toxicidade após incorporação no DNA. É metabolizado a 6-MP ribosina 5´-fosfato, que tem curta meia-vida, porque é degradada por xantina oxidase. A velocidade de degradação é muito reduzida em pacientes que estão sendo tratados com alopurinol (um inibidor da xantina oxidase) para hiperuricemia relacionada à gota, de modo que a dose deve ser drasticamente reduzida em tais pacientes.

Outra enzima que metaboliza 6-MP (e o antimetabólito relacionado 6-tioguanina) é tiopurina metil transferase (TPMT). Alguns pacientes (cerca de 10% da população) são heterozigotos para um polimorfismo que inativa a enzima e, portanto, tem aproximadamente 50% da atividade, e 1/300 das pessoas não têm atividade de TPMT e têm risco extremamente alto de imunossupressão grave e morte se forem tratadas com 6-MP. Por outro lado, pessoas que metabolizam as drogas mais rapidamente podem não chegar a ter dose terapêutica suficiente. Essa diferença farmacogenética, portanto, tem sérias implicações para o tratamento com tiopurinas.

Fonte: Sanderson, J., Ansari, A., Marinaki, T. e Duley, J. Thiopurine methyltransferase: Should it be measured before commencing thiopurine drug therapy? Ann. Clin. Biochem. 41:294, 2004.

BioQ.04 158

22.01.07 16:37:40

CAPÍTULO 4 REPLICAÇÃO, RECOMBINAÇÃO E REPARO NO DNA

|

169

| BIBLIOGRAFIA | Baynton, K. e Fuchs, R. P. P. Lesions in DNA: Hurdles for polymerases. Trends Biochem. Sci. 25:75, 2000. Berger, J. M., Gamblin, S. J., Harrison, S. C. e Wang, J. C. Structure and mechanism of DNA topoisomerase II. Nature 379:225, 1996. Blow, J. J. e Tada, S. A new check on issuing the license. Nature 404:560, 2000. Cooke, M. S., Evans, M. D., Dizdaroglu, M. e Lunec, J. Oxidative DNA damage: Mechanisms, mutation, and disease. FASEB J. 17:1995, 2003. Cox, M. M., Goodman, M. E., Kreuzer, K. N., Sherratt, D. J., Sandler, S. J. e Marians, K. J. The importance of repairing stalled replication forks. Nature 404:37, 2000. Evans, A. R., Limp-Foster, M. e Kelley, M. R. Going Ape over Ref-1. Mutat. Res. 461:83, 2000. Flores-Rozas, H. e Kolodner, R. D. Links between replication, recombination, and genome instability in eucaryotes. Trends Biochem. Sci. 25:196, 2000. Friedberg, E. C. DNA damage and repair. Nature 421:436, 2003. Friedberg, E. C. How nucleotide excision repair protects against cancer. Nature Rev. Cancer 1: 22, 2001. Gerson, S. L. MGMT: Its role in cancer aetiology and cancer therapeutics. Nature Rev. Cancer 4: 296, 2004. Haber, J. E. DNA recombination: the replication connection. Trends Biochem. Sci. 25:271, 2000. Hanawalt, P. C. Transcription-coupled repair and human disease. Science 266:1957, 1994. Hanawalt, P. C. The bases for Cockayne syndrome. Nature 405:415, 2000. Hubscher, U., Maga, G. e Spadari, S. Eukaryotic DNA polymerases. Annu. Rev. Biochem. 71:133, 2002. Human genome project. http://www.nhgri.nih.gov/HGP/ Human genome sequencing. http://www.ncbi.nih.gov/genome/ seq/ Johnson, R. E., Washington, M. T., Haracska, L., Prakash, S. e Prakash, L. Eucaryotic polymerases ι and ζ act sequentially to bypass DNA lesion. Nature 406:1015, 2000. Kowalczykowski, S. C. Initiation of genetic recombination and

recombination-dependent replication. Trends Biochem, Sci. 25:156, 2000. Lieber, M. R., Ma, Y., Pannicke, U. e Schwarz, K. Mechanism and regulation of human non-homologous DNA end joining. Nature Rev. Mol. Cell Biol. 4:712, 2003. Lindahl, T. e Wood, R. D. Quality control by DNA repair. Science 286:1897, 1999. Modrich, P. Mismatch repair, genetic stability, and cancer. Science 266:1959, 1994. Naktinis, V., Turner, J. e O’Donnell, M. A molecular switch in a replication machine defined by internal competition for protein rings. Cell 84:137, 1996. Online Mendelian Inheritance in Man (OMIM) http://www. ncbi.nlm.\nih.gov/entrez/query.fcgi?db=OMIM Rattray, A. J. e Strathern, J. N. Error-prone DNA polymerases: When making a mistake is the only way to get ahead. Annu. Rev. Genet. 37:31, 2003. Sancar, A. Excision repair in mammalian cells. J. Biol. Chem. 270:15915, 1995. Stillman, B. Cell cycle control of DNA replication. Science 274:1659, 1996. Stahl, F. Meiotic recombination in yeast: coronation of the double-strand-break repair model. Cell 87:965, 1996. Ulaner, G. A. Telomere maintenance in clinical medicine. Am. J. Med. 117:262, 2004. Von Hippel, P. H. e Jing, D. H. Bit players in the trombone orchestra. Science 287:2435, 2000. Waga, S. e Stillman, B. Anatomy of a DNA replication fork revealed by reconstitution of SV40 replication in vitro. Nature 369:207, 1994. Watson, J. D. e Crick, F. H. C. Genetical implications of the structure of deoxyribonucleic acid. Nature 171:964, 1953. Wood, R. D., Mitchell, M., Sgouros, J. e Lindahl, T. Human DNA repair genes. Science 291:1284, 2001. Yu, Z., Chen, J., Ford, B. N., Brackley, M. E. e Glickman, B. W. Human DNA repair systems: an overview. Environ. Mol. Mutagen. 33:3, 1999. Zakian, V. A. Telomeres: beginning to understand the end. Science 270:1601, 1995.

| QUESTÕES | Carol N. Angstadt Questões de Múltipla Escolha. 1. Replicação: A. é semiconservativa. B. requer apenas proteínas com atividade de DNA polimerase. C. usa atividade de polimerase 5’ para 3’ para sintetizar uma fita, e atividade de polimerase 3’ para 5’ para sintetizar a fita complementar. D. requer um primer em eucariotos, mas não em procariotos. E. deve começar com uma etapa de quebra. 2. Na replicação de DNA eucariótica: A. só um replissomo se forma, porque há uma única origem de replicação. B. os fragmentos de Okasaki têm 1000 a 2000 nucleotídeos de comprimento. C. helicase se dissocia do DNA assim que as bolhas de iniciação se formam.

BioQ.04 169

D. FEN 1 ( flap endonuclease 1) está envolvida na remoção do primer. E. o processo ocorre ao longo de todo o ciclo celular. 3. Todas as afirmativas seguintes sobre a telomerase são corretas, exceto: A. o componente RNA age como molde para a síntese de um segmento de DNA. B. adiciona telômeros às extremidades 5’ das fitas de DNA. C. fornece um mecanismo para replicar as extremidades de cromossomos lineares. D. reconhece uma fita única do DNA rica em G. E. é uma transcriptase reversa. 4. Uma mutação por transição: A. ocorre quando uma purina é substituída por uma pirimidina ou vice-versa. B. resulta da inserção de uma ou duas bases na cadeia de DNA.

22.01.07 16:37:56

172

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO IIF IID PA

IIB IIA TATA INR DPE

Pol II

IIE

IIH

5

RNA: TRANSCRIÇÃO E PROCESSAMENTO Francis J. Schmidt e David R. Setzer 5.1 VISÃO GERAL, 173 5.2 MECANISMOS DE TRANSCRIÇÃO, 173 Processo inicial de síntese de RNA é transcrição, 173 Informação em seqüência de DNA sinaliza síntese de RNA, 173 RNA polimerase catalisa o processo de transcrição, 174 Etapas da transcrição em procariotos, 175 Reconhecimento do promotor, 175 Início da síntese, 176 Elongação, 177 Terminação, 178 5.3 TRANSCRIÇÃO EM EUCARIOTOS, 178 Natureza da cromatina ativa, 178 Ativação da transcrição opera por recrutamento de RNA polimerase, 179 Enhancers, 179 Transcrição por RNA polimerase II, 180 Promotores para a síntese de mRNA, 180 Transcrição por RNA polimerase I, 181 Transcrição por RNA polimerase III, 181 A base enzimática comum para ação de RNA polimerases, 183 5.4 PROCESSAMENTO DE RNA, 184 RNA transportador é modificado por clivagem, adição e modificação de bases, 184 Clivagem, 184 Adição na extremidade 3´, 184 Nucleosídeos modificados, 184 Processamento de RNA ribossômico libera vários RNAs de um precursor mais longo, 184 Processamento de RNA mensageiro garante a seqüência codificadora correta, 185 RNA polimerase II recruta enzimas de processa-

BioQ.05 172

mento durante transcrição em eucariotos, 186 Capping, 186 Remoção de íntrons de precursores de mRNA, 186 Poliadenilação, 188 Mutações em sinais de splicing causam doenças humanas, 188 Splicing alternativo de pré-mRNA pode levar à síntese de múltiplas isoformas de proteínas a partir de uma única seqüência codificadora no DNA, 190 5.5 EXPORTAÇÃO DO RNA E CONTROLE DE QUALIDADE, 191 5.6 RNAs PEQUENOS INIBITÓRIOS, 192 5.7 REPARO DO DNA ACOPLADO À TRANSCRIÇÃO, 192 5.8 NUCLEASES E TURNOVER DO RNA, 193 BIBLIOGRAFIA, 194 QUESTÕES E RESPOSTAS, 195 CORRELAÇÕES CLÍNICAS 5.1 Antibióticos e Toxinas que Têm RNA Polimerase como Alvo, 176 5.2 Síndrome do X Frágil: Uma Doença de RNACromatina?, 179 5.3 Envolvimento de Fatores Transcripcionais em Carcinogênese, 182 5.4 Talassemia Devido a Defeitos na Síntese de RNA Mensageiro, 188 5.5 Auto-imunidade em Doença do Tecido Conjuntivo, 189 5.6 Síndrome de Cockayne, 193

22.01.07 16:40:55

CAPÍTULO 5 RNA: TRANSCRIÇÃO E PROCESSAMENTO Sítios HSS (setas)

5�

transcrito

179

CORRELAÇÃO CLÍNICA 5.2

Síndrome do X Frágil: Uma Doença de RNA-Cromatina?

Oviduto, imaturo Oviduto, maduro

Eritrócitos -5

0

Distância no DNA do início da transcrição, em quilobases

FIGURA 5.5 Sítios hipersensíveis à DNase (HSS) antes do promotor do gene de lisozima de galinha, uma unidade transcripcional eucariótica típica. Sítios hiper-sensíveis – isto é, seqüências próximas ao gene da lisozima que são particularmente susceptíveis à digestão por nucleases mesmo quando empacotadas em cromatina – são indicados por setas. É provável que esses sítios fiquem livres de nucleossomos. Note que alguns sítios hipersensíveis são encontrados no promotor da lisozima tanto em oviduto maduro como imaturo. Indução da síntese de lisozima em oviduto maduro é acompanhada pelo aparecimento de um novo sítio hipersensível. Em contraste, nenhum sítio hipersensível está presente em eritrócitos nucleados que nunca sintetizam lisozima. Adaptado de Elgin, S. C. R. J. Biol. Chem. 263:1925, 1988.

Outras modificações de histonas que influenciam atividade gênica incluem metilação, fosforilação e ubiquitinação. Combinações dessas modificações ocorrendo em diferentes posições específicas em histonas podem constituir um “código histona” que acopla modificação de histonas, compactação de cromatina, modificação do DNA e atividade gênica (Corr. Clín. 5.2). A idéia geral é que cromatina parcialmente desdobrada seja necessária, mas não suficiente, para transcrição.

Ativação de Transcrição Opera por Recrutamento de RNA Polimerase Fatores protéicos eucarióticos, independentemente da seqüência à qual se liguem, operam de modo fundamentalmente diferente do fator σ de E.coli. Em vez de primeiro fazer parte de um complexo protéico e depois procurar a seqüência relevante no DNA, os fatores se ligam a um sítio específico (seqüência) do DNA e depois ligam RNA polimerase (com ou sem envolvimento de fatores intermediários). Esse mecanismo é chamado “recrutamento”. Recrutamento é um meio pouco importante em ativação de genes em procariotos, e o principal mecanismo em eucariotos.

Enhancers Enhancers ou amplificadores aumentam muitas vezes a expressão de um gene. Fatores de transcrição

BioQ.05 179

|

Síndrome do X frágil é a forma individual mais comum de retardo mental hereditário, afetando 1/1250 homens e 1/2000 mulheres. Uma variedade de sintomas anatômicos e neurológicos resulta de inativação do gene FMR1, localizado no cromossomo X. A genética da síndrome é complexa, devido ao mecanismo molecular da mutação do X frágil. A condição do X frágil resulta de expansão de uma seqüência repetida de um trinucleotídeo, CGG, encontrado na região 5’ não-traduzida do gene FRM1. Normalmente, essa repetição está presente em 30 cópias, embora indivíduos normais possam ter até 200 cópias da repetição. Em indivíduos com síndrome do X frágil, o gene FRM1 contém muito mais cópias, de 200 a milhares, da repetição CGG. A genética complexa da doença resulta do potencial da repetição CGG se expandir de geração para geração. A presença de um número anormalmente elevado de repetições CGG induz extensa metilação do DNA de toda a região do promotor de FMR1. DNA metilado é transcripcionalmente inativo, de modo que mRNA de FMR1 não é sintetizado. Ausência da proteína FMR1 leva à patologia da doença. Proteína FMR1 normalmente se localiza no citoplasma de todos os tecidos do feto jovem e, mais tarde, especialmente no cérebro e tecido neural fetal. A proteína FMR afeta tradução de vários mRNAs e uma hipótese é que essa proteína ajude na tradução e localização de mRNAs específicos durante desenvolvimento. Uma possibilidade descoberta recentemente é que a proteína FMR1 esteja envolvida em RNA de interferência e sua perda possa causar ampla regulação gênica anormal (ver Seção 5.7). É provável que várias vias de sinalização estejam ligadas à patologia dessa doença muito complexa. Fonte: Warren, S. L. e Nelson, D. L. Advance in molecular analysis of Fragile X syndrome. JAMA 271:536, 1994. Caskey, C. T. Triple repeat mutations in human disease. Science 256:784, 1992. Jin, P., Zarnescu, D. C., Ceman, S., Nakamoto, M., Mowrey, J., Jongens, T. A., Nelson, D. L., Moses, K. e Warren, S. T. Biochemical and genetic interaction between the fragile X mental retardation protein and the micro RNA pathway. Nature Neurosci. 7:113, 2004. Miyashiro, K. e Eberwine, J. Fragile X syndrome: (What’s) lost in translation? Proc. Natl. Acad. Sci. USA 101:17329, 2004. Fragile Site Mental Retardation 1 Gene; FMR1 in Online Mendelian Inheritance in Man, http://www.ncbi. nlm.nih.gov/entrez/dispomim.cgi?id=309550

22.01.07 16:41:05

184

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Nucleotídeos entram e RNA sai por dois outros canais separados na molécula. A despeito das diferenças em seqüências e composição em subunidades, RNA polimerases procarióticas e eucarióticas mantiveram estruturas semelhantes para desempenhar os mesmos objetivos levando à síntese de uma nova cadeia de RNA. Estas incluem: (1) passagem do DNA molde por um canal na enzima; (2) separação das fitas de DNA para formar uma bolha na qual um híbrido RNA-DNA existe com a extremidade 3’ da cadeia de RNA posicionada no sítio ativo; (3) colocação de nucleotídeos no sítio ativo por um poro da enzima; (4) uso de um íon metálico para ajudar na catálise da formação de uma nova ligação éster fosfato entre o fosfato α do nucleosídeo trifosfato que está chegando e a extremidade 3’ da cadeia nascente de RNA; (5) exclusão do RNA produzido por outro poro; e (6) direção do re-pareamento das duas fitas de DNA, à medida que saem da enzima. Lembre-se que a subunidade σ da holoenzima procariótica é responsável por ligar as caixas –10 e –35 de promotores. Estudos estruturais demonstraram que sigma é uma molécula oblonga, composta por um feixe de resíduos em α-hélice, empacotados em uma forma de “V” aberto. Um braço do “V” contém resíduos críticos para reconhecimento do promotor e ligação com polimerase core. Um lado desse braço contém uma α-hélice que se liga à seqüência “–10”, e a outra face liga polimerase core por interações hidrofóbicas.

|

5.4 PROCESSAMENTO DE RNA Cópias em RNA de seqüências de DNA devem ser modificadas em moléculas maduras, funcionais, em procariotos e eucariotos. As reações de processamento do RNA podem incluir remoção de nucleotídeos extras, modificação de bases, adição de nucleotídeos e separação de diferentes seqüências de RNA pela ação de nucleases específicas. Reações de processamento podem ocorrer cotranscripcionalmente (enquanto o RNA ainda está sendo transcrito) ou pós-transcripcionalmente (depois do transcrito ter sido liberado pela RNA polimerase). Finalmente, em eucariotos, RNAs são exportados do núcleo.

RNA Transportador É Modificado por Clivagem, Adição e Modificação de Bases Clivagem O transcrito primário de um gene de tRNA contém seqüências extras de nucleotídeos, tanto 5’ como 3’ da seqüência do tRNA. Esses transcritos primários também podem conter íntrons na região do anticódon. Reações de processamento pós-transcripcional ocorrem em uma

BioQ.05 184

ordem temporal bem definida, mas não necessariamente rígida. Primeiro, o transcrito primário é cortado de modo relativamente inespecífico para gerar uma molécula precursora com extensões 5’ e 3’ mais curtas. Então ribonuclease P, uma ribozima (ver p. 68), remove a extensão 5’ por clivagem endonucleolítica. A extremidade 3’ é cortada exonucleoliticamente, seguida por síntese da terminação CCA. Síntese dos nucleotídeos modificados ocorre em qualquer ordem em relação à clivagem nucleolítica. Remoção de íntrons é determinada pela estrutura secundária do precursor (ver Figura 5.10) e é executada por um sistema enzimático solúvel, com dois componentes; uma enzima remove o íntron e a outra sela novamente a cadeia nucleotídica.

Adição na Extremidade 3’ Todo tRNA funcional tem a seqüência CCA em sua extremidade 3’. Essa seqüência é essencial para tRNA aceitar aminoácidos. Na maioria dos casos, é adicionada seqüencialmente pela enzima tRNA nucleotidiltransferase. Nucleotidiltransferases usam ATP e CTP como substratos e sempre incorporam-nos em tRNA numa razão de 2C/1A. As extremidades CCA são encontradas tanto em tRNAs citoplasmáticos como mitocondriais.

Nucleosídeos Modificados Nucleotídeos de RNA transportador são os mais modificados de todos os ácidos nucléicos. Mais de 60 modificações diferentes nas bases e na ribose, exigindo bem mais de 100 diferentes reações enzimáticas, foram encontradas em tRNA. Muitas são simples, metilações de uma etapa, mas outras envolvem síntese com múltiplas etapas. Formação de algumas bases modificadas na realidade requer quebra da ligação β-glicosídica entre ribose e a base. Enzimas modificadoras produzem as mesmas modificações específicas em mais de uma espécie de tRNA; entretanto, as enzimas modificadoras são localespecíficas. A maioria das modificações se completa antes de os precursores de tRNA terem sido clivados ao tamanho do tRNA maduro.

Processamento de RNA Ribossômico Libera Vários RNAs de um Precursor Mais Longo O produto primário da transcrição do gene de rRNA é um RNA longo, chamado 45S RNA, que contém as seqüências dos rRNAs 28S, 5,8S e 18S. Processamento do 45S RNA ocorre no nucléolo, e é feito por grandes estruturas de ribonucleoproteínas, com múltiplas subunidades. Processamento dos rRNAs segue uma ordem seqüencial (Figura 5.11). Processamento de pré-rRNA em procariotos também envolve clivagem de precursores de alto peso molecular

22.01.07 16:41:13

CAPÍTULO 5 RNA: TRANSCRIÇÃO E PROCESSAMENTO

|

193

CORRELAÇÃO CLÍNICA 5.6

Síndrome de Cockayne Síndrome de Cockayne (CS) é uma doença complexa autossômica recessiva causada por uma mutação em um de dois genes. Pacientes com CS apresentam alterações de desenvolvimento e neurológicas, anomalias esqueléticas e de retina, e uma deformidade facial “tipo pássaro”. Morte geralmente ocorre por volta dos 20 anos de idade e é causada por degeneração neural. A maioria dos pacientes com síndrome de Cockayne são também fotossensíveis e predispostos a câncer de pele. Fotossensibilidade aponta para um defeito em reparo do DNA. Por exemplo, xeroderma pigmentoso (XP) resulta de mutações em vários dos componentes da via de reparo do DNA. CS também é uma deficiência em reparo do DNA. Surpreendentemente, um dos dois genes responsáveis pela síndrome é uma subunidade da RNA polimerase II. A proteína codificada pelo gene da síndrome de Cockayne B aumenta a velocidade de elongação pela RNA polimerase II. Como pode uma deficiência de RNA polimerase causar um problema no reparo do DNA? A resposta é que os pacientes com CS são deficientes no reparo do DNA acoplado à transcrição. Reparo acoplado à transcrição ocorre quando RNA polimerase fica

parada por ter encontrado uma base alterada (p. ex., um fotodímero de timina). Transcrição pára, o transcrito parcial é degradado, e a fita molde do DNA é reparada. Aparentemente, aumento da transcrição pela proteína CSB também estimula o reparo do DNA acoplado à transcrição. Se esta fosse toda a história, síndrome de Cockayne seria uma variante do xeroderma pigmentoso; entretanto, pacientes com XP têm desenvolvimento normal e são neurologicamente normais, embora ainda sejam fotossensíveis. O que causa as outras características de CS? É provável que esses outros sintomas sejam devidos a uma deficiência primária na elongação da transcrição causada pelo fator de elongação CSB alterado pela mutação. Essa idéia expande nosso entendimento da relação entre mutação e doença. Geralmente, doenças genéticas são causadas por uma mutação em processos bioquímicos que ficam fora das vias centrais de informação da célula. Isso faz sentido, porque inibição geral da síntese de DNA, RNA ou proteína seria letal num estágio precoce do desenvolvimento. Os defeitos generalizados de CS devem se dever à mutação afetando a transcrição de alguns genes mais do que a de outros.

Fonte: Citterio, E., Vermeulen, W. e Hoeijmakers, J. H. J. Transcriptional healing. Cell 101:447, 2000; Selby, C. P. e Sancar, A. Cockayne syndrome group B protein enhances elongation by RNA polymerase II. Proc. Natl. Acad. Sci. U.S.A. 94:11205, 1997. van Gool, A. J., van der Horst, G. T. J., Citterio, E. e Hoeijmakers, J. H. J. Cockayne syndrome: defective repair of transcription? EMBO J. 16:4155, 1997. Cockayne Syndrome, Type I; CKN1 in Online Mendelian Inheritance in Man, http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=216400

|

5.8 NUCLEASES E TURNOVER DO RNA As diferentes funções de RNA e DNA em expressão gênica refletem-se em seus destinos metabólicos. O repositório de informação genética de uma célula (DNA) deve ser preservado, explicando assim a existência dos múltiplos sistemas de reparo e edição do DNA no núcleo. Embora seqüências individuais de nucleotídeos no DNA possam ser recicladas, a molécula como um todo é metabolicamente inerte quando não está replicando. As várias moléculas de RNA, por outro lado, são individualmente dispensáveis e podem ser substituídas por espécies recém-sintetizadas com a mesma especificidade. Não é surpreendente que sistemas de reparo de RNA não sejam conhecidos. Em vez disso, RNAs defeituosos são removidos das células por degradação a nucleotídeos, que depois são reutilizados em novas espécies de RNA.

BioQ.05 193

Isso é mais claro para espécies de mRNA, que são classificadas como instáveis. Entretanto, mesmo os RNAs ditos estáveis são reciclados; por exemplo, a meia vida de espécies de tRNA no fígado é cerca de 5 dias. Uma meia vida bastante longa para um mRNA de mamíferos é 30 h. Remoção de RNAs do citoplasma é realizada por ribonucleases celulares. Nucleases são de vários tipos e especificidades. A distinção mais útil é entre exonucleases, que degradam RNA a partir da extremidade 5’ ou 3’, e endonucleases, que clivam ligações fosfodiéster dentro de uma molécula. Produtos de ação de RNase contêm fosfatos 3’- ou 5’-terminal, e tanto endo- como exonucleases podem ser melhor caracterizadas pela posição (5’ ou 3’), na qual o monofosfato criado pela clivagem fica localizado. A estrutura do RNA também afeta a ação da nuclease. A maioria das nucleases é menos eficiente em regiões de RNA com estrutura muito ordenada. Assim, tRNAs são preferencialmente clivados em regiões não-pareadas da seqüência. Por outro lado,

22.01.07 16:41:25

CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO

|

197

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

6

SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO Dohn Glitz 6.1 VISÃO GERAL, 198 6.2 COMPONENTES DO APARELHO DE TRADUÇÃO, 198 RNA mensageiro transmite informação codificada em DNA, 198 RNA transportador é uma molécula tradutora bilíngüe, 199 O código genético usa um alfabeto de quatro letras de nucleotídeos, 199 Códons em mRNA são palavras de três letras, 199 Pontuação, 199 Interações códon-anticódon permitem leitura de mRNA, 199 “Decifrando” o código genético, 200 Mutações, 201 Aminoacilação de RNA transportador ativa aminoácidos para síntese protéica, 203 Especificidade e fidelidade de reações de aminoacilação, 205 Ribossomos são bancadas de trabalho para síntese protéica, 205 6.3 BIOSSÍNTESE DE PROTEÍNAS, 209 Tradução é direcional e colinear com mRNA, 209 Iniciação da síntese de proteínas é um processo complexo, 209 Elongação é a formação passo a passo de ligações peptídicas, 211 Terminação da síntese do polipeptídeo requer um códon de parada (stop codon), 215 Tradução tem custo energético significativo, 215 Síntese de proteínas em mitocôndrias difere ligeiramente, 215

BioQ.06 197

Alguns antibióticos e toxinas inibem biossíntese de proteínas, 215 6.4 AMADURECIMENTO DE PROTEÍNAS: DOBRAMENTO, MODIFICAÇÃO, SECREÇÃO E DIRECIONAMENTO, 218 Chaperones ajudam em dobramento de proteínas 218 Proteínas para exportação seguem a via secretória, 218 Glicosilação de proteínas ocorre no retículo endoplasmático e no complexo de Golgi, 218 6.5 DIRECIONAMENTO PARA MEMBRANA E ORGANELAS, 224 Seleção de proteínas na via secretória, 224 Importação de proteínas por mitocôndrias requer sinais específicos, 227 Direcionamento para outras organelas requer sinais específicos, 227 6.6 MAIS MODIFICAÇÕES PÓS-TRADUÇÃO, 227 Proteólise parcial libera insulina e ativa zimogênios, 227 Aminoácidos podem ser modificados após incorporação em proteínas, 228 Biossíntese de colágeno requer muitas modificações pós-tradução, 231 Formação de pró-colágeno no retículo endoplasmático e no complexo de Golgi, 231 Maturação de colágeno, 231 6.7 REGULAÇÃO DA TRADUÇÃO, 234

22.01.07 16:43:42

CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO

sintetizam proteínas que serão secretadas da célula ou seqüestradas e funcionam em retículo endoplasmático, complexo de Golgi ou lisossomos. Em homogenatos celulares, fragmentos de membranas com ribossomos ligados constituem a fração microssomal; detergentes que destroem membranas liberam esses ribossomos.

|

6.3 BIOSSÍNTESE DE PROTEÍNAS Tradução É Direcional e Colinear com mRNA Seqüências de RNA mensageiro são escritas (e transcritas) 5’→3’, e durante tradução são lidas na mesma direção. Seqüências de aminoácidos são tanto escritas como sintetizadas do resíduo amino-terminal para o carboxi-terminal. Um ribossomo permanece ligado a uma molécula de mRNA e se move ao longo do comprimento do mRNA até que chegue a um códon de parada. Comparações de seqüências de mRNA com seqüências das proteínas que codificam mostraram uma correspondência perfeita, colinear, sem sobreposições e sem falhas entre a seqüência codificadora do mRNA e a do polipeptídeo sintetizado. (Para uma rara exceção, ver Corr. Clín. 6.4). De fato, é comum deduzir a seqüência de uma proteína, exclusivamente a partir da seqüência de seu mRNA ou do DNA de seu gene. Entretanto, a seqüência deduzida pode diferir da proteína genuína, devido a modificações pós-tradução. Uma história pode ser analisada em função de seu início, seu desenvolvimento ou parte do meio e seu final. Biossíntese de proteínas será descrita num arcabouço semelhante: início do processo, elongação durante a qual a maior parte da proteína é formada, e terminação da síntese e liberação do polipeptídeo completo. Vamos depois examinar modificações pós-tradução, pelas quais uma proteína pode passar.

Iniciação da Síntese de Proteínas É um Processo Complexo Iniciação requer aproximação de uma subunidade ribossômica pequena (40 S), um mRNA e um complexo tRNA do aminoácido amino-terminal, todos em uma orientação correta. Segue-se associação da subunidade grande (60 S) para formar um complexo de iniciação completo em um ribossomo 80 S. Esse processo requer um grupo de proteínas ligadas transitoriamente, conhecidas como fatores de iniciação, que só atuam na iniciação. A função específica de alguns fatores de iniciação eucarióticos permanece pouco clara, mas síntese de proteínas procariótica fornece um modelo mais simples para comparação. A iniciação da tradução é apresentada na Figura 6.7. Como primeira etapa, fator de iniciação eucarió-

BioQ.06 209

|

209

tico 2a (eIF-2a) liga-se a GTP e ao tRNA iniciador, MettRNA imet, para formar um complexo ternário. Nenhum outro aminoacil-tRNA pode substituir o Met-tRNA imet iniciação-específico nessa etapa. Procariotos também utilizam um tRNA iniciador específico, cuja metionina é modificada por formilação de seu amino grupo. Só fMettRNA imet é reconhecido pelo IF-2 procariótico. A segunda etapa requer subunidades ribossômicas 40 S associadas a uma proteína muito complexa, eIF-3. eIF-3 de mamíferos contém oito polipeptídeos diferentes e tem uma massa de 600-650 kDa; liga-se à superfície da subunidade 40 S que fará contato com a subunidade 60 S e bloqueia fisicamente a associação das subunidades. Portanto, eIF-3 é um fator antiassociação ribossômica – assim como eIF-6 que se liga a subunidades 60 S. Um complexo que inclui eIF-2a-GTP, Met-tRNA i Met, eIF-3-40 S e fatores protéicos adicionais agora se forma. Na terceira etapa, o complexo de préiniciação é formado: mRNA, eIF-4f, também chamado complexo de ligação ao cap, eIF-4a, uma helicase que desenrola estrutura secundária da seqüência líder não-traduzida do mRNA, PAB, uma proteína de ligação a poliA que faz uma alça aproximando a extremidade 3’ do mRNA do 5’-cap, e várias outras proteínas são necessárias. O mRNA é então percorrido 5´à3´ até que o primeiro triplete AUG seja encontrado. Raramente, o primeiro AUG não é usado e um AUG posterior, caracterizado por sua estrutura secundária no mRNA, é selecionado para iniciação. GTP é hidrolisado por eIF-2a com a ajuda de eIF-5, e eIF-2a-GDP e outros fatores são liberados. O eIF-2a-GDP interage com fator trocador de nucleotídeo de guanina eIF-2b e GTP para regenerar eIF-2a-GTP para outro ciclo de iniciação. A etapa final requer ligação desse complexo com uma subunidade 60S e um fator adicional, eIF-5b-GTP. GTP é hidrolisado, e eIF-5b-GDP e outros fatores são liberados. O complexo de iniciação completo é um ribossomo 80 S com o mRNA e tRNA iniciador corretamente posicionados para começar tradução. Procariotos usam menos fatores de iniciação para formar um complexo de iniciação similar. Suas subunidades 30 S, complexadas com um IF-3 mais simples, podem ligar mRNA ou um complexo ternário de IF-2, fMet-tRNA i met e GTP. Orientação do mRNA depende, em parte, do pareamento de bases entre uma seqüência rica em pirimidinas de oito nucleotídeos no 16 S rRNA e uma seqüência “Shine-Dalgarno” rica em purinas, cerca de 10 nucleotídeos antes do códon AUG iniciador. Complementaridade entre rRNA e mRNA pode incluir vários pares errados, mas maior complementaridade geralmente leva a iniciação que é mais eficiente. Fator de iniciação IF1 também atua na formação do complexo de pré-iniciação. Finalmente, subunidade 50 S é ligada, GTP é hidrolisado a GDP e os fatores de iniciação são liberados. É interessante que procariotos usem pareamento de bases RNA-RNA para posicionar mRNA, enquanto eucariotos usam muitos fatores protéicos para chegar ao mesmo resultado.

22.01.07 16:43:55

CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO

|

219

CORRELAÇÃO CLÍNICA 6.6

Deleção de um Códon, Modificação Pós-Tradução Incorreta e Degradação Prematura de Proteína: Fibrose Cística Fibrose cística é a doença autossômica recessiva mais comum em caucasianos, com uma freqüência de cerca de 1 por 2000. O gene CF tem 230 kb de comprimento e inclui 27 éxons que codificam uma proteína de 1480 aminoácidos. A proteína conhecida como regulador de condutância transmembrânica da fibrose cística ou CFTR (ver p. 474) é um membro de uma família de proteínas de transporte dependentes de ATP. Contém dois domínios que atravessam a membrana, cada um com seis regiões transmembrânicas, dois domínios de ligação a ATP e um domínio regulatório que inclui vários sítios de fosforilação. CFTR funciona como um canal de cloreto regulado por AMP cíclico. Epitélios em CF caracterizam-se por transporte defeituoso de eletrólitos. Os órgãos mais afetados incluem pulmões, pâncreas e fígado, e os efeitos que mais oferecem risco de vida envol-

vem secreções mucosas viscosas que levam a doença pulmonar obstrutiva crônica e infecções persistentes nos pulmões. Em cerca de 70% dos indivíduos afetados, há uma deleção dos três nucleotídeos que codificam fenilalanina 508, normalmente localizada no domínio 1 de ligação ao ATP, no lado citoplasmático da membrana plasmática. Como em várias outras mutações CF, a proteína com deleção de Phe 508 não se dobra corretamente no ER e não é adequadamente glicosilada ou transportada para a superfície celular. Em vez disso, é devolvida ao citoplasma para ser degradada nos proteassomos. Uma abordagem terapêutica, ainda não aplicada em pacientes, usa drogas que mimetizam interações chaperones com CFTR mutante e ajudam-nas em seu dobramento e transporte para a membrana.

Fonte: Ward, C., Omura, S., e Kopito, R. Degradation of CFTR by the ubiquitin-proteasome pathway. Cell 83:121, 1995. Plemper, R. K. e Wolf, D. H. Retrograde protein translocation: Eradication of secretory proteins in health and disease. Trends Biochem. Sci. 24:266, 1999. Egan, M. E., Pearson, M., Weiner, S. A., Rajendran, V., Rubin, D., GlocknerPagel, J., et al. Curcumin, a major constituent of turmeric, corrects cystic fibrosis defects. Science 304:600, 2004.

na nascente, a seqüência sinal hidrofóbica é inserida, e tradução e extrusão no, ou através do, translocon estão agora acopladas. Mesmo segmentos muito hidrofílicos ou carregados são direcionados através da membrana para o lúmen do ER. O peptídeo sinal é excisado pela peptidase sinal, uma proteína integral de membrana da face luminal do ER. A proteína pode dobrar, e componentes de proteínas formadas por múltiplas subunidades podem se organizar. Outras etapas podem incluir processamento proteolítico e glicosilação, que ocorre no lúmen do ER e durante trânsito da proteína pelo aparelho de Golgi e em vesículas secretórias.

Glicosilação de Proteínas Ocorre no Retículo Endoplasmático e no Complexo de Golgi Glicosilação de proteínas para formar glicoproteínas (ver p. 231) é importante por muitas razões. Glicosilação altera as propriedades de proteínas, modificando sua estabilidade, solubilidade e volume físico. Além disso, os resíduos de carboidratos atuam como sinais de reconhecimento que podem dirigir a distribuição de proteínas e influenciar interações célula-célula e

BioQ.06 219

FIGURA 6.12 Retículo endoplasmático rugoso. Três setas paralelas indicam três ribossomos dentre os muitos ligados às membranas. Seta única indica uma mitocôndria, para comparação. Cortesia de Dr. U. Jarlfors, University of Miami.

22.01.07 16:44:09

CAPÍTULO 6 SÍNTESE DE PROTEÍNAS: TRADUÇÃO E MODIFICAÇÕES PÓS-TRADUÇÃO

alça da seqüência líder 5’ do mRNA da ferritina (ver p. 807). Esse mRNA é seqüestrado para uso futuro. Ácido δ-aminolevulínico sintase, uma enzima da biossíntese de heme, também é regulada por um 5’-IRE no seu mRNA. Em contraste, mais mRNA do receptor de ferritina é necessário se ferro estiver limitado; seu mRNA tem IREs em sua região 3’ não-traduzida. Ligação da proteína repressora estabiliza o mRNA e prolonga sua vida útil. Muitos mRNAs regulados por crescimento, incluindo os de proteínas ribossômicas, têm um encadeamento de polipirimidinas em sua seqüência líder. Uma proteína que se liga a polipirimidinas ajuda a regular sua tradução. Moléculas pequenas de RNA regulam biossíntese de proteínas em dois níveis. Micro-RNAs (miRNA) são RNAs de 21 a 23 nucleotídeos de comprimento que são formados a partir de RNAs maiores dupla-fita ou grampo por uma endonuclease citoplasmática chamada Dicer. Uma RNA helicase separa as fitas, uma das quais é ligada por um complexo silenciador induzido por RNA (RISC) que guia o miRNA para seqüências complementares no mRNA. Formação de um duplex mRNA-miRNA imperfeito reprime tradução, mas não afeta estabilidade do mRNA. Interação cooperativa de múltiplos miRNAs com um mRNA aumenta eficiência de inibição. Dicer e RISC também geram duplexes perfeitamente complementares de moléculas pequenas de RNA com mRNA. Esses complexos de RNA pequeno de interferência (siRNA) resultam em clivagem e inativação do mRNA alvo por uma endonuclease RISC chamada slicer. RNAs de silenciamento e interferência são importantes no desenvolvimento normal e no desenvolvimento de câncer.

|

6.8 DEGRADAÇÃO E TURNOVER DE PROTEÍNAS Proteínas têm tempos de vida que variam muito. Células do cristalino não são substituídas e suas proteínas não são recicladas. Hemoglobina em eritrócitos dura o tempo de vida dessas células, cerca de 120 dias. Outras proteínas têm tempos de vida medidos em dias, horas ou até minutos. Algumas proteínas da coagulação do sangue sobrevivem apenas alguns dias, de modo que hemofílicos só estão protegidos por um curto período após transfusão ou injeção de fatores necessários. Diabéticos requerem injeções de insulina regularmente uma vez que o hormônio é metabolizado. Enzimas metabólicas variam quantitativamente, dependendo de necessidade ou mudança de situação; por exemplo, a concentração de enzimas do ciclo da uréia muda em resposta à dieta. Proteínas estão também sujeitas a danos por oxidação, proteólise, desnaturação ou outras modificações irreversíveis. Erros em tradução e dobramento levam a proteínas não-funcionais, e processamento proteolí-

BioQ.06 235

|

235

tico gera peptídeos não-funcionais como o peptídeo-C da pró-insulina. Em todos os casos, um “tratamento do lixo” é necessário. Proteólise reduz as proteínas a peptídeos e eventualmente a aminoácidos. A maioria desses aminoácidos é reciclada para sintetizar novas proteínas, mas alguns são metabolizados e seus produtos de degradação são excretados. Proteases digestivas como pepsina, tripsina, quimotripsina e elastase hidrolisam proteínas da dieta e não participam do turnover (reciclagem) intracelular de proteínas, mas os aminoácidos que geram contribuem para a reserva metabólica usada na tradução. Isso é particularmente necessário para aminoácidos essenciais (ver Tabela 19.1, p. 726).

Proteólise Dependente de ATP Ocorre em Proteassomos Uma via proteolítica bem descrita usa proteassomos, estruturas em forma de halteres que contêm cerca de 28 polipeptídeos (Figura 6.22). Um núcleo cilíndrico é tampado em ambas as extremidades por complexos em forma de V que ajudam a reconhecer e desdobrar polipeptídeos e transportá-los para o núcleo proteolítico em um mecanismo que depende de ATP. Direcionamento para proteassomos normalmente requer ubiquitina, uma proteína muito conservada de 76 aminoácidos. Proteínas são marcadas para degradação por poliubiquitinação, como mostrado na Figura 6.23. Ubiquitina é ativada por enzima E1 para formar um tioéster; ATP é necessário e um complexo transitório AMP-ubiquitina está envolvido. A ubiquitina é, então, passada para enzima E2 e, finalmente, via um grupo de complexos multiprotéicos E3, para uma proteína alvo. Ligação da ubiquitina ocorre por ligações isopeptídicas entre ε-amino grupos de resíduos de lisina da proteína e o resíduo de glicina carboxi-terminal da ubiquitina. Várias moléculas de ubiquitina são ligadas à proteína e uma à outra, e a proteína poliubiquitinada é levada aos proteassomos e degradada; uma isopeptidase libera ubiquitina intacta para ser reutilizada. Proteínas danificadas, defeituosas, dobradas erroneamente ou mutadas são rapidamente degradadas pela via da ubiquitina. Uma mutação na fibrose cística que resulta em deleção de um aminoácido altera muito a estabilidade de CFTR (Corr. Clín. 6.6). Seleção de proteínas nativas para degradação depende da especificidade da enzima E3; tanto conformação como seqüência de aminoácidos são importantes. Seqüências desestabilizadoras PEST (ricas em Pro, Glu, Ser e Thr) foram identificadas em várias proteínas de vida curta, e um motivo de interação com ubiquitina, que liga ubiquitina e às vezes também promove poliubiquitinação, foi identificado. Outro determinante é a identidade do aminoácido amino-terminal. De acordo com a regra do N-terminal, proteínas com resíduos amino-terminais diferentes são degradadas a velocidades completamente diferentes, e o tempo de vida de uma proteína pode ser modificado pela incorporação de um resíduo N-terminal desestabi-

22.01.07 16:44:26

CAPÍTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA

|

241

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO Plasmídeo Promotor

����Z

Restrição ao sítio A Restricção ao sítio B

Gene resistente à antibióticos

7

DNA RECOMBINANTE E BIOTECNOLOGIA Gerald Soslau 7.1

VISÃO GERAL, 242

7.2 A REAÇÃO DE POLIMERASE EM CADEIA (POLYMERASE CHAIN REACTION), 243 7.3 ENDONUCLEASES DE RESTRIÇÃO E MAPAS DE RESTRIÇÃO, 243 Endonucleases de restrição hidrolisam seletivamente DNA, 243 Mapas de restrição permitem preparação rotineira de segmentos definidos de DNA, 245 7.4 SEQÜENCIAMENTO DE DNA, 245 Método de clivagem enzimática interrompida: procedimento de Sanger, 246 7.5 DNA RECOMBINANTE E CLONAGEM, 248 DNAs de diferentes fontes podem ser ligados para formar uma nova espécie de DNA: DNA recombinante, 248 Vetores de DNA recombinante são produzidos por clonagem, 249 Clonagem direcional: DNA inserido em DNA vetor em uma direção específica, 249 Bactérias transformadas com DNA recombinante e necessidade de um processo de seleção, 250 Moléculas de DNA recombinante em uma biblioteca gênica, 250 PCR contorna a necessidade de clonar DNA, 251 7.6 SELEÇÃO DE UM DNA ESPECÍFICO CLONADO EM BIBLIOTECAS, 252 Seleção de bactéria transformada por perda de resistência a antibiótico, 252 α-Complementação para selecionar bactérias que carregam plasmídeos recombinantes, 254

BioQ.07 241

7.7 DETECÇÃO E IDENTIFICAÇÃO DE ÁCIDOS NUCLÉICOS E PROTEÍNAS QUE LIGAM DNA, 254 Ácidos nucléicos como sondas (probes) para seqüências específicas de DNA ou RNA, 254 Técnica de Southern blot para identificar fragmentos de DNA, 255 Polimorfismo de conformação de cadeia única, 256 Detecção de mRNA, 258 Detecção de proteínas que se ligam a seqüência específica no DNA, 258 7.8 DNA COMPLEMENTAR E BIBLIOTECAS DE DNA COMPLEMENTAR, 260 mRNA como molde para síntese de DNA usando transcriptase reversa, 260 mRNA desejado pode ser enriquecido por técnicas de separação, 261 Síntese de DNA complementar, 261 RNA celular total como molde para síntese de DNA usando RT-PCR, 262 7.9 BACTERIÓFAGOS, COSMÍDEO E VETORES DE CLONAGEM EM LEVEDURA, 262 Bacteriófagos como vetores de clonagem, 263 Examinando (screening) bibliotecas de bacteriófagos, 264 Clonando fragmentos de DNA em cosmídeos e vetores cromossomos artificiais, 264 7.10 ANÁLISE DE LONGAS SEQÜÊNCIAS DE DNA, 265 Subclonagem permite definição de grandes segmentos de DNA, 265 Caminhar nos cromossomos (chromosome walking) define arranjo de genes em segmentos longos de DNA, 265

22.01.07 16:48:30

254

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

α-Complementação para Selecionar Bactérias que Carregam Plasmídeos Recombinantes Vetores foram construídos (a série pUC) de tal modo que bactérias selecionadas transformadas com esses vetores carregando insertos de DNA estrangeiro, podem ser identificadas visualmente (Figura 7.10). Os plasmídeos pUC contêm as seqüências regulatórias e parte da seqüência 5’-codificadora (146 aminoácidos N-terminais) do gene da β-galactosidase (gene lacZ) do operon lac (ver p. 293). O fragmento traduzido N-terminal da β-galactosidase é um polipeptídeo inativo. E. coli mutante, que codifica a porção carboxi-terminal inativa que falta da β-galactosidase, pode ser transformada usando-se os plasmídeos pUC. A tradução das porções da β-galactosidase do plasmídeo e a da célula hospedeira em resposta a um indutor, isopropil tio-β-d-galactosídeo, se complementam mutuamente gerando uma enzima ativa. O processo é chamado α-complementação. Quando essas bactérias transformadas são crescidas em presença de um substrato cromogênico (5-bromo-4-cloro-3-indolil-β-D-galactosídeo [X-gal]) para a β-galactosidase, formam colônias azuis. Se, entretanto, um fragmento de DNA estrangeiro for inserido na seqüência da porção N-terminal da β-galactosidase, a enzima ativa não pode ser formada. Bactérias transformadas com esses plasmídeos recombinantes e crescidas em X-gal dão colônias brancas e podem ser selecionadas visualmente, das colônias azuis não transformadas. Sítio de policlonagem

ampr

pUC 18 2686 bp

|

7.7 DETECÇÃO E IDENTIFICAÇÃO DE ÁCIDOS NUCLÉICOS E PROTEÍNAS QUE LIGAM DNA Ácidos Nucléicos como Sondas (Probes) para Seqüências Específicas de DNA ou RNA Sondas de DNA e RNA são usadas para seleção de bactérias que abrigam DNA recombinante de interesse, para análise de mRNA expresso em uma célula ou para identificação de seqüências de DNA em um genoma. Contêm seqüências complementares ao ácido nucléico alvo e hibridizam com o ácido nucléico de interesse. O grau de complementaridade determina a força de ligação da sonda. A sonda não precisa conter a seqüência complementar inteira do DNA. A sonda pode ser marcada, geralmente com 32P ou com marcas não-radioativas que dependem de substratos de enzimas acoplados a nucleotídeos que, quando incorporados ao ácido nucléico, podem ser detectados por uma reação catalisada por enzima. Sondas marcadas podem ser produzidas por nick translation (tradução com corte) do DNA dupla-fita.

N-terminal interrompido

Seqüência codificadora N-terminal do gene da �-galactosidase do operon-���

ampr

pUC 18 2686 bp

DNA estranho inserido N-terminal interrompido

Promotor

Transformação

Transformação Cromossomo

� pUC18

Seqüência codificadora N-terminal do gene da � -galactosidase do operon-���

A bactéria cresce em agar contendo X-gal a um indutor do operon����

pUC18 recombinante A bactéria cresce em agar contendo X-gal a um indutor do operon����

Colônias brancas contêm pUC18 recombinante

FIGURA 7.10 α-Complementação para detecção de bactérias transformadas. Um vetor construído (pUC 18) expressa a seqüência codificadora N-terminal da enzima β-galactosidase do operon lac. Bactérias mutantes que codificam a região C-terminal da β-galactosidase são transformadas com pUC 18. Essas bactérias transformadas, crescidas em presença de um substrato especial para a enzima intacta (X-gal), resultam em colônias azuis, porque contêm a enzima para reagir com o substrato. As seqüências codificadoras funcionais N-terminal e C-terminal do gene complementam-se mutuamente, gerando uma enzima funcional. Se, entretanto, um fragmento de DNA estrangeiro for inserido, interrompe a seqüência codificadora N-terminal da β-galactosidase, bactérias transformadas com essa molécula recombinante não produzirão enzima funcional. Colônias de bactérias que contêm esses vetores recombinantes podem ser detectadas visualmente como colônias brancas.

Colônias azuis Colônias azuis contêm pUC18 sem o DNA estrangeiro

BioQ.07 254

22.01.07 16:48:41

CAPÍTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA

|

259

CORRELAÇÃO CLÍNICA 7.6

Polimorfismo de Conformação de Cadeia-Única para Detecção de Mutações Espontâneas que Podem Levar a SIDS a síndrome do QT longo continha a substituição de AAC para TCC na posição 2971 a 2972 (proteína associada com o canal de sódio), por análise de polimorfismo de conformação de cadeia-única (SSCP) na amostra de DNA da criança, mas não dos pais. A mutação substituiu um resíduo de serina por uma asparagina em uma região muito conservada da proteína, que se presume participe da função do canal de sódio. A mutação não foi detectada em 200 indivíduos controles. A conclusão foi que a criança tinha uma mutação espontânea em um gene associado com intervalo QT prolongado e isso contribuiu para um evento tipo SIDS. Após tratamento, a criança ficou sem nenhum sintoma por volta dos cinco anos de idade. Esse estudo indica o valor potencial do exame eletrocardiográfico neonatal para reduzir mortalidade infantil por SIDS.

A síndrome da morte súbita infantil (SIDS) é uma causa importante de morte durante o primeiro ano de vida nos Estados Unidos. Estudo prospectivo em mais de 34.000 recém-nascidos que foram monitorados por eletrocardiografia indicou uma forte correlação entre risco aumentado de SIDS e intervalo QT prolongado em seu ECG. Com base nesse estudo, decidiu-se procurar uma mutação em um ou mais dos genes que se sabe estarem relacionados com a síndrome do QT longo em uma criança de 44 dias de idade, que se apresentou cianótica, apnéica e sem pulso ao pronto-socorro de um hospital. A arritmia da criança com um intervalo QT prolongado foi estabilizada com múltiplos eletrochoques DC, seguidos de tratamento com drogas. DNA genômico foi preparado a partir de linfócitos do sangue periférico da criança e de seus pais. Um gene associado com

Fonte: Schwartz, P. J., Priori, S. G., Dumaine, R. Napolitano, C., Antzelevitch, C., Stramba-Badiale, M., Richard, T. A., Berji, M. R. e Bloise, R. A molecular link between the sudden infant death syndrome and the long-QT syndrome. N. Engl. J. Med. 343:262, 2000.

(a) Solução de hidrização 250 bases

Sonda X

Sonda Y

+ +

mRNAX

300 bases

mRNAY

Outros RNAs

400 bases

Sonda Z

+

mRNAZ

e sondas não hidridizadas

(b) Digestão com nuclease Híbrido X

250 bp

+

Híbrido Y

300 bp

+

Híbrido Z

400 bp

FIGURA 7.13 Ensaio de proteção de nuclease. mRNA celular total pode ser isolado de diferentes tecidos. Sondas de DNA fita-única que são complementares a seqüências conhecidas de diferentes genes transcritos (mRNAx, mRNAy, mRNAz) são hibridizadas com a mistura de RNAs. Digestão com uma ribonuclease hidrolisará as regiões de RNA fita-única de mRNA não-hibridizado com a sonda de DNA e todas as espécies de RNA que não hibridizaram. Só os híbridos DNA-RNA protegidos da nuclease permanecerão para análise por eletroforese em gel de poliacrilamida. Expressão diferencial de genes em diferentes tecidos é, então, facilmente observada

Pele

Cérebro

Pulmão

Coração

Padrão

(c ) Reações de amostras de RNA de diferentes tecidos analisadas por eletroforese em gel de poliacrilamida.

400 bp 300 bp 250 bp

BioQ.07 259

22.01.07 16:48:46

272

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO Gene ��� Z truncado

RE Gene clonado Endonucleose de restrição (RE)

Gene clonado e purificado

Sítio de policlonagem

Elemento regulatório de ��� Z

RE PLASMÍDEO

Vetor M13

Transformar ������ susceptível

Fita recombinante (–) do M13

Isolar DNA fita única de M13 recombinante do meio

Oligômero com um único nucleotídeo com pareamento errado

M13 RECOMBINANTE

DNA polimerase quatro dNTPs, DNA ligase

DNA ligado a filtro de nitrocelulose com NaOH, hibridizado com sonda marcada para o oligômero com pareamento errado

5� 3�

Transformar ������ suscetível e plaquear o bacteriófago resultante contendo M13 tipo selvagem mais DNA mutado sobre o tapete de ������ crescida em agar

Tocar a placa de agar com filtro de nitrocelulose Mutante putativo

Auto-radiografia

fita de M13 é transformado em uma E. coli tipo-selvagem, a fita contendo uracil é destruída e a fita mutada (–)serve de molde para a progênese dos bacteriófagos, a maioria dos quais carregando a mutação de interesse. O PCR também pode ser empregado para mutagênese sítio-dirigida. Estratégias foram desenvolvidas para incorporar uma base com pareamento errado em um dos oligonucleotídeos que servem de primer para o PCR. Alguns desses procedimentos empregam bacteriófago M13 e seguem os princípios descritos na Figura 7.26. Uma variação desses métodos de PCR, mutagênese por PCR inverso, foi aplicada a pequenos plasmídeos recombinantes (4-5 kb) (Figura 7.25). O método é muito rápido, com 50-100% das colônias geradas contendo a seqüência mutante. Os dois primers são sintetizados de modo que pareiem final-comfinal com um primer contendo a base errada.

BioQ.07 272

FIGURA 7.25 Mutagênese sítio-dirigida de um único nucleotídeo e detecção do DNA mutado. A figura é uma visão geral simplificada do método. Esse processo envolve a inserção de um fragmento de DNA amplificado puro em um vetor bacteriófago modificado, M13. E. coli susceptível, transformada com o DNA recombinante de M13, sintetiza a fita (+) de DNA, acondicionada nas proteínas do bacteriófago. Os bacteriófagos são isolados do meio de cultura, e o DNA do M13 recombinante fita-única é purificado. O DNA do M13 recombinante serve de molde para replicação do DNA por DNA polimerase, desoxinucleosídeos trifosfato (dNTPs), DNA ligase e um primer especial. O primer de DNA (oligômero com pareamento errado) é sintetizado de modo a ser exatamente complementar a uma região do DNA (gene) de interesse, exceto por uma base que se deseja alterar (mutar). O DNA do M13 recém-sintetizado, portanto, contém uma base especificamente mutada que, quando reintroduzida em E. coli susceptível, será fielmente replicada. A E. coli transformada é crescida em placas de agar com réplicas das colônias resultantes sendo feitas em filtro de nitrocelulose. DNA associado com cada colônia é desnaturado e fixado ao filtro com NaOH, e o DNA ligado ao filtro é hibridizado com uma sonda oligômero de DNA marcada com 32P, com pareamento errado. Os mutantes putativos são, então, identificados por exposição do filtro a filme de raio X.

|

7.14 APLICAÇÕES DA TECNOLOGIA DO DNA RECOMBINANTE Métodos de DNA recombinante são aplicáveis a numerosas disciplinas biológicas incluindo agricultura, estudos de evolução, biologia forense e clínica médica. Engenharia genética pode introduzir proteínas novas ou alteradas em grãos (p. ex., milho), de modo que eles contenham aminoácidos essenciais para o homem mas freqüentemente ausentes de proteínas vegetais. Toxinas letais a insetos específicos, mas inócuas ao homem, podem ser introduzidas em grãos para protegerem as plantas, evitando assim o uso de pesticidas que agridem o meio ambiente. O DNA isolado de células do líquido amniótico de uma mulher grávida pode ser analisado quanto a defeitos genéticos no feto. Quantidades mi-

22.01.07 16:49:01

CAPÍTULO 8 REGULAÇÃO DA EXPRESSÃO GÊNICA

|

287

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

8

REGULAÇÃO DA EXPRESSÃO GÊNICA Daniel L. Weeks e John E. Donelson

8.1 VISÃO GERAL, 288 8.2 UNIDADE DE TRANSCRIÇÃO EM BACTÉRIAS: O OPERON, 288

8.7 EXPRESSÃO GÊNICA EM EUCARIOTOS, 300 DNA eucariótico é ligado a histonas para formar cromatina, 301 Metilação do DNA correlaciona-se com inativação de genes, 302

8.3 OPERON LACTOSE DE E. COLI, 288 Repressor do operon lactose é uma proteína difusível, 290 Seqüência operador do operon lactose é contígua a um promotor e três genes estruturais, 291 RNA polimerase e uma proteína reguladora reconhecem seqüência do promotor do operon lactose, 292 Proteína ativadora de catabólito liga promotor lactose, 292

8.8 COMPLEXO DE PRÉ-INICIAÇÃO EM EUCARIOTOS: FATORES DE TRANSCRIÇÃO, RNA POLIMERASE II E DNA, 303 Promotores eucarióticos e outras seqüências que influenciam transcrição, 305 Projeto modular de fatores de transcrição eucarióticos, 305 Motivos comuns em proteínas que ligam DNA e regulam transcrição, 306

8.4 OPERON TRIPTOFANO DE E. COLI, 293 Operon triptofano é controlado por uma proteína repressora, 293 Região atenuadora do operon triptofano, 295 Atenuação da transcrição controla outros operons de biossíntese de aminoácidos, 296

8.9 REGULAÇÃO DA EXPRESSÃO GÊNICA EUCARIÓTICA, 308 Regulando os reguladores, 309 Ativação da transcrição do gene do receptor de LDL ilustra muitas características encontradas na regulação gênica eucariótica, 309

8.5 OUTROS OPERONS BACTERIANOS, 297 Síntese de proteínas ribossômicas é regulada de modo coordenado, 297 Resposta estringente controla síntese de rRNAs e tRNAs, 297

BIBLIOGRAFIA, 312

8.6 TRANSPOSONS BACTERIANOS, 299 Transposons são segmentos móveis do DNA, 299 Transposons TN3 contêm três genes estruturais, 299

BioQ.08 287

QUESTÕES E RESPOSTAS, 312 CORRELAÇÕES CLÍNICAS 8.1 Resistência Transmissível a Múltiplas Drogas, 300 8.2 Síndrome de Rubstein-Taybi, 302 8.3 Tamoxifeno e Receptor de Estrógeno como Alvo, 309 8.4 Fatores de Transcrição e Doença Cardiovascular, 310

22.01.07 16:52:32

CAPÍTULO 8 REGULAÇÃO DA EXPRESSÃO GÊNICA

influencie a formação de alças em grampo alternativas, uma das quais lembrando um grampo de terminação seguido de vários resíduos U. Ao contrário do operon trp, transcrição do operon his é regulada primariamente por atenuação, uma vez que não possui um operador reconhecido por uma proteína repressora. Em vez disso, o ribossomo age como uma proteína reguladora positiva, semelhante ao complexo cAMP-CAP no operon lac. Se o ribossomo estiver ligado (i.é., parado) no sítio atenuador, transcrição dos genes estruturais a seguir estará aumentada. Se o ribossomo não estiver ligado, transcrição desses genes estará muito reduzida. Transcrição de alguns operons, mostrados na Figura 8.11, pode ser atenuada por mais de um aminoácido. Por exemplo, o operon thr é atenuado por treonina ou isoleucina, enquanto o operon ilv é atenuado por leucina, valina ou isoleucina. Esse efeito pode ser explicado em todos os casos por pausa do ribossomo no códon correspondente, o que interfere com formação de um grampo de terminação. É possível que em seqüências líderes mais longas, a pausa em mais de um códon seja necessária para atingir máxima transcrição pela região de atenuação.

|

8.5 OUTROS OPERONS BACTERIANOS Síntese de Proteínas Ribossômicas É Regulada de Modo Coordenado Muitos operons bacterianos possuem os mesmos mecanismos regulatórios gerais dos operons lac, trp e his. Entretanto, cada operon tem suas próprias características distintas. Um exemplo é dado pelos genes estruturais das 70 ou mais proteínas que compõem os ribossomos (Figura 8.12). Cada ribossomo contém uma cópia de cada proteína ribossômica (exceto proteínas L7L12, que provavelmente estão presentes em quatro cópias). Portanto, todas as 70 proteínas são necessárias em quantidades equimolares, e faz sentido que sua síntese seja regulada de modo coordenado. Seis operons diferentes, contendo cerca de metade dos genes de proteínas ribossômicas, ocorrem em dois grupos principais de genes. Um grupo contém quatro operons adjacentes (Spc, S10, str e a) e o outro grupo tem dois operons (L11 e rif) localizados em outro ponto do cromossomo de E. coli. Não há nenhum padrão óbvio de distribuição dos genes entre esses operons. Alguns operons codificam proteínas de uma subunidade ribossômica; outros codificam proteínas de ambas as subunidades. Esses operons também contêm genes de outras proteínas (relacionadas). Por exemplo, o operon str contém genes de fatores de elongação de tradução solúveis, EF-Tu e EF-G, e genes de algumas proteínas da subunidade ribossômica 30S. O operon a contém genes de proteínas de ambas

BioQ.08 297

|

297

Operon

Proteína regulatória

Proteínas especificadas pelo operon

���

S8

L14-L24-L5-S14-S8-L6-L18-S5-L15-L30

���

L4

S10-L3-L2-L4-L23-S19-L22-S3-S17-L16-L29

���

S7

S12-S7-EF•G-EF•Tu

S4

S13-S11-S4-�-L17

���

L1

L11-L1

���

L10

L10-L7-����

FIGURA 8.12 Operons contendo genes de proteínas ribossômicas de E. coli. Genes dos componentes protéicos das subunidades ribossômicas pequena (S) e grande (L) de E. coli ficam agrupados em vários operons. Alguns desses operons também contêm genes das subunidades α, β e β‘ da RNA polimerase e fatores de síntese protéica EF-G e EF-Tu. Pelo menos um dos produtos protéicos de cada operon geralmente regula expressão desse operon (ver texto).

as subunidades ribossômicas e um gene da subunidade α da RNA polimerase. O operon rif tem os genes das subunidades β e β’ da RNA polimerase e de proteínas ribossômicas. Uma característica comum aos seis operons de proteínas ribossômicas é que sua expressão é regulada por um dos produtos de seus próprios genes estruturais; isto é, são auto-regulados. Em alguns casos, regulação ocorre em nível de tradução, não de transcrição como discutido para operons lac e trp. Depois que o mRNA policistrônico é feito, a proteína ribossômica “regulatória” liga-se a esse mRNA e determina que região, se alguma, será traduzida. Em geral, a proteína ribossômica que regula expressão de seu próprio operon associa-se com RNA ribossômico (rRNAs) no ribossomo. Essa proteína tem uma alta afinidade por rRNA e uma afinidade menor por uma ou mais regiões de seu próprio mRNA. Portanto, competição ocorre entre rRNA e o operon do mRNA pela ligação com a proteína. À medida que a proteína se acumula, alcançando um nível mais alto que o de rRNA livre, liga-se a seu próprio mRNA e impede síntese protéica em uma ou mais das seqüências codificadoras desse mRNA (Figura 8.13). Quando mais ribossomos são formados, o excesso dessa proteína ribossômica é usado e tradução de seu mRNA pode recomeçar.

Resposta Estringente Controla Síntese de rRNAs e tRNAs Bactérias respondem de várias maneiras a extremo estresse geral. Uma dessas situações é quando há aminoácidos insuficientes para manter síntese protéica. Nessas condições, a célula invoca a resposta estringente, que reduz síntese de rRNAs e tRNAs cerca de 20 vezes. Síntese de mRNAs também diminui cerca de três vezes.

22.01.07 16:52:44

300

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

CORRELAÇÃO CLÍNICA 8.1

Resistência Transmissível a Múltiplas Drogas Uma tendência alarmante é que bactérias patogênicas estão ficando cada vez mais resistentes a um grande número de antibióticos. Muitos casos foram documentados, nos quais uma cepa bacteriana em um paciente que vinha sendo tratado com um antibiótico, subitamente torna-se resistente a esse antibiótico e, simultaneamente, a vários outros antibióticos, embora essa cepa bacteriana nunca tenha sido exposta antes a esses outros antibióticos. Isso ocorre quando a bactéria subitamente adquire, de outra cepa bacteriana, um plasmídeo que contém vários transposons diferentes, cada um contendo um ou mais genes de resistência a antibióticos. Exemplos incluem: os genes que codificam β-lactamase, que inativa penicilina e cefalosporinas; a cloranfenicol acetiltransferase, que inativa cloranfenicol; e fosfotransferases, que modificam aminoglicosídeos, como neomicina e gentamicina. Fonte: Neu, H. C. The crisis in antibiotic resistance. Science 257:1064, 1992

transcritos de modo divergente a partir de uma região de controle de 163 pb, localizada entre eles, que liga o repressor. O repressor também participa da inserção do novo transposon, mas não afeta transcrição do gene de resistência à ampicilina. Mutações em tnpA que inativam a transposase diminuem a freqüência de transposição de Tn3. Mutações em tnpR que inativam o repressor aumentam a freqüência de transposição. Essas mutações desreprimem tnpA, resultando em mais moléculas de transposase; isso aumenta a formação de mais cópias duplicadas do transposon. Também desreprime tnpR, mas como o repressor é inativo, isso não tem efeito. Transposons localizados em plasmídeos bacterianos são de importância crescente em uso clínico de antibióticos. Plasmídeos bacterianos que não foram alterados para uso experimental geralmente contêm genes que facilitam sua transferência de uma bactéria para outra. Quando esses plasmídeos se transferem entre diferentes cepas bacterianas infecciosas, seus transposons contendo genes de resistência a antibióticos são transportados para as novas cepas bacterianas. Uma vez dentro de uma nova bactéria, o transposon pode se duplicar no cromossomo e ficar permanentemente estabelecido naquela linhagem celular. O resultado é que mais e mais cepas de bactérias patogênicas tornaramse resistentes a um número crescente de antibióticos.

BioQ.08 300

|

8.7 EXPRESSÃO GÊNICA EM EUCARIOTOS Transcrição de genes em organismos eucarióticos é também regulada para dar a resposta adequada a necessidades biológicas. Além de modular a expressão de genes em resposta a condições nutricionais ou ambientais, organismos multicelulares regulam a expressão de genes especializados que direcionam diferenciação celular e caracterizam tipos celulares específicos. Alguns genes (chamados genes zeladores ou housekeeping) são expressos na maioria das células, outros são ativados sob demanda e outros, ainda, ficam permanentemente inativos em todos, exceto alguns poucos tipos de células. Em células eucarióticas, a membrana nuclear serve de barreira que permite seletivamente o acesso de algumas proteínas ao DNA, enquanto mantém outras no citosol. Em bactérias, uma RNA polimerase é responsável pela transcrição de todos os RNAs (tRNA, rRNA e mRNA). Em organismos eucarióticos, três RNA polimerases diferentes são usadas (ver p. 181). RNA polimerase I transcreve os genes de rRNA, RNA polimerase II transcreve os genes que codificam proteínas, cujos transcritos se tornam mRNAs, e RNA polimerase III transcreve os genes de tRNAs e a maioria dos outros RNAs pequenos. Embora alguns princípios de ativação gênica e controle eucarióticos se apliquem a todas as três RNA polimerases, nesta seção o foco será transcrição por RNA polimerase II. RNA polimerase II é composta por pelo menos 10 subunidades diferentes, com tamanhos entre 10 e 220 kDa. Algumas das subunidades são também parte dos complexos das RNA polimerases I e III, enquanto outras são exclusivas da RNA polimerase II. A subunidade maior da RNA polimerase II tem, dependendo da espécie, até 52 repetições da seqüência de aminoácidos PTSPSYS em sua região C-terminal (CTD, C-terminal domain). Uma característica própria dessas repetições é que treonina (T), serina (S) e tirosina (Y) podem ser fosforiladas. Para entender melhor a regulação da transcrição em eucariotos, é útil relembrar a organização do DNA em cromatina e o papel de modificação no DNA, especialmente metilação de citosina, sobre ativação gênica. Além disso, vamos considerar como RNA polimerase II é posicionada no ponto correto do promotor de um gene para transcrever esse gene pela formação de um complexo de pré-iniciação, que envolve organização de fatores de transcrição gerais (TFs) com RNA polimerase II. A seguir, vamos ver como atividade de genes específicos pode ser regulada pelo uso de enhancers, sítios de ligação de fatores de transcrição e sítios de organização de RNA polimerase. Finalmente, vamos discutir a ativação da transcrição por fatores de transcrição específicos, algumas de suas características gerais e como são regulados.

22.01.07 16:52:47

308

|

PARTE 2 TRANSMISSÃO DA INFORMAÇÃO

Proteínas bZIP têm um domínio de ligação ao DNA composto por uma região básica, definida pela presença de arginina e lisina, localizada a sete aminoácidos antes da primeira leucina e α-hélice. Os aminoácidos básicos estabilizam a associação DNA-proteína por interações eletrostáticas com o esqueleto carregado negativamente do DNA, além de formar pontes de hidrogênio na fenda maior. Sítios de ligação de homodímeros têm simetria díade, enquanto essa simetria não é encontrada em sítios de ligação de heterodímeros. A classe hélice-alça-hélice de fatores de transcrição inclui myoD, myc e max. Dois segmentos de α-hélice anfipática separados por uma alça interveniente caracterizam proteínas hélice-alça-hélice. As hélices não são responsáveis por ligação com DNA, como nas proteínas dedos de zinco, mas por dimerização com outra proteína. Como foi descrito para as proteínas bZIP, os dímeros formados podem ser homo ou heterodímeros. O domínio de ligação ao DNA é uma extensão de uma das α-hélices que formam o feixe de quatro-hélices gerado por dimerização (Figura 8.27).

|

8.9 REGULAÇÃO DA EXPRESSÃO GÊNICA EUCARIÓTICA Como indicado acima, uma região relativamente pequena de uma proteína regulatória pode ser dedicada à ligação seqüência-específica ao DNA, enquanto outros domínios estão envolvidos em interações proteína-proteína ou ligante. Vários domínios de ativação característicos foram identificados, incluindo domínios ácidos (alta concentração de aminoácidos com cadeias laterais ácidas), domínios ricos em glutamina, e domínios ricos em prolina. Experimentalmente, superprodução de qualquer desses domínios por técnicas de recombinação, mesmo sem seus domínios de ligação ao DNA correspondentes, pode levar à ativação errônea de transcrição de uma variedade de genes. Eles parecem ativar transcrição por meio do aumento da taxa de montagem do complexo de pré-iniciação. Alguns interagem diretamente com TFIID, aumentando ligação ao TATA box, enquanto outros interagem com TFIIB ou TAFs que são parte do complexo TFIID. Quando múltiplos fatores de transcrição se ligam a um promotor, eles podem ter um efeito combinatório sobre a ligação e a montagem do complexo de pré-iniciação. Domínios de ativação de muitos fatores de transcrição têm como alvos as mesmas proteínas no complexo de pré-iniciação.

���

���

Homodímero HLS ativo

Heterodímero HLS inativo

FIGURA 8.27 Formação do fator de transcrição dimérico é mediada por interações hélice-alça-hélice. O motivo hélice-alça-hélice aproxima dois monômeros para formar um dímero que se liga ao DNA. (a) Cada monômero tem duas hélices unidas por uma alça. Uma hélice é usada para interação proteína-proteína, enquanto a outra é usada para ligar a fenda maior do DNA. Assim, o dímero consiste de um feixe de quatro hélices Se o dímero for formado por dois monômeros idênticos, então se espera que os sítios de ligação no DNA sejam muito semelhantes ou idênticos; entretanto, se os monômeros forem proteínas diferentes (formando heterodímeros), então os sítios de ligação no DNA podem ser não-relacionados. (b) Quando fatores de transcrição ligam-se como dímeros, a presença de um monômero truncado pode impedir ligação ao DNA, mesmo em presença de monômeros completos. Por exemplo, se a hélice de dimerização da proteína for feita sem o domínio de ligação ao DNA, a dimerização com um monômero completo produz um produto incapaz de se ligar eficientemente ao DNA. Modificado de Alberts, B., Bray, D., Lewis, J., Raff, M., Roberts, K. e Watson, J. Molecular Biology of the Cell. New York: Garland, 1994.

DNA

BioQ.08 308

22.01.07 16:53:21

CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO

|

315

PARTE 3 FUNÇÕES DE PROTEÍNAS Fab 1

Fab 2

Sítio de ligação do anticorpo (Ag)

Sítio de ligação do anticorpo (Ag) SS

Tuftsina

C1q CHO

Prot–A

Prot–A

Fc

9

PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO EM FAMÍLIAS DE PROTEÍNAS Richard M. Schultz 9.1 VISÃO GERAL, 316 9.2 MOLÉCULAS DE ANTICORPOS: SUPERFAMÍLIA DE PROTEÍNAS IMUNOGLOBULINAS, 316 Moléculas de anticorpos contêm quatro cadeias polipeptídicas, 317 Regiões de seqüências constantes e variáveis da estrutura primária, 318 Imunoglobulinas de uma classe contêm regiões de seqüências homólogas comuns, 318 Seqüências repetitivas geram dobras homólogas tridimensionais em um anticorpo, 318 Há dois sítios de ligação de antígeno por molécula de anticorpo, 322 Genética das imunoglobulinas, 323 Dobra de imunoglobulina é encontrada em uma grande família de proteínas com diferentes papéis funcionais, 323 9.3 PROTEÍNAS COM UM MECANISMO CATALÍTICO COMUM: SERINO PROTEASES, 324 Enzimas proteolíticas são classificadas por seu mecanismo catalítico, 324 Serino proteases apresentam notável especificidade em hidrólise de ligações peptídicas, 325 Serino proteases são sintetizadas como zimogênios, 329 Inibidores protéicos específicos para serino proteases, 330 Serino proteases têm relações estrutura-função semelhantes, 330 Homologia de seqüência em serino proteases, 331

BioQ.09 315

Estruturas terciárias da família serino proteases são semelhantes, 332 9.4 HEMOGLOBINA E MIOGLOBINA, 334 Hemoglobina humana ocorre em várias formas, 334 Mioglobina: uma cadeia polipeptídica única com um sítio de ligação para O2, 334 Grupo prostético heme é sítio de ligação de O2, 334 Cristalografia de raios-X definiu a estrutura de hemoglobina e mioglobina, 336 Estruturas primária, secundária e terciária de mioglobina e cadeias de hemoglobina, 336 Um equilíbrio simples define ligação de O2 à mioglobina, 337 Ligação de O2 à hemoglobina envolve cooperatividade entre subunidades, 339 Mecanismo molecular de cooperatividade na ligação de O2, 340 Hemoglobina facilita transporte de CO2 e NO, 342 Diminuição em pKa de grupos ácidos com mudança de conformação T para R leva à dissociação de prótons, 343 Transporte de CO2 e O2 é ligado por prótons de efeito Bohr, 344 2,3-Bisfosfoglicerato (BPG) em eritrócitos modula liberação de oxigênio de hemoglobina, 345 Hemoglobina entrega óxido nítrico (NO) para a parede capilar de tecidos onde promove liberação de O2, 345

22.01.07 16:59:32

324

|

PARTE 3 FUNÇÕES DE PROTEÍNAS FIGURA 9.9 Seqüência de aminoácidos das regiões constantes de cadeias pesadas de genes de cadeia pesada de IgG 1, 2 e 4. Seqüências de CH1, região de articulação H (hinge), regiões CH2 e CH3 são apresentadas. Seqüência de γ1 está completa, e diferenças em γ2 e γ4 em comparação com seqüência γ1 são mostradas usando abreviações de uma letra dos aminoácidos. Linha tracejada (—) indica ausência de aminoácido na posição correspondente em γ1, com a finalidade de melhor alinhar as seqüências para mostrar a homologia máxima. Seqüência de cadeia γ1 de Ellison, J. W., Berson, B. J. e Hood, L. E. Nucleic Acid Res. 10:4071, 1982. Seqüências dos genes γ2 e γ4 de Ellison, J. e Hood, L. Proc. Natl. Acad. Sci. USA 79:1984, 1984.

|

9.3 PROTEÍNAS COM UM MECANISMO CATALÍTICO COMUM: SERINO PROTEASES Serino proteases são uma família de enzimas que usam um resíduo de serina ativado de modo singular no sítio de ligação ao substrato, para hidrolisar cataliticamente ligações peptídicas. Essa serina pode ser caracterizada pela reação irreversível de seu grupo hidroxila de cadeia lateral com diisopropilfluorofosfato (DFP) (Figura 9.11). De todas as serinas da proteína, DFP reage só com a serina cataliticamente ativa, formando um éster de fosfato.

BioQ.09 324

Enzimas Proteolíticas São Classificadas por seu Mecanismo Catalítico Enzimas proteolíticas são classificadas de acordo com seu mecanismo catalítico. Além das serino proteases, outras classes utilizam cisteína (cisteíno proteases), aspartato (aspartato proteases) ou íons metálicos (metalo proteases) para realizar sua função catalítica. As que hidrolisam ligações peptídicas no interior de um polipeptídeo são endopeptidases, e aquelas que quebram a ligação peptídica de aminoácidos COOH- ou NH2-terminais são exopeptidases. Serino proteases freqüentemente ativam outras serino proteases a partir de sua forma precursora inativa, denominada um zimogênio, por clivagem de uma ligação peptídica específica. Esse mecanismo de ativação

22.01.07 16:59:43

CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO

|

335

CORRELAÇÃO CLÍNICA 9.6

Hemoglobinopatias Há mais de 800 hemoglobinas humanas mutantes diferentes. Mutações causam instabilidade na estrutura da hemoglobina, afinidade aumentada ou diminuída por oxigênio, ou um aumento na taxa de oxidação do ferro ferroso do heme (Fe2+) para o estado férrico (Fe3+). Uma hemoglobina férrica, nãofuncional, é chamada meta-hemoglobina e é simbolizada por HbM. Hemoglobinas instáveis surgem por substituição de prolina por um aminoácido em uma região de αhélice da dobra de globina. Prolinas não participam da estrutura em α-hélice e a quebra de um segmento de α-hélice gera uma hemoglobina instável (exemplos são HbSakiβ14Leu→Pro e HbGenova β28Leu→Pro). Outras hemoglobinas instáveis surgem por substituição por um aminoácido que é muito grande ou muito pequeno para estabelecer contatos corretos, ou por colocação de um grupo carregado ou polar no lado de dentro de um domínio. Hemoglobinas instáveis desnaturam facilmente e precipitam, formando corpos de Heinz, que danificam a membrana do eritrócito. Pacientes com hemoglobinas instáveis podem desenvolver anemia, reticulocitose, esplenomegalia e urobilinúria. Algumas hemoglobinas mutantes têm afinidade aumentada por oxigênio (P50 mais baixa). Um exemplo interessante é HbCowtown β246His→Leu, na qual a histidina, que dissocia 50% dos prótons do efeito Bohr, é perdida. Essa mutação impede a regulação da dissociação de oxigênio por concentração de íons hidrogênio e desestabiliza a conformação T, em relação à conformação R, causando um aumento na afinidade por oxigênio e liberação diminuída de O2 para os tecidos. Mutações em hemoglobina que interferem com ligação de DPG também aumentam afinidade por oxigênio. Hemoglobinopatias com

afinidade aumentada por oxigênio são freqüentemente caracterizadas por anemia hemolítica e formação de corpos de Heinz. Hemoglobinas mutantes que formam metahemoglobina incluem HbM Iwateα87His→Tyr e HbM HydeParkβ92His→Tyr, onde as histidinas proximais F8 das cadeias α e β, respectivamente, estão mutadas. Na HbM Bostonα58His→Tyr e na HbMSaskatoonβ63His→Tyr, as histidinas distais E7 estão mutadas. Mutações de aminoácidos que ficam junto do heme ou formam o sítio de ligação com oxigênio freqüentemente levam a meta-hemoglobina. Pacientes com altas concentrações de meta-hemoglobina apresentam cianose (cor azulada na pele). Duas das mutações mais prevalentes ocorrem no aminoácido da mesma posição, o β6Glu. Quando esse glutamato é substituído por valina, o resultado é HbS β6Glu→Val; enquanto substituição por lisina gera HbCβ6Glu→Lys. Homozigotos com HbS expressam anemia falciforme, na qual as moléculas de hemoglobina precipitam como tactóides ou longas cadeias, o que produz a forma de foice dos eritrócitos (ver Corr. Clín. 3.3). HbC forma uma estrutura diferente de agregado consistindo de cristalóides de extremidades cegas. Isso reduz o tempo de vida dos eritrócitos, mas causa menos hemólise que HbS. Esta forma de hemoglobinopatia apresenta efeitos patológicos mais limitados. Como ambas HbS e HbC são comumente encontradas em certas populações negras da África, não é raro encontrar indivíduos heterozigotos para ambos os genes mutantes nessas populações. Indivíduos com HbSC terão uma anemia intermediária entre as observadas para homozigotos de HbS e HbC.

Fonte: Dickerson, R. E. e Geis, I. Hemoglobin: Structure, Function, Evolution, and Pathology. Menlo Park, CA: Benjamin-Cummings, 1983. Arcasoy, M. O. e Gallagher, P. G. Molecular diagnosis of hemoglobinopathies and other red blood cell disorders. Semin. Hematol. 36:328, 1999.

Quatro ligações são com os átomos de nitrogênio pirrólico da porfirina. Como os anéis pirrólicos e os carbonos de ligação fazem parte do mesmo sistema aromático, esses átomos ficam em um plano comum. O ferro ligado à porfirina tenderá a ficar no mesmo plano da porfirina. A quinta e a potencial sexta ligações com ferro são direcionadas ao longo de um eixo perpendicular ao plano do anel porfirínico (Figura 9.20). A quinta ligação é com um nitrogênio do imidazol de uma histidina. Esta

BioQ.09 335

é designada como histidina proximal nas estruturas de hemoglobina e mioglobina (Figuras 9.20 e 9.21). O2 forma a sexta ligação; o O2 é colocado entre o átomo ferroso e um segundo imidazol de histidina, designada como histidina distal. Na desoxi-hemoglobina, a sexta posição está desocupada. O heme é posicionado dentro de um bolsão hidrofóbico de cada subunidade globina, com aproximadamente 80 interações fornecidas por cerca de 18 resíduos,

22.01.07 16:59:57

CAPÍTULO 9 PROTEÍNAS II: RELAÇÕES ESTRUTURA-FUNÇÃO VEIA HS SH

1

ARTÉRIA

O2

2 O HS SH O 2 2 CO2

    CO2

    O2 R

T

ONS SH O 6 O2 2  

ON HS SH

5

    O2

O2

 

X-SNO

O2 R

T

O2

X-SNO 8 ON HS SH  

CO2

7

 

  CO2

  4 O2

T

4

HS SH

T

HS SH

3

O2 HS SH O2

 

NO

 

  NO T 3 O2 CAPILAR

  NO R

O2

1 O2 ARTERÍOLA

FIGURA 9.37 Ligação e liberação de NO por hemoglobina durante o ciclo respiratório. O modelo mostra a ligação e a dissociação de NO, O2 e CO2 enquanto uma molécula de hemoglobina faz dois ciclos completos na circulação. O primeiro ciclo envolve intermediários 1-4, e o segundo ciclo, intermediários 5-8. As conformações T e R são mostradas e os grupos SH são da cadeia lateral de βCys93. O NO é ligado diretamente a um ferro-heme ou ao SH da βCys93. As etapas-chaves no transporte de NO são (i) sua ligação inicial a um heme no intermediário 3 e transferência do heme de uma subunidade β para βCys93 no intermediário 6 (conformação R) e (ii) sua transferência para uma molécula tiol pequena X-SH no intermediário 7 (conformação T), quando hemoglobina é convertida de R para T. A molécula de hemoglobina representada pode ser apenas 1 em 1.000 moléculas de hemoglobina circulantes, devido à relativamente baixa concentração molar de NO no sangue. Redesenhado de Gross, S. S. e Lane, P. Proc. Natl. Acad. Sci. USA 96:9967, 1999.

|

9.5 O COMPLEXO PROTÉICO DA LÂMINA BASAL Uma lâmina basal é um complexo muito estruturado de proteínas de matriz extracelular observado inicialmente ao microscópio como uma região amorfa densamente empacotada de cerca de 50 a 100 nm de espessura circundando tecidos ou células (Figura 9.39). O termo membrana basal é usado para descrever a lâmina basal e os colágenos fibrilares ligados ao seu lado externo. A membrana basal dá suporte a tecidos e regula acesso de células ao estroma intersticial. Também participa da determinação de propriedades de células que estão ligadas a ela, incluindo os críticos processos

BioQ.09 347

|

347

de divisão celular, morte (apoptose), diferenciação e migração. Todas as células produzem constituintes de membrana basal, e cada membrana basal tem características do tipo celular, a partir do qual é sintetizada. Uma membrana basal sublinha camadas de células epiteliais e endoteliais, e circunda outros tipos de células (Figura 9.39). Uma membrana basal separa duas camadas de células no glomérulo renal, onde funciona como um filtro seletivo. Uma lâmina basal é formada por associações nãocovalentes entre sítios específicos localizados em domínios de ligação das proteínas associadas. Muitas proteínas de membrana basal também se ligam a células por meio de domínios de ligação a células nas proteínas e receptores celulares na membrana celular externa. A estrutura de muitas das proteínas é composta de unidades modulares com homologia de seqüência e de dobras com superdobras comuns, como as dobras de imunoglobulinas (Ig) e de fator de crescimento epidérmico (EGF). Essas dobras são encontradas repetitivamente e são os blocos construtores de proteínas de matriz extracelular. Enquanto módulos EGF nessas proteínas não parecem ter função de fator de crescimento, proteínas fatores de crescimento e citocinas são encontradas na lâmina basal, particularmente em associação com as partes carboidrato dos proteoglicanos componentes. Durante a reciclagem (turnover) da membrana basal induzida por proteases e heparanases, esses fatores de crescimento e citosinas são liberados para agirem sobre células vizinhas. Além disso, muitas proteínas de lâmina basal escondem atividades crípticas que são ativadas quando clivadas e removidas da seqüência completa por ação de proteases (ver endostatina, p. 1021). O próprotease plasminogênio está ubiquamente presente na matriz extracelular e é ativado por secreção celular de ativadores de plasminogênio (ver p. 979).

Composição Protéica da Lâmina Basal A lâmina basal é composta de colágeno tipo IV, laminina, nidogem (também chamado entactina) e perlecam, o proteoglicano de heparam sulfato. Além disso, pequenas quantidades de talvez 50 outras proteínas podem estar presentes, incluindo osteopontina (também chamada BM-40 ou SPARC), fibulina, colágeno tipo XV, colágeno tipo XVIII e o proteoglicano agrim. A diversidade e a tecido-especificidade de uma membrana basal é determinada pelas isoformas de colágeno tipo IV e laminina e os tipos de proteínas minoritárias presentes. Isoformas de colágeno tipo IV são produzidas por sete genes diferentes de colágeno tipo IV. Essas isoformas compartilham homologia de estrutura de domínios, mas diferem em 30-50% de suas seqüências de aminoácidos. Há pelo menos 12 isoformas de laminina. As isoformas de colágeno tipo IV e laminina expressas são características do tipo celular e do tecido que sintetiza a membrana basal associada.

22.01.07 17:00:54

358

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

PARTE 3 FUNÇÕES DE PROTEÍNAS

10

ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E CONTROLE Henry Weiner 10.1 VISÃO GERAL, 359 10.2 CLASSIFICAÇÃO DE ENZIMAS, 360 Classe 1: Óxido-redutases, 361 Classe 2: Transferases, 361 Classe 3: Hidrolases, 361 Classe 4: Liases, 362 Classe 5: Isomerases, 362 Classe 6: Ligases, 363 10.3 CONCEITOS GERAIS DE MECANISMOS ENZIMÁTICOS, 363 Considerações termodinâmicas, 363 Ligação de substrato por uma enzima, 364 Estado de transição, 364 Ligação forte no estado de transição, 365 Reações iônicas não precisam envolver íons, 365 Ligações parcialmente carregadas, 366 Importância do grupo carbonila, 366 Oxidações, 367 Adição e remoção de prótons, 367 Ligação covalente de substrato à enzima, 367 pH afeta a reação por afetar ácidos e bases gerais, 368 10.4 SÍTIO ATIVO DE UMA ENZIMA, 368 Estereoquímica ajuda a explicar o mecanismo de reações catalisadas por enzimas, 370 Influência de grupos sobre o substrato distal à ligação a ser modificada, 370 10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES, 371 Coenzimas, 371 NAD e NADP são formas coenzimas da niacina, 372

BioQ.10 358

FMN e FAD são formas coenzimas da riboflavina, 373 Piridoxal fosfato é a forma coenzima de piridoxal, 373 Adenosina trifosfato pode ser um segundo substrato ou um modulador de atividade, 374 Cofatores íons metálicos, 374 Papel de metais em oxidação e redução, 376 10.6 CINÉTICA DE REAÇÕES QUÍMICAS, 376 Velocidade de formação de produto, 376 Reações de primeira e segunda ordem, 377 Velocidade de desaparecimento de substrato, 377 Reações reversíveis, 378 Reações complexas, 378 10.7 CINÉTICA ENZIMÁTICA DE REAÇÕES DE UM SUBSTRATO, 379 Equação de Michaelis-Menten, 380 Concentração de enzima livre, 382 Significado de Km, 382 Número de turnover (kcat), 382 Significado de kcat na equação de Michaelis-Menten, 383 Quando concentração de substrato é muito maior que Km, 383 Quando concentração de substrato é muito menor que Km, 383 Reações reversíveis, 384 Baixo Km versus alto kcat, 384 Calculando as constantes, 384 Substrato e produto ligam-se ao mesmo sítio, 385 Efeito das condições de ensaio, 385 Temperatura, 385 pH, 385

22.01.07 17:10:09

CAPÍTULO 10 ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E CONTROLE

|

371

CORRELAÇÃO CLÍNICA 10.1

Mutação de um Sítio de Ligação de Coenzima Resulta em Doença Clínica Cistationinúria é uma doença genética na qual γ-cistationase está deficiente ou inativa. A cistationase catalisa a reação: Cistationina → cisteína + α-cetobutirato Deficiência da enzima leva ao acúmulo da cistationina no plasma. Como cistationase é uma enzima dependente de piridoxal fosfato, vitamina B6 foi administrada a pacientes cujos fibroblastos continham material que apresentavam reação cruzada com anticorpos contra cistationase. Muitos responderam à terapia com B6 com uma queda nos níveis plasmá-

ticos de cistationina. Esses pacientes produzem a apoenzima, que reagiu com o anticorpo. Em um paciente, a atividade enzimática era não-detectável em homogenatos de fibroblastos, mas aumentou para 31% do normal com a adição de piridoxal fosfato 1 mM à mistura de reação. Acredita-se que o Km para a ligação do piridoxal fosfato à enzima tenha aumentado, devido a uma mutação no sítio de ligação. Atividade é parcialmente restaurada aumentando-se a concentração de coenzima. Aparentemente, esses pacientes requerem uma concentração de estado estacionário mais alta de coenzima para manter a atividade de γ-cistationase.

Fonte: Pascal, T. A., Gaull, G. E., Beratis, N. G., Gillam, B. M., Tallan, H. H. e Hirschhorn, K. Vitamin B6 -responsive and unresponsive cystathionuria: two variant molecular forms. Science 190: 1209, 1975.

|

Coenzimas

10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES Muitas enzimas requerem a participação de uma coenzima, um co-substrato ou cofator na reação catalítica. Coenzimas são moléculas orgânicas pequenas, freqüentemente derivados de vitaminas (ver p. 1074). Podem ser ou não modificadas (p. ex., oxidadas ou reduzidas) na reação. As que são alteradas são também chamadas cosubstratos. Para algumas reações, a energia de hidrólise de ATP é necessária sem incorporação de sulfato ao produto. ATP nessas reações é um co-substrato. Íons metálicos são freqüentemente necessários para reações enzimáticas e chamados cofatores.

Tabela 10.2 lista as coenzimas e vitaminas a partir das quais são derivadas. Coenzimas participam de enzimas catalisadas por enzimas, mas não são os compostos primários que estão sendo modificados. Algumas coenzimas participam da ação de muitas enzimas diferentes, enquanto outros participam apenas de um número limitado de reações. Podem ter afinidades pela enzima semelhantes ao substrato, podem ser fortemente ligadas ou podem ser covalentemente ligadas. Algumas são modificadas durante uma reação, mas estão no seu estado original no final da reação (modificação cíclica), enquanto outras permanecem modificadas no fim. Se estiverem modificadas no fim (p. ex., oxidadas ou reduzidas), devem participar de outra reação para retornar ao seu estado original. Coenzimas estão presentes em células em uma concentração razoavelmente constante,

TABELA 10.2 Coenzimas Coenzima

Vitamina

Reação Mediada

Biotina

Biotina

Carboxilação

Cobalamina (B12)

Cobalamina (B12)

Alquilação

Coenzima A

Pantotenato

Transferência de acil

Coenzimas flavina

Riboflavina (B2)

Oxidação-redução

Ácido lipóico

BioQ.10 371

Transferência de acil

Coenzimas nicotinamida

Nicotinamida

Oxidação-redução

Piridoxal fosfato

Piridoxina (B6 )

Transferência de amino

Tetra-hidrofolato

Ácido fólico

Transferência de grupo de um carbono

Tiamina pirofosfato

Tiamina (B1)

Transferência de carbonila

22.01.07 17:10:28

CAPÍTULO 10 ENZIMAS: CLASSIFICAÇÃO, CINÉTICA E CONTROLE

383

|

CORRELAÇÃO CLÍNICA 10.3

Efeito Fisiológico de Mudanças nos Valores de Km de Enzimas A sensibilidade incomum de asiáticos a bebidas alcoólicas tem uma base bioquímica. Em alguns japoneses e chineses, muito menos álcool é necessário para produzir vasodilatação, que resulta em rubor facial e aceleração dos batimentos cardíacos, do que o necessário para causar o mesmo efeito em europeus. Os efeitos fisiológicos devem-se ao acetaldeído gerado pela álcool desidrogenase hepática. Acetaldeído é normalmente removido por aldeído desidrogenase (ALDH), que converte acetaldeído em acetato. Um aminoácido na posição 487 na subunidade de 500 aminoácidos da enzima tetramérica está trocado em alguns dos indivíduos afetados. A enzima ativa tem um glutamato, enquanto a variante inativa tem uma lisina. Descobriu-se que a variante asiática tem atividade muito baixa, e o Km para NAD+ aumentado de 30 μM para 7.000 μM. Embora a enzima esteja ativa, teria muito pouca atividade no fígado porque o Km é muito alto e kcat, muito baixa. Além disso, indivíduos afetados eram heterozigotos, tendo genes para a enzima glutamato ativa e a enzima lisina essencialmente inativa. Esperar-se-ia

que sua enzima fosse 50% ativa, mas apresentava atividade muito baixa. ALDH forma tetrâmeros com os dois monômeros (E4, E3K, E2K2, EK3 e K4), onde E4 e K4 são formas homotetraméricas das subunidades contendo glutamato e lisina, respectivamente, e as outras são heterotetrâmeros. E3K tinha 50% da atividade total, não 75%, enquanto EK3 praticamente não tinha atividade, não os 25% que se poderia esperar com uma subunidade ativa. A subunidade K era dominante e podia inativar a subunidade, à qual estava pareada, uma vez que o resíduo da posição 487 interage com uma arginina da posição 475. Quando um glutamato estava na posição 487, uma ligação salina estável se formava, mas quando uma lisina estava na posição 487, causava um movimento da arginina. O movimento rompia o bolsão de ligação a NAD, embora o resíduo 487 não estivesse em contato com a dobra de Rossmann. Este exemplo ilustra o fato de uma mutação puntual em uma enzima poder afetar o sítio ativo, embora o resíduo não esteja em contato direto com essa região. Também mostra como uma subunidade pode ser dominante sobre outra.

Fonte: Zhou J. e Weiner, H. Basis for half-of-the-site reactivity and the dominance of the K487 oriental subunit over the E487 subunit in heterotetrameric human liver mitochondrial aldehyde dehydrogenase. Biochemistry 39:12019, 2000. geral, este termo representa a(s) etapa(s) mais lenta(s) da reação. Como Km, kcat é composta de várias constantes de velocidade individuais.

Significado de kcat na Equação de Michaelis-Menten Quando Concentração de Substrato É Muito Maior do que Km Equação 10.19 está na forma de uma equação hiperbólica geral. Quando o valor de [S] é muito maior que o valor de Km, o valor do denominador aproxima-se do valor de [S], e a equação pode ser aproximada por v=

kcat [E][S] [S]

Quando Concentração de Substrato É Muito Menor do que Km Quando [S] é muito baixa comparada com Km, Eq. 10.18 pode ser aproximada como v=

= kcat [E]

(10.26)

isto é, a velocidade torna-se independente da concentração de S; a reação torna-se de ordem zero com relação a S. Isso é encontrado na parte da curva onde a velocidade essencialmente se nivela, e não aumenta quando a concentração de [S] aumenta (inclinação = 0) (Figura 10.47). A reação está acontecendo à sua velocidade má-

BioQ.10 383

xima nessas condições porque praticamente 100% da enzima está no complexo ES. No instante em que uma molécula de produto é feita, ela deixa a enzima e outra molécula de S liga-se à enzima, mantendo sempre a enzima saturada com S. Nessas condições, a velocidade é governada estritamente pelos termos que governam a reação de ES indo para produto (ES → E + P).

kcat [Et ][S] km

ou v =

Vmax [S] Km

(10.27)

Um gráfico de v versus [S] seria linear, uma condição que existe só quando [S] << valor de Km. Como para qualquer reação química a velocidade de formação de produto é uma constante de velocidade multiplicada pela concentração de reagentes, o termo kcat /Km pode ser considerado como uma constante de velocidade de segunda ordem, uma vez que há dois termos de concen-

22.01.07 17:10:54

394

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

|

10.10 REGULAÇÃO DE ATIVIDADE ENZIMÁTICA Modificação Covalente Células têm capacidade de regular a atividade de enzimas-chaves por modificação covalente ou ligação reversível de ligantes. Muitos exemplos de modificação covalente, como fosforilação, serão descritos em outros capítulos. Há muitas proteínas quinases que catalisam fosforilação de resíduos de serina, treonina ou treonina em proteínas e enzimas específicas (ver p. 490) e proteína fosforilases que removem o fosfato por hidrólise. Dependendo da proteína, fosforilação pode aumentar ou diminuir a atividade enzimática. Outros grupos além do fosfato podem ser adicionados a uma enzima para alterar sua atividade, incluindo sulfato e acetato. Modificação covalente de proteínas é um modo rápido e eficiente de controlar atividade de uma proteína ou enzima.

Controle Alostérico de Atividade Enzimática Embora os sítios de ligação de substrato e ativo de uma enzima sejam estruturas bem definidas, a atividade de muitas enzimas pode ser modulada por ligantes agindo

de modos diferentes de inibidores competitivos ou nãocompetitivos. Ligantes podem ser ativadores, até mesmo os substratos de enzimas. Os ligantes que mudam a atividade enzimática, mas não são modificados em conseqüência da ação enzimática, são chamados efetores, modificadores ou moduladores. A maioria das enzimas sujeitas à modulação por ligantes são enzimas determinantes de velocidade de vias metabólicas. Enzimas que respondem a moduladores têm sítios adicionais conhecidos como sítio(s) alostérico(s). Alostérico é derivado da raiz grega allo, significando “o outro”. Um sítio alostérico é uma região específica da enzima, bem diferente do sítio de ligação do substrato. A existência de sítios alostéricos é ilustrada na Corr. Clín. 10.10. Os ligantes que se ligam a sítios alostéricos são chamados efetores alostéricos ou moduladores. Ligação de um efetor alostérico causa uma mudança conformacional na enzima, de modo que a afinidade pelo substrato ou outros ligantes também muda. Efetores alostéricos positivos (+) aumentam a afinidade da enzima por substrato ou outro ligante. O inverso é verdade para efetores alostéricos negativos (–). O sítio alostérico no qual o efetor positivo se liga é chamado um sítio ativador; o efetor negativo liga-se a um sítio inibitório. Enzimas alostéricas são divididas em duas classes, com base no efeito do efetor alostérico sobre Km e Vmax. Na classe K, o efetor altera o Km, mas não Vmax, enquanto na classe V, o efetor altera Vmax, mas não Km. Enzimas da classe K dão gráficos duplos-recíprocos como os de inibidores competitivos, e enzimas da classe

CORRELAÇÃO CLÍNICA 10.10

Um Caso de Gota Demonstra a Diferença entre um Sítio Alostérico e um Sítio de Ligação de Substrato A descoberta de que sítios alostéricos inibitórios são separados de sítios alostéricos ativadores, bem como dos sítios de ligação de substrato e catalítico, é ilustrada por um estudo de um paciente com gota, cujo nível de PRPP nos eritrócitos estava aumentando. Descobriu-se que a PRPP sintetase do paciente tinha valores normais de Km, Vmax, juntamente com sensibilidade à ativação por fosfato. Os níveis aumentados de PRPP e hiperuricemia surgiram porque os produtos finais da via (ATP, GTP) não eram capazes de inibir a sintetase no sítio alostérico inibitório (I). Sugeriu-se que uma mutação no sítio inibitório ou no mecanismo de acoplamento entre o sítio inibitório e catalítico levou ao defeito do mecanismo de controle por feedback.

A

PRPP sintetase

I

C

+

PRPP

Pi ATP Ribose

AMP GMP

ATP GTP

Fonte: Sperling, O., Persky-Brosh, S., Boen, P. e DeVries, A. Human erytrocyte phosphoribosyl-pyrophosphate synthetase mutationally altered in regulatory properties. Biochem. Med. 7: 389, 1973

BioQ.10 394

22.01.07 17:11:17

CAPÍTULO 11 CITOCROMOS P450 E ÓXIDO NÍTRICO SINTASES

|

407

PARTE 3 FUNÇÕES DE PROTEÍNAS Adenina Ribose

Citocromo P450 Redutase

Fosfato Fosfato

NADPH

2e-

O

N N

O

Ribitol N N [FAD]

CH3 1e- Fosfato CH3 Ribitol N N H3C O N H3C N

[FMN]

O

?

1eC

Citocromo �5 C N• C N Fe N C N C

N

C

N • • •• N C

N

C

Citocromo P450

11

CITOCROMOS P450 E ÓXIDO NÍTRICO SINTASES Linda J. Roman e Bettie Sue Siler Masters 11.1 VISÃO GERAL, 408 11.2 CITOCROMOS P450: PROPRIEDADES E FUNÇÃO, 408 11.3 CICLO DE REAÇÃO DO CITOCROMO P450, 409 11.4 SISTEMAS DE TRANSPORTE DE ELÉTRONS DOS CITOCROMOS P450, 410 NADPH-citocromo p450 redutase é a flavoproteína doadora de elétrons no retículo endoplasmático, 410 NADPH-adrenodoxina redutase é a flavoproteína doadora de elétrons em mitocôndrias, 411 11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS, 412 11.6 CITOCROMOS P450: SUBSTRATOS E FUNÇÕES FISIOLÓGICAS, 413 11.7 CITOCROMOS P450 PARTICIPAM DE SÍNTESE DE HORMÔNIOS ESTERÓIDES E DE OXIGENAÇÃO DE COMPOSTOS ENDÓGENOS, 414 Citocromos P450 oxidam substratos lipofílicos exógenos, 417 11.8 INDUÇÃO E INIBIÇÃO DE CITOCROMO P450, 423 Interações droga-droga, 423 Polimorfismos genéticos de citocromo P450, 425 Inibição terapêutica de citocromo P450, 425

BioQ.11 407

11.9 AS ÓXIDO NÍTRICO SINTASES: PROPRIEDADES E FUNÇÃO, 425 11.10 ISOFORMAS DE ÓXIDO NÍTRICO SINTASES E FUNÇÕES FISIOLÓGICAS, 428 NOSI, 428 NOSII, 429 NOSIII, 430 BIBLIOGRAFIA, 432 QUESTÕES E RESPOSTAS, 434 CORRELAÇÕES CLÍNICAS 11.1 Hiperplasia Adrenal Congênita: Deficiência de CYP21A2, 416 11.2 Produção de Hormônios Esteróides Durante a Gestação, 418 11.3 Inibição de Citocromo P450: Interações Droga-Droga e Efeitos Adversos, 420 11.4 Papel de CYP2E1 em Toxicidade Hepática Induzida por Acetaminofen, 422 11.5 Indução de Citocromo P450: Interações Droga-Droga e Efeitos Adversos, 423 11.6 Polimorfismos Genéticos de Enzimas P450, 426 11.7 Mecanismo de Ação de Sildenafil, 430 11.8 Aspectos Clínicos da Produção de Óxido Nítrico, 431 11.9 História da Nitroglicerina, 432

22.01.07 17:15:52

412

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

|

11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS Devido ao grande número de citocromos P450 que foram identificados (mais de 4.500 em janeiro de 2005), um sistema de classificação das enzimas em grupos funcionais e nomenclatura foi desenvolvido. O sistema escolhido é baseado em classificação de acordo com a identidade relativa das seqüências de aminoácidos das enzimas. A superfamília dos citocromos P450 é assim dividida inicialmente em famílias, nas quais a identidade da seqüência de aminoácidos dos membros é superior a 40%. A família é designada pelo prefixo “CYP”, em referência a cytochrome P450, seguida por um numeral arábico (p. ex., CYP1, CYP2, CYP3, etc). As famílias são ainda divididas em subfamílias, nas quais a identidade

de seqüência de aminoácidos dos membros é superior a 55%. A subfamília é identificada por uma letra maiúscula arábica (p. ex., CYP1A, CYP1B, CYP1C, etc.). Os membros individuais de cada subfamília são então numerados na ordem em que foram identificados (p. ex., CYP1A1, CYP1A2, CYP1A3, etc.). Embora citocromos P450 sejam enzimas, os termos “isoenzima” ou “isozima” não são usados para descrever essas proteínas; em ver disso, o termo “forma”ou “isoforma” é usado. Tabelas 11.1 e 11.2 relacionam as isoformas conhecidas de citocromos P450 humanos. Há 57 isoformas divididas em 18 famílias e 41 subfamílias. O genoma humano codifica 58 pseudogenes CYP que não formam proteína ativa. Tabela 11.1 lista as isoformas que utilizam primariamente compostos exógenos (p. ex., drogas e xenobióticos); cada isoforma metaboliza uma ampla variedade de substratos. Tabela 11.2 lista as isoformas envolvidas em metabolismo de compostos endógenos; essas isoformas geralmente reconhecem apenas um ou dois substratos específicos, e estes são apresentados na tabela.

TABELA 11.1 Citocromos P450 Humanos Envolvidos em Metabolismo Exógeno Família CYP 1

2

3

a

BioQ.11 412

Substrato(s) Selecionado(s)

Isoformas

Inibidor(es) Selecionado(s)

Indutor(es) Selecionado(s)

1A1

Benzo(a)pireno, diclofenac

Cetoconazol

Benzo(a)pireno

1A2

Benzo(a)pireno, warfarina

Ciprofloxin

Erva de São João

1B1

Benzo(a)pireno, aflatoxina B1

Tamoxifen

NCa

2A6

Acetaminofen, nicotina

Canabidol

Dexametasona

2A7

NC

NC

NC

2A13

Hexametilfosforamida

NC

NC

2B6

Diazepam, mefenitoína

Cetoconazol

Rifampicina

2C8

Taxol, ibuprofen, verapamil

Quinina

Fenobarbital

2C9

Amitriptilina, naproxen

Sulfafenazol

Rifampicina

2C18

Imipramina, metadona

NC

Rifampicina

2C19

Diazepan, omeprazol

Isoniazida

Rifampicina

2D6

Fluvastatina, codeína, risperidona

Quinidona

Dimetilsulfóxido

2E1

Acetaminofen, halotano

Watercress

Isoniazida, etanol

2F1

Naftaleno, estireno

NC

NC

2J2

Bufuralol

NC

NC

2R1, 2S1

NC

NC

NC

2U1, 2W1

NC

NC

NC

3A4

Eritromicina, nifedipina, codeína, warfarina, terfenadina

Troleandomicina, cetoconazol

Cortisol, rifampina, fenobarbital

3A5

Verapamil, prevastatina

NC

Dexametazona

3A7

Ácido retinóico, codeína, cortisol

DHEA

NC

3A43

Testosterona

NC

NC

NC, não bem caracterizado.

22.01.07 17:16:01

420

|

PARTE 3 FUNÇÕES DE PROTEÍNAS Metabolismo de Terfenadina OH HO

N

Terfenadina (Seldane)

CYP3A4

OH HO

N

Fexofenadina (Allegra)

CO2H

FIGURA 11.12 O metabolismo de terfenadina em fexofenadina, o composto bioativo.

Acetaminofen, comumente usado como analgésico e antipirético, é convertido por CYP2E1 em N-acetil-pbenzoquinoneimina (NAPQ1), um composto muito reativo levando a aductos protéicos, estresse oxidativo e toxicidade. Normalmente, acetaminofen é primariamente metabolizado por vias de glucuronidação e sulfatação em conjugados polares, inativos, que são facilmente excretados (Figura 11.14, vias superior e inferior, respectivamente). Acetaminofen é também metabolizado por CYP2E1 em NAPQ1 muito reativo (Figura 11.14, via do meio). A quantidade de acetaminofen que é metabolizada por CYP2E1 é normalmente baixa, em comparação com glucuronidação e sulfatação. As pequenas quantidades de NAPQ1 formadas são rapidamente conjugadas por glutationa (ver p. 764) em um metabólito não-tóxico.

CORRELAÇÃO CLÍNICA 11.3

Inibição de Citocromo P450: Interações Droga-Droga e Efeitos Adversos Os papéis que citocromos P450 desempenham no metabolismo de drogas e as sérias conseqüências das interações droga-droga foram demonstrados com clareza para duas drogas, terfenadina (Seldane) e cisapride (Propulside), quando seu metabolismo foi inibido por outras drogas. Uma pequena porcentagem dos usuários teve efeitos adversos graves, que forçaram seus fabricantes e o Food and Drug Administration (FDA) a divulgar avisos de que essas drogas não podem ser tomadas juntamente com outras drogas que inibem CYP3A4. A gravidade dos efeitos adversos forçou o FDA a remover ambas as drogas do mercado. O FDA aprovou terfenadina, um anti-histamínico de segunda geração, em 1985, para tratar alergias sazonais. Terfenadina é rapidamente metabolizada no fígado por CYP3A4 em fexofenadina, como mostra a Figura 11.12, resultando em baixos níveis da droga original logo depois da ingestão, mas os efeitos terapêuticos do terfenadina são realmente causados por fexofenadina. Como muitas outras drogas são substratos ou inibidores de CYP3A4, o metabolismo de terfenadina é potencialmente passível de inibição. Indivíduos que tomaram terfenadina com o antibiótico macrolídeo eritromicina, ou com o agente antifúngico cetoconazol, ambos fortes inibidores de CYP3A4, apresentaram níveis plasmáticos significativamente elevados de terfenadina. Numa pequena porcentagem de usuários de terfenadina, problemas

cardíacos sérios surgiram, porque a droga parental causou alteração nos canais cardíacos de potássio e aumentou o risco de uma taquicardia ventricular rara, chamada Torsade de Pointes. Alguns indivíduos morreram de problemas cardíacos que se desenvolveram depois que tomaram terfenadina com eritromicina ou cetoconazol. Como as propriedades terapêuticas da terfenadina estão associadas com seu metabólito não-tóxico fexofenadina, o fabricante testou fexofenadina como um novo medicamento e buscou aprovação do FDA para esse metabólito, agora comercializado como Allegra. Cisapride foi aprovado em 1993 para pacientes que sofrem de azia noturna, que resulta de doença de refluxo gastro-esofágico ou GERD. A eliminação dessa droga do corpo depende do seu metabolismo por CYP3A4, e quando administrada sozinha ou com outras drogas que não inibem CYP3A4, a droga original não se acumula no plasma. Entretanto, quando tomada com outras drogas que são substratos ou inibidores de CYP3A4, o metabolismo de cisapride é reduzido e acumula-se com administrações subseqüentes. Em alguns indivíduos, níveis aumentados de cisapride causam arritmias cardíacas e, por volta do final de 1999, anomalias de ritmo cardíaco foram relatados em 341 pacientes que tomavam cisapride, resultando em 80 mortes. Então, o fabricante de cisapride parou de comercializar essa droga nos Estados Unidos, após 2000.

Fonte: Terfenadine: proposal to withdraw approval of two new drugs applications and one abbreviated new drug application. Fed. Reg. 62:1889, 1997. (Esse documento pode ser visto na página da internet do Federal Register em http://www.access.gpo.gov/su_docs/aces/aces140.html); e Desta, Z., Soukhova, N., Mahal, S. K. e Flockhart, D. A. Interactions of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab. Dispos. 28:789, 2000.

BioQ.11 420

22.01.07 17:16:08

428

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

|

11.10 ISOFORMAS DE ÓXIDO NÍTRICO SINTASES E FUNÇÕES FISIOLÓGICAS

bora se localize na membrana por interações proteína-proteína com uma gama de proteínas regulatórias e de localização. É expressa constitutivamente, o que significa que não é normalmente induzida em nível transcripcional, e é ativada pelo influxo de cálcio. No caso de NOSI, e NOSIII, ver a seguir), calmodulina não está ligada à enzima nos níveis intracelulares basais de cálcio. Requer um influxo de cálcio para elevar a concentração de cálcio, permitindo ligação da calmodulina, assim ativando a formação de NO. A quantidade de NO sintetizado no estado ativado é muito baixa – isto é, picomolar. O NO produzido funciona como um neurotransmissor nos sistemas nervosos central e periférico. No músculo esquelético, NO também serve de mediador da força contrátil. No sistema nervoso central, NO é produzido geralmente por NOSI no neurônio pós-sináptico, mas difunde de volta na sinapse para o neurônio pré-sináptico. Síntese de NO é regulada pelo influxo de cálcio por canais dependentes de receptor – isto é, após estimulação pós-sináptica de receptores de N-metil-D-aspartado (NMDA) pelo neurotransmissor excitatório glutamato. Guanilato ciclase é ativada por NO, produzindo cGMP, que regula síntese dos neurotransmissores norepinefrina e glutamato, aumentando assim a produção de NO (Figura 11.20). NO está implicado em sinalização neural, neurotoxicidade, plasticidade neuronal, aprendizado e memória, e percepção de dor. Além de seus domínios oxigenase e redutase, NOSI tem um domínio PDZ N-terminal de 300 aminoácidos, que medeia sua interação com outras proteínas. No sistema nervoso central, o domínio PDZ da NOSI interage com a proteína de densidade pós-sináptica PSD-95. O receptor NMDA também interage com PSD-95, aproximando muito NOSI e o receptor NMDA, de modo que NOSI fica diretamente exposta ao cálcio entrando pelo canal iônico do receptor NMDA ativado.

Há três isoformas principais de NOS – neuronal (NOSI ou nNOS), indutível (NOSII ou iNOS) e endotelial (NOSIII ou eNOS) – embora variações em cada um desses tipos ocorram em muitos organismos diferentes. Propriedades dessas isoformas são resumidas na Tabela 11.4. Muitas das funções fisiológicas de NO são mediadas por ativação de guanilato ciclase solúvel, uma proteína heterodimérica (α/β) contendo heme que converte GTP em cGMP. cGMP é um segundo mensageiro envolvido em muitas cascatas de transdução de sinal (ver p. 518). A forma inativa da guanilato ciclase solúvel tem um heme penta-coordenado, ligado por uma histidina à subunidade β. NO liga-se à sexta posição para formar um heme hexa-coordenado e causa quebra da ligação heme-histidina, gerando o complexo nitrosil ativo, penta-coordenado, da guanilato ciclase solúvel (Figura 11.19). Ativação da guanilato ciclase solúvel causa aumento de até 400 vezes na taxa de formação de cGMP. Os níveis de cGMP são regulados por um equilíbrio entre atividade de guanilato ciclase e fosfodiesterase (PDE), particularmente PDE5, que é específica para cGMP, que hidrolisa cGMP em 5’-GMP, desligando o sinal.

NOSI NOSI é encontrada primariamente em músculo esquelético e em neurônios tanto do sistema nervoso central como do periférico. É uma enzima solúvel, em�������

������

His α1

β1

Fe F e2+

α1

His Fe

����� His β1

α1

2+

β1 Fe F e2+

NO

FIGURA 11.19 Ativação da guanilato ciclase solúvel por NO. Redesenhado com base em figura de Bellamy, T. C. e Garthwaite, J. The receptor-like properties of nitric oxide-activated soluble guanylate cyclase in intact cells. Mol. Cell. Biochem. 230:165, 2002.

NO

NO

TABELA 11.4 Propriedades das Isoformas de NOS Propriedade

BioQ.11 428

NOSI

NOSII

NOSIII

Massa molecular

160 kDa

130 kDa

135 kDa

Expressão

Constitutiva

Indutível

Constitutiva

Fração celular

Citoplasmática

Citoplasmática

Ligada à membrana

Dependência de influxo de cálcio

Dependente

Independente

Dependente

Ação fisiológica

Neurotransmissão

Citotoxicidade

Vasodilatação

22.01.07 17:16:19

436

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

PARTE 3 FUNÇÕES DE PROTEÍNAS

12

MEMBRANAS BIOLÓGICAS: ESTRUTURA E TRANSPORTE EM MEMBRANAS Thomas M. Devlin 12.1

VISÃO GERAL, 437

12.2 COMPOSIÇÃO QUÍMICA DE MEMBRANAS, 438 Lipídeos são importantes componentes de membranas, 438 Glicerofosfolipídeos são os lipídeos mais abundantes de membranas, 438 Glicerofosfolipídeos são anfipáticos, 441 Esfingolipídeos estão presentes em membranas, 441 Colesterol é um importante componente de membranas plasmáticas, 443 Composição em lipídeos varia entre membranas, 443 Proteínas de membrana, 444 Carboidratos de membranas são parte de glicoproteínas ou glicolipídeos, 445 12.3 MICELAS, BICAMADAS LIPÍDICAS E LIPOSSOMOS, 445 Lipídeos formam estruturas vesiculares, 445 Bicamadas lipídicas sintéticas e lipossomos, 445 Propriedades gerais de bicamadas lipídicas, 446 12.4 ESTRUTURA DE MEMBRANAS BIOLÓGICAS, 447 Modelo do mosaico fluido de membranas biológicas, 447 Lipídeos são distribuídos assimetricamente em membranas, 448 Proteínas integrais de membrana ficam mergulhadas na bicamada lipídica, 449

BioQ.12 436

Proteínas periféricas de membrana, 451 Proteínas de membrana ancoradas por lipídeos, 451 Proteínas e lipídeos difundem em lamelas da membrana, 452 Microdomínios de complexos lipídeo-proteína estão presentes em membranas, 454 Natureza dinâmica de membranas, 455 12.5 MOVIMENTO DE MOLÉCULAS ATRAVÉS DE MEMBRANAS, 456 Algumas moléculas difundem através de bicamadas lipídicas, 456 Classificação e nomenclatura de sistemas de deslocamento por membrana, 457 12.6 CANAIS DE MEMBRANAS, 458 Classificação dos canais de membrana, 458 Características dos canais de membrana, 459 Aquaporinas e aquagliceroporinas, 459 Canais iônicos de Na+, Ca 2+, K+ e Cl– controlados por voltagem, 460 Canal nicotínicos de acetilcolina (nAChR), 464 Junções comunicantes (gap junctions) e canais do poro nuclear, 465 12.7 TRANSPORTADORES DE MEMBRANA, 466 Quatro etapas no transporte de moléculas de soluto, 466 Energética de sistemas de transporte de membrana, 467 12.8 TRANSPORTE PASSIVO, 468

22.01.07 17:18:53

CAPÍTULO 12 MEMBRANAS BIOLÓGICAS: ESTRUTURA E TRANSPORTE EM MEMBRANAS

Carboidratos de Membranas São Parte de Glicoproteínas ou Glicolipídeos

BioQ.12 445

H

OH

H OH

HNCOCH3

H

N-Acetil-�-D-glucosamina CH2OH O

HO

H OH

H

H

H

H OH

HNCOCH3

N-Acetil-�-D-galactosamina H H HO

O

H

CH3 H

OH

HO

OH

H

�-L-Fucose

O

Dependendo das condições experimentais, lipídeos anfipáticos como glicerofosfolipídeos formam uma es-

H

HO

|

Bicamadas Lipídicas Sintéticas e Lipossomos

O

H

12.3 MICELAS, BICAMADAS LIPÍDICAS E LIPOSSOMOS

A característica estrutural básica das membranas devese às propriedades físico-químicas dos glicerofosfolipídeos e esfingolipídeos. Esses compostos anfipáticos, com uma cabeça hidrofílica e uma cauda hidrofóbica (Figura 12.19a), interagem em sistemas aquosos in vitro para formar esferas, chamadas micelas (Figura 12.19b). Os grupos das cabeças polares ficam no lado de fora da esfera, enquanto as caudas hidrofóbicas interagem para excluir água. Micelas têm apenas uma superfície polar, que fica no lado apresentado para a fase aquosa. Micelas podem ser preparadas contendo um único lipídeo ou uma mistura de lipídeos. A concentração de lipídeos necessária para formação de micelas é a concentração micelar crítica. Formação de micelas também depende da temperatura e, se uma mistura de lipídeos estiver presente, da razão entre as concentrações dos diferentes lipídeos (ver p. 1062). A estrutura da micela é muito estável, graças às interações hidrofóbicas entre cadeias hidrocarbônicas e atração dos grupos polares de cabeça pela água. Micelas são importantes em digestão intestinal e absorção de lipídeos (ver p. 1031).

445

CH2OH

Carboidratos estão presentes em membranas como oligossacarídeos covalentemente ligados a proteínas (glicoproteínas) e a lipídeos (glicolipídeos). Os açúcares nos oligossacarídeos incluem glicose, galactose, manose, fucose, N-acetilgalactosamina, N-acetilglucosamina e ácido N-acetilneuramínico (ácido siálico) (Figura 12.18 e Apêndice, para estruturas). Estruturas de glicoproteínas e glicolipídeos são apresentadas nas páginas 638 e 708, respectivamente. O carboidrato fica na superfície extracelular da membrana plasmática e na superfície luminal do retículo endoplasmático. Funções de carboidratos ligados a proteínas em membranas incluem reconhecimento célula-célula, adesão e ação como receptor. Há pouco ou nenhum carboidrato livre em membranas.

Lipídeos Formam Estruturas Vesiculares

|

CH3

C

H H N

H

HCOH HCOH CH2OH H

O

H

COOH

OH

H II Ácido N-Acetil-D-neuramínico OH

FIGURA 12.18 Estruturas de alguns carboidratos de membrana.

trutura em bicamada, com duas camadas de lipídeos formando uma estrutura na qual há contato mínimo das cadeias hidrocarbônicas com água. Os grupos da cabeça polar ficam na interface entre o meio aquoso e o lipídeo, e as caudas hidrofóbicas interagem, criando um ambiente interior hidrofóbico que exclui água (Figura 12.19c). Esta conformação em bicamada é a estrutura lipídica básica de todas as membranas biológicas. Bicamadas lipídicas são extremamente estáveis, sendo mantidas juntas por forças hidrofóbicas das cadeias hidrocarbônicas e interações iônicas dos grupos carregados das cabeças com água. Bicamadas lipídicas selamse automaticamente, se rompidas. Uma bicamada lipídica, em condições adequadas, fechar-se-á sobre si mesma para formar uma vesícula esférica que separa o ambiente externo de um compartimento aquoso interno. Tais vesículas, chamadas lipossomos (Figura 12.19d), são preparadas usando lipídeos purificados e lipídeos extraídos de membranas

22.01.07 17:19:06

462

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

CORRELAÇÃO CLÍNICA 12.4

O Rim de Mamíferos e Aquaporinas O papel primário do rim é regular o pH do sangue, eliminar produtos tóxicos do metabolismo e regular equilíbrio de água do corpo. Cada rim contém cerca de um milhão de néfrons, as unidades funcionais multicelulares do tecido. Cada néfron tem várias regiões distintas (ver diagrama), cada uma com funções muito específicas no processamento do filtrado do sangue, que ocorre no glomérulo. Uma grande quantidade de sangue é filtrada (cerca de 150 L/dia), e a água deve ser reabsorvida no néfron e ductos coletores, exceto cerca de 1,5 L/dia, que é excretado como urina. Aquaporinas são responsáveis pela recuperação de água do filtrado à medida que flue pelo lúmen do néfron. Como indicado no diagrama, pelo menos sete diferentes isoformas de aquaporinas, localizadas em diferentes pontos ao longo do néfron e dos ductos coletores, são responsáveis pela reabsorção de água. Existem várias doenças renais nas quais a reabsorção de água é anormal e nas quais a expressão e a função das aquaporinas foi investigada. Vários modelos animais dessas condições foram úteis na determinação da causa de algumas dessas condições. Baixos níveis de AQP2 e poliúria (excreção excessiva de urina) são encontrados em diabetes insipidus nefrogênica adquirida (NDI), hipocalemia adquirida (baixo K+ sangüíneo) e hipercalcemia (Ca 2+ sangüíneo aumentado). Em muitos casos, NDI é causada por incapacidade do rim responder a vasopressina (ver p. 897); considera-se que isso leve a uma expressão diminuída e/ou incorporação de AQP2 na membrana. Em outros casos de NDI, há um defeito no gene da aquaporina; em alguns casos, este defeito leva a uma incapacidade do monômero formar estruturas tetraméricas normais. Níveis de AQP1, AQP2 e AQP3 em modelos animais são reduzidos

em isquemia tissular. Em algumas condições, como insuficiência cardíaca congestiva, cirrose hepática e gravidez, há um aumento na quantidade de AQP2 no rim, levando a uma expansão no volume líquido extracelular. Seres humanos sem atividade de AQP1 do rim aparentemente não têm problemas detectáveis em condições normais, mas podem ter em condições de estresse (desidratação). Espera-se que condições clínicas adicionais venham a ser atribuídas a alterações nas outras aquaporinas. Túbulo contornado distal

Glomérulo

Túbulo de conexão

Água

Tubo proximal AQP 1, 7, 8

+ADH água Água

Água

Dutos coletores AQP 2, 3, 4, 6, 8

Alça descendente fina AQP 1 Água Alça ascencente fina

+ADH água

Urina final

Localização de aquaporinas em cada segmento do néfron e ductos coletores do rim. Modificado a partir de figura das citações abaixo.

Fonte: King, L. S. e Yasui, M. Aquaporins and disease: Lessons from mice to humans. Trends Endocrinol. Metab. 13:355, 2002. Nielsen, S., Frokiaer, J., Marples, D., Kwon, T-H., Agre, P., e Knepper, M. A. Aquaporins in the kidney: From molecules to medicine. Physiol. Rev. 82: 205, 2002. King, L. S., Kozono, K., e Agre, P. From structure to disease: The evolving tale of Aquaporin biology. Nature Rev. Mol. Cell Biol. 5:687, 2004.

acessórias (β, γ ou δ) não têm uma estrutura comum; algumas têm vários segmentos transmembrânicos e outras são proteínas periféricas localizadas inteiramente intra ou extracelularmente. Estão geralmente envolvidas em regulação do canal; subunidades β podem interagir com proteínas de citoesqueleto e de matriz extracelular. Um modelo do canal de Na+ é apresentado na Figura 12.38. Um segmento transmembrânico tem um

BioQ.12 462

resíduo carregado positivamente a cada terceira posição, e pode servir como um sensor de voltagem; deslocamento mecânico deste segmento pode levar a uma mudança conformacional na proteína, resultando em abertura do canal. Dois mecanismos muito diferentes foram sugeridos, mas nenhum provado, para como o canal e os domínios sensíveis a voltagem são acoplados e iniciam a abertura do canal. Canais iônicos voltagem-

22.01.07 17:19:39

478

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

12.10 | IONÓFOROS Um grupo interessante de compostos sintetizados e excretados por bactérias facilita a translocação de íons inorgânicos através de membranas de outras células. Essas moléculas, chamadas ionóforos, são membros dos canais sintetizados não-ribossomicamente (ver p. 459) e são compostos de peso molecular relativamente baixo (até alguns milhares de daltons). Há dois subgrupos principais. (1) transportadores móveis, que ligam um íon e se difundem facilmente em uma membrana, e (2) formadores de canal. Alguns ionóforos importantes são listados na Tabela 12.11. Cada transportador móvel tem uma especificidade definida para íons. Valinomicina (Figura 12.59) tem uma afinidade por K+ 1.000 vezes maior do que por Na+, e A23187 (Figura 12.60) tem uma afinidade por Ca 2+ 10 vezes maior do que por Mg2+. Vários dos transportadores móveis têm uma estrutura cíclica, e o íon fica coordenado com átomos de oxigênio no centro da estrutura; a periferia da molécula consiste de grupos hidrofóbicos. Quando um íon é quelado pelo ionóforo, sua capa de água é removida e o íon é envolvido pela capa hidrofóbica. O complexo ionóforo-íon difunde-se livremente através da membrana. Como interação de íon e ionóforo é uma reação de equilíbrio, uma concentração de estado estacionário (steady state) do íon se estabelece em ambos os lados da membrana. Valinomicina transporta K+ por um mecanismo eletrogênico uniporte que cria um gradiente eletroquímico através de uma membrana, visto que transporta um K+ carregado positivamente (Figura 12.61a). Nigericina é um antiporter eletricamente neutro; seu grupo carboxila, quando dissociado, liga um íon positivo, como K+, formando um complexo neutro que cruza a membrana. Transporta um próton de volta na difusão pela membrana, levando a uma troca de K+ por H+ (Figura 12.61b). Gramicidina A é um peptídeo de 15 resíduos com D- e L-aminoácidos alternados. Em membranas, forma uma β-hélice e pode dimerizar, formando um longo segmento transmembrânico (25 Å) e um canal de diâmetro estreito (5 Å) (Figura 12.62). Resíduos polares reves-

tem o canal e grupos hidrofóbicos ficam na periferia do canal, interagindo com a membrana lipídica. A estrutura permite a passagem de água e cátions divalentes, mas não ânions. Associação e dissociação de monômeros controla a taxa de fluxo de íons. Ionóforos têm atividade de antibiótico, porque rompem o equilíbrio iônico intracelular. São também valiosas ferramentas experimentais em estudos de translocação de íons em membranas biológicas e para manipulação da composição iônica de células. L-Val

O

N

O O

D-Val

N O O

O L

D-Val

O

O H

N O

K+ L O

N

N

H

L-Val

O N

O

O

O

L-Val

O

L O

H O

O

D-Val

FIGURA 12.59 Estrutura do complexo valinomicina-K+. Abreviaturas: D-Val, D-valina; L-Val: L-valina; L, L-lactato; H, D-hidroxiisovalerato. CH3 H3C

CH3 O

H H

O

CH3 C

O NH

N

O

OH C O

NH CH3

FIGURA 12.60 Estrutura de A23187, um ionóforo de Ca2+.

TABELA 12.11 Importantes Ionóforos Composto Valinomicina

+

K ou Rb +

+

+

Ação Uniporte, eletrogênico

Nonactina

NH4 , K

Uniporte, eletrogênico

A23187

Ca2+ /2 H +

Antiporte, elétron-neutro

Nigericina

+

K /H

+

+

Antiporte, elétron-neutro +

Monensina

Na /H

Gramicidina

H +, Na +, K+, Rb +

Alameticina

BioQ.12 478

Importantes Cátions Transportados

+

K , Rb

+

Antiporte, elétron-neutro Forma canais Forma canais

22.01.07 17:20:19

CAPÍTULO 13 FUNDAMENTOS DA TRANSDUÇÃO DE SINAL

|

483

PARTE 3 FUNÇÕES DE PROTEÍNAS P

P

P

P

13

FUNDAMENTOS DA TRANSDUÇÃO DE SINAL George R. Dubyak 13.1

VISÃO GERAL, 484

13.2

TRANSDUÇÃO DE SINAL INTERCELULAR, 485 Dois modos fundamentais de transdução de sinal intercelular, 485 Sinalização justácrina ou contato-dependente, 485 Sinalização endócrina, 486 Sinalização parácrina, 486 Sinalização sináptica ou neuronal, 486 Sinalização autócrina, 486 Moléculas sinalizadoras secretadas, 487

13.3

RECEPTORES PARA MOLÉCULAS SECRETADAS, 487

13.4

TRANSDUÇÃO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFÍCIE CELULAR, 488 Ligantes, receptores e interações receptor-ligante, 488 Relações entre receptores, efetores e segundos mensageiros, 489 Fosforilação de proteínas na transdução de sinal, 490 Proteínas regulatórias que ligam GTP na transdução de sinal, 491 Outros componentes de complexos de sinalização mediada por receptor e cascatas, 491 Interação ligante-receptor e eventos subseqüentes de sinalização, 492 Término da transdução de sinal por receptores de superfície celular, 492

13.5

BioQ.13 483

RECEPTORES CANAIS IÔNICOS LIGANTE-DEPENDENTES, 493

Receptores canais iônicos, 494 Término da sinalização por receptores canais iônicos, 495 Regulação de canais iônicos por outros receptores, 495 13.6

RECEPTORES LIGADOS A ENZIMAS, 496 Funções fisiológicas de ligantes extracelulares, 496 Receptores tirosina quinases (RTKs), 496 Ras GTPase e MAP quinase, 497 Receptores serina/treonina quinases, 499

13.7

RECEPTORES DE CITOCINAS, 500 Receptores de citocinas: estrutura e função, 500

13.8

RECEPTORES ACOPLADOS A PROTEÍNA G, 500 Funções fisiológicas e ligantes extracelulares, 500 Estrutura de receptores acoplados a proteína G, 501 Proteínas G heterotriméricas, 503 O ciclo da proteína G, 505 Término da sinalização por receptores acoplados a proteína G, 506 Efeitos de toxinas bacterianas sobre proteínas G heterotriméricas, 506

13.9

TRANSDUÇÃO DE SINAL BASEADA EM AMP CÍCLICO, 506 Regulação da síntese e degradação de AMP cíclico, 506 Mecanismos intracelulares de sinalização por AMP cíclico, 508

22.01.07 17:40:53

488

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

ou reprimir transcrição e, assim, alterar a expressão de proteínas codificadas por estes genes. Devido a seus efeitos sobre a expressão gênica, ativação de receptores intracelulares produz mudanças de longa duração (de horas a dias) na função das células-alvos. A estrutura e a função desses receptores são descritas em maiores detalhes na p. 488. Receptores de superfície celular atuam como sítios de reconhecimento para a vasta maioria de moléculas sinalizadoras que são muito grandes (proteínas ou hormônios polipeptídicos) ou muito hidrofílicas para cruzar rapidamente a membrana plasmática da célula-alvo. Tais moléculas sinalizadoras interagem com a célula-alvo ligando-se a receptores de superfície celular que são proteínas integrais de membrana (Figura 13.3b). Proteínas receptores de superfície são acopladas a uma variedade de reações bioquímicas intracelulares chamadas cascatas ou vias de transdução de sinal. O evento mais proximal ou precoce da transdução de sinal, desencadeado pela ligação de uma molécula sinalizadora a um receptor, é uma mudança conformacional do receptor que resulta no seguinte: (1) geração

��� Receptor canal iônico ligante-dependente Membrana plasmática

Íons Neurotransmissor

Citosol

Receptor ��� Receptores ligados a enzimas

Domínio catalítico inativo

Domínio catalítico inativo

��� Receptores de citocinas

de moléculas sinalizadoras intracelulares conhecidas como segundos mensageiros (a molécula secretada extracelular é o primeiro mensageiro); ou (2) uma mudança no potencial elétrico de membrana plasmática; e (3) ativação de cascatas enzimáticas envolvendo proteína quinases, proteína fosfatases ou proteases. Quatro superfamílias principais de receptores de superfície celular estrutural e funcionalmente relacionados são mediadores da imensa maioria de vias de comunicação intercelular (Figura 13.4); estas incluem receptores canais iônicos ligante-dependentes, receptores ligados a enzimas ou catalíticos; família de receptores de citocinas; e receptores acoplados a proteína G ou GPCR.

|

13.4 TRANSDUÇÃO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFÍCIE CELULAR Ligantes, Receptores e Interações Receptor-Ligante Um ligante é qualquer molécula que se liga a uma receptor protéico. Um agonista é um ligante que, ao se ligar, ativa transdução de sinal, enquanto um antagonista é um ligante que impede transdução de sinal quando se liga ao receptor. Um agonista ou antagonista fisiológico é uma molécula de ocorrência natural (como um hormônio ou neurotransmissor) que atua como um ligante para um receptor. Um agonista ou antagonista farmacológico é uma molécula sintética que atua como um ligante para um receptor. Muitas drogas terapêuticas são agonistas ou antagonistas de receptores. Certos agonistas fisiológicos podem estimular múltiplos tipos de receptores que são chamados subtipos de receptores. O conceito-chave é que a mesma molécula extracelular sinalizadora pode se ligar a diferentes receptores protéicos que são produtos de diferentes genes. Por exemplo, acetilcolina pode interagir com um receptor canal iônico ligante-dependente (ver p. 465) que causa contração de músculo esquelético, ou com receptores acoplados a proteína G (ver p. 491) que causam relaxamento do músculo cardíaco (Figura 13.5).

Enzima ativada ��� Receptores acoplados a proteína G

Proteína G

BioQ.13 488

Enzima

Neurotransmissor ou hormônio

Proteína G ativada

Enzima ativada

FIGURA 13.4 Principais classes de receptores de superfície celular para moléculas sinalizadoras secretadas. Redesenhado com base em figura de Alberts, B., et al. Essential Cell Biology, 2nd ed. New York: Garland, 2004.

22.01.07 17:41:19

498

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

CORRELAÇÃO CLÍNICA 13.1

Família de Receptores Tirosina Quinases ErbB/HER como Alvos para Quimioterapia do Câncer O receptor de fator de crescimento epidérmico (EGF) foi o primeiro com atividade intrínseca de tirosina quinase a ser identificado e caracterizado em detalhes. Este receptor catalítico é membro de uma família de quatro proteínas relacionadas, chamadas receptores ErbB/HER, devido à sua semelhança com o oncogene v-erbB de vírus de eritroblastose aviária, que induz leucemia eritróide em pássaros. Esta ligação entre proteínas ErbB/HER e câncer também se observa no homem. Superexpressão do gene ErbB1 humano, que codifica o receptor humano de EGF (HER1), caracteriza cânceres de bexiga, mama, rim, próstata e pulmão de célula não-pequena. Um gene ErbB1 mutante produz um receptor que não tem o domínio extracelular de ligação a EGF, e é muito expresso nos glioblastomas, que correspondem a 25% dos tumores de cérebro humano adulto. ErbB3 e ErbB4 humanos, respectivamente, codificam os receptores HER3 e HER4 que se ligam a proteínas extracelulares pertencentes à família NRG (neurregulina/herregulina/neu) de fatores de crescimento e diferenciação. ErbB3 é freqüentemente superexpresso em cânceres de mama, cólon, próstata e estômago, enquanto superexpressão de ErbB4 foi observada em tumores de células da granulosa ovariana. O outro membro da família é o gene ErbB2, que codifica a proteína HER2 a qual, surpreendentemente, não tem capacidade de se ligar a nenhum fator de crescimento extracelular conhecido. Em vez disso, receptores HER2 possuem uma conformação basal que permite a eles formarem homodímeros com outras proteínas HER2 não-ligadas ou heterodímeros com receptores HER1, HER3 ou HER4 ocupados por fator de crescimento. Como dimerização é a etapa crítica para ativar a atividade intrínseca de tirosina quinase dessa proteína, mesmo modesta superexpressão de HER2 pode alterar regulação normal de crescimento celular. Significativamente, expressão

do gene ErbB2 é amplificada em até duas ordens de grandeza em 20% dos seres humanos com câncer de mama invasivo. A expressão aberrante de proteína ErbB/HER em múltiplos cânceres humanos tem levado ao desenvolvimento de várias terapias por drogas que têm estes receptores como alvos. Um grupo de agentes terapêuticos inclui anticorpos monoclonais que se ligam a domínios extracelulares funcionalmente significativos de diferentes subtipos de HER. Trastuzumab (Herceptin® da Genentech) é um anticorpo antiHER2 que tem sido usado, desde 1998, para o tratamento desses cânceres de mama caracterizados por superexpressão de ErbB2/HER2. O mecanismo por trás das ações antitumorais de Trastuzumab/Herceotin® envolve o recrutamento de fatores imunes anticorpo-dependentes que matam as células tumorais e a atenuação da proteólise do ectodomínio de HER2 (por metaloproteases nativas) que potencializa ainda mais a dimerização constitutiva desses receptores. Cetixumab (IMC-C225 ou Erbitux® da ImClone) é um anticorpo que interage com o domínio de ligação de EGF da proteína ErbB1/HER1 e, assim, impede ativação induzida por ligante do receptor. Este agente está sendo testado em pacientes com cânceres de célula escamosa de cabeça e pescoço ou cânceres de pulmão de célula não-pequena. Além dessas terapias baseadas em anticorpos, uma variedade de drogas que são moléculas pequenas foi projetada para atingir os domínios intracelulares tirosina quinase das proteínas ErbB/HER. Esses reagentes são compostos baseados em 4-anilinoquinazolina, que atuam como inibidores competitivos dos sítios de ligação de ATP das quinases, particularmente do subtipo ErbB1/HER1. No momento, tais drogas estão sendo testadas em pacientes sofrendo de cânceres de pulmão de célula não-pequena que não responderam a outras quimioterapias.

Fonte: Roskowski, R., Jr. The ErbB/HER receptor protein-tyrosine kinases and cancer. Biochem. Biophys. Res. Commun. 319:1, 2004. transitoriamente e estimulam uma família de proteína serina/treonina quinases, que desencadeiam a cascata da proteína quinase ativada por mitógeno (mitogen-activated protein kinase) ou cascata da MAP quinase (Figura 13.17). Esta cascata de amplificação envolve ações em série de três proteína quinases; a primeira quinase, ativada por Ras (ou MAP quinase quinase quinase) ativa um conjunto intermediário de MAP quinase quinases, que ativam as MAP quinases finais efetoras.

BioQ.13 498

Quando ativadas, as MAP quinases terminais fosforilam múltiplas proteínas-alvos no citosol e no núcleo, incluindo fatores de transcrição que regulam a expressão de genes necessários para divisão celular, sobrevivência celular ou diferenciação fenotípica.

22.01.07 17:42:09

514

|

PARTE 3 FUNÇÕES DE PROTEÍNAS

Proteína quinase dependente de calmodulina

Proteína fosfatase

Pi

Domínio inibitório COOH

P

Ca2+ independente (50-80% ativa)

Calmodulina

Inativa NH2 Domínio catalítico

FIGURA 13.31 Papel de calmodulina e proteína quinases reguladas por calmodulina nas cascatas de sinalização intracelular reguladas por Ca2+. Redesenhado com base em figura de Alberts, B., et al. Molecular Biology of the Cell, 4th ed. New York: Garland, 2002. Principais classes de fosfolipases usadas durante transdução de sinal mediada por receptor.

+Ca2+ +Ca2+/calmodulina

Ca2+

ADP P

ATP

Autofosforilação Totalmente ativa

Ativada

nal) podem fosforilar uma ampla faixa de proteínas substratos. Alterar a atividade dessas proteínas é o mecanismo primário, pelo qual Ca 2+ aumentado altera o comportamento celular. CaM-quinase II também se autofosforila quando ligada a calmodulina. Embora Ca 2+ citosólico seja só transitoriamente aumentado em resposta à ativação de receptores de superfície celular, esta autofosforilação de CaM-quinase II permite que permaneça ativa muito depois do Ca 2+ citosólico ter voltado ao nível de linha basal. CaM-quinases podem fosforilar e modular uma ampla faixa de enzimas, canais iônicos, proteínas contráteis e proteínas regulatórias de genes.

|

13.12 TRANSDUÇÃO DE SINAL BASEADA EM FOSFOLIPÍDEOS Metabolismo Regulado de Fosfolipídeos como um Componente de Vias Intracelulares de Sinalização Transdução de sinal por muitos receptores de superfície celular envolve ativação de uma ou mais fosfolipases que catalisam a hidrólise de diferentes classes de fosfolipídeos (p. ex., fosfolipídeos de inositol ou colina). Várias importantes classes de enzimas efetoras fosfolipases catalisam a produção de diferentes produtos que atuam como segundos mensageiros ou reguladores de produção de segundos mensageiros (Figura 13.32). Enzimas fosfolipases C (PI-PLC) hidrolisam fosfolipídeos de inositol gerando inositol

BioQ.13 514

fosfatos e diacilgliceróis como segundos mensageiros. Inositol fosfolipídeos podem ser mais fosforilados por fosfoinositídeo-3-quinase (PI-3K) para produzir fosfatidilinositol-3,4,5-trisfosfato (PIP3), outro segundo mensageiro. Enzimas fosfolipases D (PLD) hidrolisam predominantemente fosfolipídeos de colina ou etanolamina para produzir ácido fosfatídico, que é subseqüentemente metabolizado por ácido fosfatídico fosfo-hidrolases (PAP) para gerar o segundo mensageiro diacilglicerol. Enzimas fosfolipases A2 (PLA2) atacam vários fosfolipídeos para produzir ácidos graxos livres, como ácido araquidônico e liso-fosfolipídeos.

Regulação de Fofolipase C e Fosfolipase D Como descrito anteriormente para transdução de sinal baseada em Ca 2+, muitos receptores acoplados a proteína G e receptores tirosina quinases estimulam a liberação de Ca 2+ do retículo endoplasmático por meio de ativação da produção de 1,4,5-inositol trisfosfato (IP3). Este segundo mensageiro solúvel em água é derivado da hidrólise de fosfatidilinositol-4,5-bisfosfato (PIP2), um fosfolipídeo de membrana relativamente minoritário que é gerado por múltiplas fosforilações do resíduo de inositol do fosfatidilinositol. Esta hidrólise de PIP2 é catalisada por uma família de fosfolipases tipo C (PLC) com alta seletividade para inositol fosfolipídeos (Figura 13.32). É importante apreciar que a hidrólise de PIPs por uma PLC gera dois segundos mensageiros diferentes: (1) o produto solúvel IP3 e (2) diacilglicerol (DAG), um segundo mensageiro hidrofóbico. Enzimas PI-PLCβ são ativadas por interação com subunidades α de proteínas G da família Gq /11 ou as subunidades βγ

22.01.07 17:43:19

CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO

|

521

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE P

P

P

P

14

BIOENERGÉTICA E METABOLISMO OXIDATIVO Diana S. Beattie 14.1

SISTEMAS DE PRODUÇÃO E DE UTILIZAÇÃO DE ENERGIA, 522 ATP liga sistemas de produção e de utilização de energia, 522 NAD+ e NADPH em catabolismo e anabolismo, 523

14.2

RELAÇÕES TERMODINÂMICAS E COMPONENTES RICOS EM ENERGIA, 524 Energia Livre é energia disponível para trabalho útil, 525 Valor calórico de componentes da dieta, 526 Compostos são classificados com base em energia liberada na hidrólise de grupos específicos, 526 Variações de energia livre podem ser determinadas em reações enzimáticas acopladas, 527 Energias de ligações de alta energia de vários grupos podem ser transferidas de um composto para outro, 527

14.3

FONTES E DESTINOS DA ACETIL-COENZIMA A, 529 Fontes e destinos metabólicos do piruvato, 530 Piruvato desidrogenase é um complexo multienzimático, 531 Piruvato desidrogenase é rigorosamente regulada, 531 Acetil-CoA é usado por várias vias diferentes, 534

14.4

CICLO DOS ÁCIDOS TRICARBOXÍLICOS, 534 Reações do ciclo dos ácidos tricarboxílicos, 535

BioQ.14 521

Conversão do grupo acetil de acetil-CoA a CO2 e H2O conserva energia, 537 Ciclo dos ácidos tricarboxílicos serve como uma fonte de intermediários biossintéticos, 537 Reações anapleróticas repõem intermediários do ciclo dos ácidos tricarboxílicos, 538 Atividade do ciclo dos ácidos tricarboxílicos é cuidadosamente regulada, 539 14.5

ESTRUTURA E COMPARTIMENTALIZAÇÃO POR MEMBRANAS MITOCONDRIAIS, 540 Membranas mitocondriais interna e externa têm diferentes composições e funções, 540

14.6

CADEIA DE TRANSPORTE DE ELÉTRONS, 542 Reações de oxidação-redução, 542 Variações da energia livre em reações redox, 544 Transporte mitocondrial de elétrons é um sistema com múltiplos componentes, 544 Complexo I: NADH-ubiquinona óxido-redutase, 545 Complexo II: succinato-ubiquinona óxido-redutase, 546 Outras desidrogenases flavoproteínas mitocondriais, 546 Complexo III: ubiquinol-citocromo c óxido-redutase, 547 Citocromos, 547 Ciclo Q para transferência de elétrons e bombeamento de prótons no complexo III, 549 Movimento proposto das proteínas ferroenxofre durante transferência de elétrons no complexo III, 549

22.01.07 17:50:31

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE Carboidrato

C

H

O

OH

H Oxidado

Lipídeo H

C

H

4

5

–O

P

O

CH2

O

H

H

O

–O

P

FIGURA 14.3 Estados de oxidação de átomos de carbono típicos em carboidratos e lipídeos.

O

C

NH2

2

O

H

O C

NH2 + H+

H

NH2

N

H

H

.. N

1

H OH OH

CH2

Íon híbrido, H:–

O

H

N

N

N

H OH OH NADP+ contém um grupo fosforil nessa 2�-hidroxila

FIGURA 14.4 Estrutura de nicotinamida adenina dinucleotídeo (NAD +). Íon hidreto (H: -, um próton com dois elétrons) transferido para NAD + forma NADH.

|

14.2 RELAÇÕES TERMODINÂMICAS E COMPONENTES RICOS EM ENERGIA Células podem interconverter diferentes formas de energia e também trocam energia com seu ambiente. Os princípios de termodinâmica governam reações desse tipo. Conhecimento desses princípios facilita uma percepção de como reações que produzem e que utilizam energia ocorrem dentro da mesma célula, e como um organismo é capaz de executar várias funções de trabalho. A primeira lei da termodinâmica afirma que energia não pode ser criada nem destruída. Essa lei de conservação de energia estipula que, embora energia possa ser convertida de uma forma para outra, a energia total de um sistema permanece constante. Por exemplo, energia química disponível em um combustível metabólico, como glicose, é convertida na glicólise em energia química de ATP. No músculo esquelético, a energia química envolvida em ligações fosfato ricas em energia do ATP é convertida em energia mecânica, durante a contração muscular. A energia de um gradiente de prótons com eletropotencial osmótico através da membrana mitocondrial é convertida em energia química durante a síntese de ATP. A segunda lei da termodinâmica diz respeito a entropia. Entropia, designada por S, é uma medida ou indicador do grau de desordem ou casualidade de um

BioQ.14 524

N+

O

H Reduzido

3

6

Nicotinamida (reduzida)

O

H

AMP

C

H

OH Nicotinamida adenina dinucleotídeo (NAD+)

C

H

Nicotinamida (oxidada)

...

524

Substrato reduzido

Produto oxidado Catabolismo

NADP+

NADPH

Anabolismo Produto reduzido

Precursor oxidado

FIGURA 14.5 Transferência de equivalentes de redução durante catabolismo e anabolismo usando NADPH e NADH.

sistema. Entropia é vista como a energia de um sistema que não está disponível para realizar trabalho útil. Todos os processos, sejam químicos ou biológicos, tendem a progredir em direção a uma situação de máxima entropia. Portanto, sistemas vivos que são muito ordenados, nunca estão em equilíbrio com seu ambiente, visto que o equilíbrio em um sistema resulta quando acaso ou desordem (entropia) está no máximo. Em sistemas biológicos, entretanto, é quase impossível quantificar mudanças de entropia porque tais sistemas raramente estão em equilíbrio. Para maior simplicidade e por utilidade inerente nessas considerações, uma grandeza chamada energia livre é empregada.

22.01.07 17:50:36

CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO COO–

COO–

CH2

CH2

CH2

COO–

H

H

C C

COO–

COO–

COO– Succinato

Malonato

Maleato

FIGURA 14.21 Estruturas do succinato, um intermediário do ciclo TCA; malonato, um inibidor da succinato desidrogenase e do ciclo; e maleato, um composto não envolvido no ciclo.

(200 kDa) e é estereoespecífica para a forma trans do substrato (a forma cis, maleato, não é substrato; Figura 14.21). A reação é livremente reversível em condições fisiológicas. Correlação Clínica 14.2 descreve uma deficiência genética de fumarase. A reação final do ciclo TCA é catalisada pela malato desidrogenase, na qual os equivalentes de redução são transferidos para NAD +, para formar NADH + H+. O equilíbrio da reação é fortemente deslocado para a formação de L-malato, com um ΔGo’ = +7,0 kcal mol–1. Esta reação endergônica é deslocada no sentido para frente por ação da citrato sintase e de outras reações, que removem oxaloacetato.

CORRELAÇÃO CLÍNICA 14.2

Deficiência de Fumarase Deficiência de enzimas do ciclo TCA é rara, indicando a importância desta via para sobrevivência. Vários casos, entretanto, foram descritos, de severa deficiência de fumarase em mitocôndrias e citosol de tecidos (p. ex., linfócitos do sangue). É caracterizada por severa deficiência neurológica, encefalopatia e distonia, que se desenvolvem logo após o nascimento. Urina contém quantidades anormais de fumarato e níveis elevados de succinato, α-cetoglutarato, citrato e malato. As isoenzimas mitocondrial e citosólica de fumarase são derivadas de um único gene. Em pacientes afetados, ambos os pais têm a metade dos níveis normais de atividade enzimática, mas são clinicamente normais, como seria de se esperar em uma doença autossômica recessiva. A primeira mutação caracterizada no gene da fumarase contém uma glutamina substituída por um resíduo de glutamato 319. Fonte: Bourgeron, T., Chreiten, D., Poggi-Bach, J., et. al. Mutation of the fumarase gene in two siblings with progressive encephalopathy and fumarase deficiency. J. Clin. Invest. 93:2514, 1994.

BioQ.14 537

|

537

O NADH produzido nas três desidrogenases NAD + ligadas no ciclo TCA é rapidamente oxidado a NAD + pela cadeia respiratória. Este é outro fator que favorece a direção para frente da malato desidrogenase.

Conversão do Grupo Acetil de AcetilCoA a CO2 e H2O Conserva Energia O ciclo TCA (Figura 14.20) é a via oxidativa terminal para a maioria dos combustíveis metabólicos. Resíduos de dois carbonos na forma de acetil-CoA são completamente oxidados a CO2 e H2O, e quatro etapas oxidativas resultam na formação de 3 NADH + H+ e 1 FADH2, que são usados subseqüentemente para geração de ATP. Oxidação de cada NADH + H+ resulta em formação de 2,5 ATPs por fosforilação oxidativa, enquanto que oxidação do FADH2 formado na reação da succinato desidrogenase gera 1,5 ATPs. Uma ligação de alta energia é formada como GTP, na reação da succinil-CoA sintetase. Assim, a geração líquida de ATP ou seus equivalentes (i. é, GTP) para a completa oxidação de um grupo acetil no ciclo de Krebs é 10.

Ciclo dos Ácidos Tricarboxílicos Serve como uma Fonte de Intermediários Biossintéticos A discussão do ciclo TCA até agora se concentrou em seu papel na quebra oxidativa de grupos acetil a CO2 e H2O, formação de coenzimas reduzidas e síntese de ATP. Em geral, o ciclo TCA é o mecanismo final comum para quebra de alimentos; entretanto, como resumido na Figura 14.22, os compostos de quatro, cinco e seis carbonos gerados nas reações do ciclo TCA são importantes intermediários em processos biossintéticos. Succinil-CoA, malato, oxaloacetato, α-cetoglutarato e citrato são todos precursores da biossíntese de importantes compostos celulares. Transaminação converte α-cetoglutarato em glutamato, que pode deixar a mitocôndria e ser convertido em vários outros aminoácidos. No tecido nervoso, α-cetoglutarato é convertido nos neurotransmissores glutamato e ácido γ-aminobutírico (GABA). Glutamato é também produzido a partir de α-cetoglutarato pela enzima mitocondrial glutamato desidrogenase, em presença de NADH ou NADPH e amônia. O amino grupo incorporado em glutamato pode, então, ser transferido para formar vários aminoácidos, por diferentes aminotransferases. Estas enzimas e a relevância da incorporação ou da liberação de amônia em ou de α-cetoácidos são discutidas no Capítulo 19. Succinil-CoA representa um ponto de ramificação metabólico (Figura 14.23), porque pode ser formado a partir de α-cetoglutarato no ciclo ou a partir de metilmalonil-CoA, nas etapas finais da quebra de ácidos graxos de cadeia ímpar ou dos aminoácidos de cadeia ramificada valina e isoleucina, ou pode ser convertido

22.01.07 17:50:57

CAPÍTULO 14 BIOENERGÉTICA E METABOLISMO OXIDATIVO

|

565

CORRELAÇÃO CLÍNICA 14.6

Intolerância a Exercício em Pacientes com Mutações no Citocromo b Em 1993, uma mutação no citocromo b resultando em atividade diminuída do complexo citocromo bc1 foi encontrada em um homem de 25 anos de idade, que se apresentava com intolerância a exercício e fraqueza proximal. A mutação substituía um resíduo de aspartato, no lugar de uma glicina conservada na posição 290. Subseqüentemente, demonstrou-se que outros pacientes com sintomas semelhantes e atividade diminuída do complexo bc1 têm mutações nas quais um glutamato substituiu uma glicina conservada na posição 339, e uma serina substituiu uma glicina conservada na posição 34. Mais recentemente, demonstrou-se que um paciente com severa cardiomiopatia hipertrófica tinha uma mutação na qual um glutamato substituiu uma glicina conservada na posição 166. As mutações de glicina para aspartato ou glutamato estavam localizadas no citocromo b próximo ao sítio QO para oxidação de ubiquinol, enquanto a mutação glicina para serina localizava-se próxima do sítio Qi da redução de ubiquinona. Todas

essas mutações envolvem uma transição de guanina para adenina no mtDNA, sugerindo que a mutação pode ter resultado de dano oxidativo. Além disso, em todas as mutações de sentido errado (missense), uma glicina conservada foi substituída por uma molécula carregada maior; isto alterou a estrutura do citocromo b, resultando em atividade catalítica diminuída do complexo bc1. Mutações sem sentido (nonsense) resultando em citocromo b truncado e mutações envolvendo deleções de 4-24 pares de bases do mtDNA foram identificadas. Estas mutações nonsense e por deleções freqüentemente levam a severa intolerância a exercício, acidose láctica no estado de repouso e ocasionalmente mioglobinúria. Em contraste com a maioria das mutações no mtDNA, as mutações identificadas no gene do citocromo b não são de herança materna. Além disso, a maioria foi expressa apenas em tecidos musculares, sugerindo que sejam mutações somáticas, que ocorreram durante diferenciação de células troncos miogênicas.

Fonte: Andreu, A. L., et al. Exercise intolerance due to mutations in the cytochrome b gene of mitochondrial DNA. N. Engl. J. Med. 341:1037, 1999.

|

14.10 ESPÉCIES REATIVAS DE OXIGÊNIO (ROS) Oxigênio é essencial para a vida. A maioria das oxidações intracelulares resulta em transferência de dois elétrons para aceptores apropriados, como NAD + ou FAD, que são então oxidados pela cadeia de transporte de elétrons. A etapa final desta cadeia é catalisada por citocromo c oxidase, que liga fortemente O2 ao centro binuclear, onde redução passo a passo do O2 ocorre, sem liberação de intermediários no processo de oxidação (ver Seção 14.6, p. 542). A estrutura eletrônica do O2, entretanto, favorece sua redução por adição de um elétron de cada vez, levando à geração de radicais de oxigênio que podem causar dano celular. Um radical é uma molécula com um elétron não-pareado muito reativo em um orbital externo, que pode iniciar uma cadeia de reações por remoção de um elétron de outra molécula para completar seu próprio orbital. A transferência passo a passo de elétrons para O2 resulta em formação de ânions superóxido (O2-), depois peróxido de hidrogênio (H2O2), e finalmente radical hidroxila livre (OH•) (Figura 14.61).

BioQ.14 565

O radical hidroxila é, sem dúvida, o radical livre mais perigoso, uma vez que está envolvido em reações como peroxidação de lipídeos e geração de outros radicais tóxicos. Peróxido de hidrogênio não é um radical livre, mas é convertido pelas reações de Fenton ou de HaberWeiss no radical hidroxila, em presença de Fe2+ ou de Cu+, que são prevalentes em células (Figura 14.62).

Produção de Espécies Reativas de Oxigênio Embora processos oxidativos em células geralmente resultem em transferência de elétrons para O2 para formar água, sem liberação de intermediários, um pequeno número de radicais de oxigênio é inevitavelmente formado devido a vazamento nas reações de transferência de elétrons. A principal fonte intracelular de radicais de oxigênio é a cadeia de transporte de elétrons mitocondrial, onde superóxido é produzido por transferência de um elétron para O2, a partir da semiquinona estável produzida durante a redução de ubiquinona pelos complexos I e II (Figura 14.63). Superóxido também pode ser produzido por transferência de um elétron de uma flavina, como FMN. As espécies reativas de oxi-

22.01.07 17:51:56

572

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE Glicogênio

G

C

15

METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE Robert A. Harris 15.1 VISÃO GERAL, 573 15.2 GLICÓLISE, 574 Glicólise ocorre em todas as células humanas, 574 Glicose é metabolizada diferentemente em várias células, 575 15.3 VIA GLICOLÍTICA, 577 Glicólise ocorre em três estágios, 578 Estágio um: preparação da glicose, 578 Estágio dois: quebra de um intermediário fosforilado, 578 Estágio três: reações de óxido-redução e síntese de ATP, 578 Rendimento em ATP e equação balanceada da glicólise anaeróbica, 581 NADH gerado por glicólise deve ser oxidado novamente a NAD +: papel da lactato desidrogenase e das lançadeiras de substrato, 582 Glicólise anaeróbica, 582 Glicólise aeróbica, 582 Lançadeiras são importantes em outras vias de óxido-redução, 583 Oxidação de álcool, 583 Formação de glucuronídeo, 583 Reagentes sulfidrila e fluoreto inibem glicólise, 583 Arsenato impede síntese de ATP sem inibir glicólise, 583

BioQ.15 572

15.4 REGULAÇÃO DA GLICÓLISE, 584 Hexoquinase e glucoquinase têm propriedades diferentes, 586 6-Fosfofruto-1-quinase é uma enzima regulatória da glicólise, 589 Regulação da 6-fosfofruto-1-quinase por ATP e AMP, 589 Regulação da 6-fosfofruto-1-quinase por pH intracelular, 590 Regulação da 6-fosfofruto-1-quinase por citrato, 592 Controle hormonal da 6-fosfofruto-1-quinase por cAMP e frutose 2,6-bisfosfato, 592 A enzima bifuncional 6-fosfofruto-2-quinase/frutose 2,6-bisfosfatase é regulada por fosforilação, 595 Coração contém uma isoenzima diferente da 6-fosfofruto-2-quinase/frutose 2,6-bisfosfatase, 595 Piruvato quinase é também uma enzima regulatória da glicólise, 595 15.5 GLUCONEOGÊNESE, 597 Síntese de glicose é necessária para sobrevivência, 597 Ciclos de Cori e da alanina, 599 Síntese de glicose a partir de lactato, 600 Gluconeogênese usa muitas enzimas glicolíticas na direção inversa, 601 Glicose é sintetizada a partir da maioria dos aminoácidos, 602

22.01.07 18:00:31

574

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE GLICOGÊNIO

CH2OH

Glicogênese

Glicogenólise GLICOSE Glicólise

O

H OH

HO Gluconeogênese

H

H OH

H OH �-D-Glicose

LACTATO

2 ADP3– + 2 Pi2–

FIGURA 15.1 Relação da glicose com as principais vias do metabolismo de carboidratos.

2 ATP4– O–

O

gulação é exercida em enzimas chaves será enfatizado ao longo do capítulo. Isto será particularmente verdadeiro para síntese (glicogênese) e degradação (glicogenólise) de glicogênio. Muitas células armazenam glicogênio para suas próprias necessidades futuras. O fígado é menos egoísta, armazenando glicogênio principalmente para manutenção da glicose sangüínea, para garantir que outros tecidos, em especial o cérebro, tenham um suprimento adequado. Regulação da síntese e da degradação de glicogênio é um modelo para nosso entendimento de como hormônios funcionam e como vias metabólicas são reguladas. Estes tópicos contribuem para nosso entendimento da condição diabética, do jejum e de como os tecidos do corpo respondem a estresse, trauma severo e lesões. A química e a nomenclatura dos carboidratos são apresentadas no Apêndice.

15.2 | GLICÓLISE Glicólise Ocorre em Todas as Células Humanas A via de Embden-Meyerhof ou via glicolítica representa um processo antigo, que ocorre em todas as células do corpo humano, pelo qual ocorre degradação anaeróbica de glicose em lactato, com liberação de energia como ATP. Este é um exemplo da fermentação anaeróbica, um termo usado para vias metabólicas que organismos usam para extrair energia química de combustíveis ricos em energia, em ausência de oxigênio. Para muitos tecidos, glicólise é só uma via fornecedora de energia de emergência, capaz de produzir 2 moles de ATP a partir de 1 mol de glicose, em ausência de oxigênio (Figura 15.2). Quando o suprimento de oxigênio de um tecido é interrompido, os níveis de ATP ainda podem ser mantidos pela glicólise, pelo menos por um curto período. Muitos exemplos poderiam ser dados, mas a capacidade de utilizar glicólise como uma fonte de energia é particularmente importante durante o nascimento natural de seres humanos. Com exceção do cérebro, a circulação do sangue diminui para a maioria das partes do corpo do bebê, durante o parto. Normalmente, o cérebro não é privado de oxigênio durante o parto, mas outros tecidos passam a depender da glicóli-

BioQ.15 574

C 2

HO

C

H

CH3 L-Lactato

FIGURA 15.2 Equação geral balanceada da soma das reações da glicólise.

se para seu suprimento de ATP, até que um suprimento normal de oxigênio esteja disponível. Isto economiza oxigênio para ser usado pelo cérebro, ilustrando um dos muitos mecanismos que evoluíram para assegurar a sobrevivência do tecido cerebral em momentos de estresse. Oxigênio não é necessário para glicólise; de fato, oxigênio pode, indiretamente, suprimir glicólise pelo efeito Pasteur, que será considerado mais tarde (p. 589). Contudo, glicólise ocorre em células com um suprimento abundante de oxigênio molecular. Desde que as células também contenham mitocôndrias, o produto final da glicólise em presença de oxigênio é piruvato, e não lactato. Piruvato é, então, completamente oxidado a CO2 e H2O pelo complexo piruvato desidrogenase e enzimas do ciclo TCA alojadas dentro de mitocôndrias (Figura 15.3). Glicólise, portanto, prepara para a oxidação aeróbica dos carboidratos. O processo completo de glicólise e oxidação mitocondrial do piruvato a CO2 e H2O tem a seguinte equação: D-Glicose(C6H12O6) + 6 O2 + 32 ADP3- + 32 Pi 2- + + 32 H+ → 6 CO2 + 6 H2O + 32 ATP4 Muito mais ATP é produzido na oxidação completa da glicose a CO2 e H2O (32 ATP/glicose) do que na conversão de glicose em lactato (2 ATP/glicose). Isto tem importantes conseqüências a serem consideradas em detalhes mais adiante. A importância da glicólise como uma via preparatória é melhor exemplificada pelo cérebro, que tem uma necessidade absoluta de glicose. O piruvato processado pela glicólise é oxidado a CO2 em mitocôndrias. Um cérebro humano adulto usa aproximadamente 120 g de glicose por dia para suprir sua necessidade de ATP. Em contraste, glicólise com lactato como produto final é o principal mecanismo de produção de ATP em alguns outros tecidos. Glóbulos vermelhos não têm mitocôndrias e, portanto, são incapazes de converter piruvato em CO2. A córnea, o cristalino e regiões da retina

22.01.07 18:00:33

CAPÍTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE

ína enzima glucoquinase no fígado. Portanto, uma pessoa que está consumindo uma refeição grande e rica em carboidratos terá maiores quantidades de glucoquinase do que uma que não está. O fígado com glucoquinase induzida contribui mais para baixar os níveis elevados de glicose no sangue. A ausência de insulina torna o fígado de pacientes com diabetes mellitus deficiente em glucoquinase, a despeito dos altos níveis de glicose sangüínea, e diminui a capacidade de o fígado “tamponar” a glicose sangüínea (ver Corr. Clín. 15.4). Defeitos no gene que codifica glucoquinase, que alteram sua S0,5 e/ ou Vmax causam diabetes do jovem com início na maturidade (MODY, maturity-onset diabetes of the young), uma forma de diabetes mellitus tipo 2.

6-Fosfofruto-1-quinase É uma Enzima Regulatória da Glicólise 6-Fosfofruto-1-quinase seja um ponto regulatório muito importante da glicólise. Catalisa a primeira etapa de comprometimento da glicólise porque a reação catalisada pela fosfoglicose isomerase é reversível, e células fazem uso de glicose 6-fosfato na via das pentoses fosfato e para síntese de glicogênio. Citrato, ATP e íons hidrogênio (baixo pH) são os efetores alostéricos negativos importantes, enquanto AMP e frutose 2,6-bisfosfato são importantes efetores alostéricos positivos (Figura 15.13). Estes compostos sinalizam a necessidade de diferentes velocidades da glicólise em resposta a mudanças em (a) estado energético da célula (ATP e AMP), (b) ambiente interno da célula (íons hidrogênio), (c) disponibilidade de combustíveis alternativos, como ácidos graxos e corpos cetônicos (citrato), e (d) razão insulina/glucagon no sangue (frutose 2,6-bisfosfato).

Regulação da 6-Fosfofruto-1-quinase por ATP e AMP O efeito Pasteur é a inibição da utilização de glicose e o acúmulo de lactato que ocorre quando respiração (consumo de oxigênio) é iniciada em células anaeróbicas. É perfeitamente compreensível em bases termodinâmicas, uma vez que a oxidação completa da glicose a CO2 e H2O rende muito mais ATP do que glicólise anaeróbica: Glicólise: D-Glicose + 2 ADP3– + 2 Pi 2 – → 2 L-lactato – + 2 ATP4– Oxidação completa: D-Glicose + 6 O2 + 32 ADP3- + 32 Pi 2 – + 32 H+ → → 6 CO2 + 6 H2O + 32 ATP4– Células usam ATP para fornecer a energia necessária a seus processos de trabalho inerentes. Como muito mais ATP é produzido a partir de glicose em presença de oxigênio, muito menos glicose precisa ser consumida para satisfazer a demanda de energia. O efeito Pasteur

BioQ.15 589

|

589

CORRELAÇÃO CLÍNICA 15.4

Diabetes Mellitus Diabetes mellitus é uma doença crônica que se caracteriza por alterações no metabolismo de carboidratos, lipídeos e proteínas. Dois tipos principais são identificados clinicamente: tipo 1 (ver Corr. Clín. 22.8, p. 857) e tipo 2 (ver Corr. Clín. 22.7, p. 855). Em pacientes sem hiperglicemia em jejum, o teste de tolerância à glicose por via oral pode ser usado para diagnóstico. Consiste na determinação do nível de glicose sangüínea no estado de jejum e em intervalos de 30-60 min., por 2 h ou mais, após consumo de sobrecarga de 100 g de glicose. Em indivíduos normais, glicose sangüínea retorna aos níveis normais em 2 h após ingestão do carboidrato. No diabetes, glicose no sangue atinge um nível mais elevado e permanece elevada por períodos de tempo mais longos, dependendo da gravidade da doença. Entretanto, muitos fatores podem contribuir para um teste de tolerância a glicose anormal. O paciente deve ter consumido uma dieta rica em carboidratos nos 3 dias anteriores, presumivelmente para permitir indução de enzimas das vias de utilização de glicose, por exemplo, glucoquinase, acil graxo sintase e acetil-CoA carboxilase. Quase todas as infecções (até mesmo um resfriado) e “estresse” menos definido (presumivelmente por efeitos sobre o sistema nervoso simpático) podem resultar em anormalidades transitórias no teste de tolerância à glicose. Devido a esses problemas, hiperglicemia de jejum seria, provavelmente, o teste sine qua non para o diagnóstico de diabetes. Captação de glicose por tecidos sensíveis a insulina – isto é, múscular e adiposo – é diminuída no estado diabético. O paciente diabético ou não tem insulina ou desenvolveu “resistência à insulina” nestes tecidos. Resistência à insulina resulta de anomalia no receptor de insulina ou em etapas subseqüentes, mediadoras dos efeitos metabólicos da insulina. Células do parênquima hepático não requerem insulina para captar glicose. Sem insulina, contudo, o fígado tem capacidade diminuída para remover glicose do sangue. Isto é explicado, em parte, por atividade diminuída de glucoquinase e a perda de ação da insulina sobre enzimaschaves da glicogênese e da via glicolítica.

Fonte: Taylor, S. I. Insulin action, insulin resistance and type 2 diabetes mellitus. Em: C. R. Scriver, A. L. Beaudet, W. S. Sly e D. Valle (Eds.), The Metabolic and Molecular Bases of Inherited Disease, 8th ed., New York: McGraw-Hill, 2001, p. 1433.

22.01.07 18:00:57

CAPÍTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABÓLICAS E SEU CONTROLE

|

15.6 GLICOGENÓLISE E GLICOGÊNESE

FIGURA 15.46 Micrografia eletrônica mostrando grânulos de glicogênio (material corado escuro) no fígado de um rato alimentado. Micrografia generosamente cedida por Dr. Robert R. Cardell do Department of Anatomy da University of Cincinnati.

BioQ.15 609

CH2OH

O

O

O

609

O

O

Glicogênio É a Forma de Armazenamento de Glicose Glicogenólise refere-se à quebra de glicogênio em glicose ou glicose 6-fosfato; glicogênese refere-se à síntese de glicogênio. Estes processos ocorrem em quase todos os tecidos, mas especialmente em músculo e fígado. No homem bem alimentado, o conteúdo de glicogênio no fígado pode responder por até 10% do peso úmido desse órgão. Músculo armazena menos glicogênio, quando expresso nas mesmas bases – um máximo de apenas 1-2% do seu peso úmido. Contudo, a maioria das pessoas tem mais músculos do que fígado, com o total do glicogênio muscular chegando ao dobro da quantidade de glicogênio hepático. Grânulos de glicogênio são abundantes no fígado de animais bem alimentados (Figura 15.46), mas estão virtualmente ausentes deste órgão após 24 h de jejum. Exercício pesado causa a mesma perda de grânulos de glicogênio em fibras musculares. Esses grânulos são grupos de moléculas individuais de glicogênio que têm uma massa de até 2  107 Da. Glicogênio é composto de resíduos glucosil, ligados principalmente por ligações glicosídicas α-1,4 (Figura 15.47). Ramificações surgem de ligações α-1,6 freqüentes. Um braço da

CH2OH

|

Ligação glicosídica �-1,4

��� CH2OH O O

O CH2 O O

O

Ligação glicosídica �-1,6

��� FIGURA 15.47 Dois tipos de ligações entre as moléculas de glicose estão presentes no glicogênio.

“árvore” do glicogênio (ver Figura 15.48) é caracterizado por ramos a cada quatro resíduos glucosil no esqueleto (core) mais central da molécula, e muito menos freqüentemente em regiões mais externas. Glicogênio contrasta com proteínas e ácidos nucléicos, devido a essa ramificação, mas, é claro, é uma forma de armazenamento de combustível e não catalisa reações nem contém informação em uma célula. Glicogênio é estocado em músculo e fígado por razões bem diferentes. Glicogênio do músculo é uma reserva de combustível para a produção de ATP dentro daquele tecido, enquanto glicogênio hepático é uma reserva de glicose para a manutenção das concentrações de glicose no sangue. Os níveis de glicogênio hepático variam: são altos logo após uma refeição e, depois, diminuem lentamente à medida que é usado para ajudar a manter o nível de glicose no sangue (ver Figura 15.49) entre refeições e durante o jejum noturno. No homem como no rato, o

FIGURA 15.48 Estrutura ramificada do glicogênio

22.01.07 18:01:40

626

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE COO– H

CH2OH

O

H OH

–O SO 3

H

O

H

OH

H

O

H

H

H

H

O–

H

HNCOCH3

Unidade repetitiva do condroitim 4-sulfato

16

METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS Nancy B. Schwartz 16.1 VISÃO GERAL, 627 16.2 VIA DAS PENTOSES FOSFATO, 627 Via das pentoses fosfato tem duas fases, 627 Glicose 6-fosfato é oxidada e descarboxilada em uma pentose fosfato, 627 Interconversões de pentoses fosfato levam a intermediários glicolíticos, 628 Glicose 6-fosfato pode ser completamente oxidada a CO2, 628 Via das pentoses fosfato produz NADPH, 630 16.3 INTERCONVERSÕES DE AÇÚCARES E FORMAÇÃO DE NUCLEOTÍDEOS-AÇÚCAR, 631 Isomerização e fosforilação são reações comuns para interconverter carboidratos, 631 Açúcares ligados a nucleotídeos são intermediários em muitas transformações de açúcares, 633 Epimerização interconverte glicose e galactose, 633 Ácido glucurônico é formado por oxidação de UDP-glicose, 634 Descarboxilação, óxido-redução e transaminação de açúcares geram produtos necessários, 635 Ácidos siálicos são derivados de N-acetilglucosamina, 637

16.5 GLICOPROTEÍNAS, 638 Glicoproteínas contêm quantidades variáveis de carboidratos, 639 Carboidratos são ligados Covalentemente a glicoproteínas por ligações N- ou O-glicosídicas, 639 Síntese de glicoproteínas N-ligadas envolve dolicol fosfato, 640 16.6 PROTEOGLICANOS, 642 Existem seis classes de proteoglicanos, 642 Hialuronato é um copolímero de N-acetilglucosamina e ácido glucurônico, 642 Condroitim sulfatos são os glicosaminoglicanos mais abundantes, 642 Dermatam sulfato contém ácido L-idurônico, 643 Heparina e heparam sulfato diferem dos outros glicosaminoglicanos, 643 Queratam sulfato existe em duas formas, 643 Biossíntese de condroitim sulfato é típica da formação de glicosaminoglicanos, 643 BIBLIOGRAFIA, 647 QUESTÕES E RESPOSTAS, 647

16.4 BIOSSÍNTESE DE CARBOIDRATOS COMPLEXOS, 637

BioQ.16 626

22.01.07 18:09:26

CAPÍTULO 16 METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS ATP Glicose

(6) NADP+

ADP

(6) NADPH + (6) H+

(6) Glicose 6-fosfato

|

631

H2O

6-Fosfoglucono-lactona

6-Fosfogluconato (6) NADP+ (6) NADPH + (6)H+

(6) CO2

(6) Ribulose 5-fosfato

(2) Ribose 5-fosfato

(4) Xilulose 5-fosfato

(2) Frutose 6-fosfato +

(2) Gliceraldeído 3-fosfato

+

(2) Sedo-heptulose 7-fosfato

Gliceraldeído 3-fosfato

(2) Eritrose 4-fosfato + (2) Frutose 6-fosfato

FIGURA 16.3 Via das pentoses fosfato.

des, requerem equivalentes de redução de NADPH. No fígado, 20-30% do CO2 produzido pode ser proveniente da via das pentoses fosfato; o equilíbrio entre glicólise e via das pentoses fosfato depende das necessidades metabólicas do órgão. Em músculo estriado de mamíferos, que apresenta pouca síntese de ácidos graxos e esteróides, todo catabolismo de G6P ocorre por glicólise e ciclo TCA, com nenhuma oxidação direta de glicose 6-fosfato pela via das pentoses fosfato.

|

16.3 INTERCONVERSÕES DE AÇÚCARES E FORMAÇÃO DE NUCLEOTÍDEO-AÇÚCAR A maioria dos monossacarídeos encontrados em compostos biológicos deriva da glicose. As transformações dos açúcares mais comuns em sistemas de mamíferos são resumidas na Figura 16.4.

BioQ.16 631

Isomerização e Fosforilação são Reações Comuns para Interconverter Carboidratos Formação de alguns açúcares pode ocorrer diretamente, começando com glicose, por reações de modificações, como conversão de G6P em frutose 6-fosfato por fosfoglucose isomerase, na glicólise. Uma isomerização aldose-cetose semelhante, catalisada por fosfomanose isomerase, produz manose 6-fosfato. Deficiência dessa enzima leva a uma forma de síndrome de glicoproteínas deficientes em carboidratos (CDGS, carbohydrate-deficient glycoprotein syndrome) (ver Corr. Clín. 16.3). Fosforilação e transferência interna de um grupo fosfato na mesma molécula de açúcar são também modificações comuns. Glicose 1-fosfato, resultante da glicogenólise, é convertida em G6P pela fosfoglucomutase. Galactose é fosforilada a galactose 1-fosfato por galactoquinase, e manose a manose 6-fosfato por manoquinase. Frutose livre, um importante constituinte da dieta, é fosforilada no fígado a frutose 1-fosfato, por uma frutoquinase especial. Entretanto, nenhuma mutase interconverte frutose 1-fosfato e frutose 6-fosfato, nem a fosfofrutoquinase pode sintetizar frutose 1,6-bisfosfato a partir de frutose 1-fosfato. Em vez disso, frutose 1-fos-

22.01.07 18:09:30

638

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

redutora de um açúcar aceptor. Uma glicosiltransferase é específica para o açúcar aceptor, o açúcar transferido e a ligação formada. Uma reação de glicosiltransferase é resumida como se segue: Nucleosídeoglicosiltransferase glicosil1 −  difosfato- + glicose    O − glicose2 − (aceptor) glicose (doador)

(glicosídeo)

+ nucleosídeo difosfato

CORRELAÇÃO CLÍNICA 16.8

Substâncias dos Grupos Sangüíneos A superfície dos eritrócitos humanos é coberta por um complexo mosaico de determinantes antigênicos específicos, muitos dos quais são polissacarídeos complexos. Há cerca de 100 determinantes de grupos sangüíneos, pertencentes a 21 sistemas de grupos sangüíneos independentes. Os mais estudados são os do sistema ABO de grupos sangüíneos e do sistema Lewis, estreitamente relacionado. Variação genética é alcançada por glicosiltransferases específicas, responsáveis pela síntese dos determinantes heterossacarídicos. O gene H codifica uma fucosiltransferase, que adiciona fucose a uma galactose periférica do heterossacarídeo precursor. O alelo A codifica uma N-acetilgalactosamina glicosiltransferase, o alelo B codifica uma galactosiltransferase, e o alelo O codifica uma proteína inativa. Os açúcares transferidos pelas enzimas A e B são adicionados ao oligossacarídeo H-específico. O gene Lewis (Le) codifica outra fucosiltransferase, que adiciona fucose a um resíduo periférico de N-acetilglucosamina do precursor. Ausência do produto do gene H dá origem ao determinante Lea específico, enquanto ausência de ambas as enzimas H e Le é responsável pela especificidade Leb. Elucidação das estruturas desses oligossacarídeos determinantes representa um marco na química de carboidratos. Este conhecimento é essencial para práticas de transfusão de sangue e para propósitos legais e históricos. Por exemplo, pó de tecidos contendo carboidratos complexos foi utilizado em análises sorológicas para estabelecer o grupo sangüíneo de Tutankhamen e de seus prováveis ancestrais.

Mais de 40 tipos de ligações glicosídicas foram identificados em oligossacarídeos de mamíferos, e cerca de 15 mais em glicosaminoglicanos. A multiplicidade de ligações surge da diversidade de monossacarídeos envolvidos e da formação de ligações α e β com cada um dos grupos hidroxila disponíveis no açúcar aceptor. Isso sugere que oligossacarídeos tenham o potencial para grande conteúdo informacional. De fato, sabe-se que a bioatividade de muitas moléculas é determinada pela natureza dos resíduos de açúcares constituintes. Por exemplo, a especificidade antigênica dos principais tipos sangüíneos é determinada pela composição em açúcares (ver Corr. Clín. 16.8). N-acetilgalactosamina é o imunodeterminante do sangue tipo A, e galactose, do sangue tipo B. Remoção de N-acetilgalactosamina de eritrócitos do tipo A, ou de galactose de eritrócitos do tipo B, converte ambos em eritrócitos do tipo O. Cada vez mais, outros exemplos de açúcares como determinantes de especificidade de receptores de superfície celular e interações com lectinas, do direcionamento de células para certos tecidos e da sobrevivência ou remoção da circulação de certas moléculas, têm sido reconhecidos. Todas as ligações glicosídicas identificadas em compostos biológicos são degradadas por enzimas hidrolíticas específicas, glicosidases. Além de serem instrumentos valiosos para a elucidação da estrutura de oligossacarídeos, o interesse nessa classe de enzimas baseiase nas muitas doenças genéticas do metabolismo de carboidratos complexos que resultam de defeitos em glicosidases (ver Corr. Clín. 16.10 e 16.11; p. 641 e 642, respectivamente).

16.5 | GLICOPROTEÍNAS Glicoproteínas foram definidas como proteínas conjugadas, que contêm um ou mais açúcares, sem uma unidade repetitiva serial, e são ligados covalentemente a uma proteína. Esta definição exclui os proteoglicanos (ver p. 652). Glicoproteínas em membranas celulares podem ter um papel importante no comportamento de células e, especialmente, em funções biológicas da membrana. Glicoproteínas são constituintes do muco secretado por certas células epiteliais, onde medeiam lubrificação e proteção de tecidos que revestem os sistemas respiratório, gastrointestinal e reprodutor feminino. Muitas proteínas secretadas são glicoproteínas, e estas incluem (a) hormônios como hormônio folículoestimulante, hormônio luteinizante e gonadotrofina coriônica e (b) proteínas plasmáticas como orosomucóides, ceruloplasmina, plasminogênio, protrombina e imunoglobulinas.

Fonte: Yamamoto, F., Clausen, I., White, T., Mark, J. e Hakomori, S. Molecular genetic basis of the histoblood group ABO system. Nature 345:229, 1990.

BioQ.16 638

22.01.07 18:09:38

642

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

CORRELAÇÃO CLÍNICA 16.11

Doenças de Glicolipídeos Um grupo de doenças genéticas humanas surge de deficiências em hidrolases, que agem predominantemente em substratos glicolipídicos, resultando em acúmulo de produtos de glicolipídeos e gangliosídeos. Os sintomas clínicos associados a cada um dos glicoconjugados podem variar muito. Entretanto, devido à preponderância de lipídeos no sistema nervoso, tais doenças freqüentemente têm neurodegeneração associada e severa deterioração mental e motora.

Defeitos Enzimáticos na Degradação de Glicolipídeos Doença

Deficiência Enzimática

Tay-Sachs de Sandhoff GM1 gangliosidose Sialidose de Fabry de Gaucher de Krabbe Leucodistrofia metacromática

β-Hexosaminidase A β-Hexosaminidases A e B β-Galactosidase Sialidase α-Galactosidase β-Glucoceramidase β-Galactoceramidase Arilsulfatase A (cerebrosídeo sulfatase)

Fonte: Beutler, E. e G. Garabowski. Gaucher disease. Em: C. R. Scriver, A. R. Beaudet, W. S. Sly e D. Valle (Eds.), The Metabolic and Molecular Bases of Inherited Disease, Vol. III, 8th ed. New York: McGraw-Hill, 2001, p. 3635.

16.6 | PROTEOGLICANOS

das matrizes extracelulares e das superfícies celulares, e participam de adesão e sinalização celular.

Esta é uma classe de macromoléculas complexas que pode conter 95% ou mais carboidratos, e lembra mais polissacarídeo do que proteína. Para distingui-los de outras glicoproteínas, eles são chamados proteoglicanos. Suas cadeias de carboidratos são chamadas glicosaminoglicanos ou mucopolissacarídeos, especialmente em referência às doenças de acúmulo mucopolissacaridoses, que resultam de uma incapacidade de degradar essas moléculas (ver Corr. Clín. 16.13).

Hialuronato É um Copolímero de N-Acetilglucosamina e Ácido Glucurônico

Existem Seis Classes de Proteoglicanos Proteoglicanos consistem de muitas cadeias de glicosaminoglicanos diferentes, ligadas covalentemente a um esqueleto protéico. Seis classes são reconhecidas: condroitim sulfato, dermatam sulfato, queratam sulfato, heparam sulfato, heparina e hialuronato. Certas características são comuns a todas as diferentes classes de glicosaminoglicanos. As longas cadeias heteropolissacarídicas não-ramificadas são compostas, em grande parte, por unidades dissacarídicas repetitivas, consistindo de uma hexosamina e um ácido urônico. Constituintes comuns dos glicosaminoglicanos são grupos sulfatos, ligados por ligações éster a certos monossacarídeos, ou por ligações amida ao grupo amino de glucosamina. Só hialuronato não é sulfatado e não é covalentemente ligado a proteína. As carboxilas dos ácidos urônicos e os grupos sulfatos contribuem para a natureza fortemente carregada dos glicosaminoglicanos. Sua carga elétrica e sua estrutura macromolecular são importantes em seu papel como lubrificantes e como elementos de sustentação no tecido conjuntivo. Glicosaminoglicanos são componentes predominantes

BioQ.16 642

Hialuronato difere dos outros tipos de glicosaminoglicanos. É não-sulfatado, não é ligado covalentemente a proteína, e não está limitado a tecidos animais, sendo também produzido por bactérias. É classificado como glicosaminoglicano devido a sua similaridade estrutural com esses polímeros, e consiste exclusivamente de unidades dissacarídicas repetitivas de N-acetilglucosamina e ácido glucurônico (Figura 16.12). Embora tenha a estrutura química menos complexa dos glicosaminoglicanos, as cadeias podem alcançar 105 -107 Da. A alta massa, o caráter polieletrolítico e o grande volume que ocupa em solução contribuem para as propriedades do hialuronato como um lubrificante e absorvente de choques. É encontrado predominantemente em líquido sinovial, humor vítreo e cordão umbilical.

Condroitim Sulfatos São os Glicosaminoglicanos Mais Abundantes Os glicosaminoglicanos mais abundantes do corpo, os condroitim sulfatos, são ligados a resíduos específicos de serina em um esqueleto protéico por meio de uma região de ligação tetrassacarídica: GluUA

1�3

Gal

1�3

Gla

1�4

Xyl

�-Ser

As unidades dissacarídicas características consistem de N-acetilgalactosamina e ácido glucurônico, que são ligadas a essa região de ligação (Figura 16.12). Os dissacarídeos podem ser sulfatados na posição 4- ou 6- da N-acetilgalactosamina. Cada cadeia contém 30-

22.01.07 18:09:43

650

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE Fígado Ácidos graxos Acetil-CoA Corpos cetônicos

Glicose �������������� Glicerol

17

METABOLISMO DE LIPÍDEOS I: SÍNTESE, ARMAZENAMENTO E UTILIZAÇÃO DE ÁCIDOS GRAXOS E TRIACILGLICERÓIS Martin D. Snider, J. Denis McGarry e Richard W. Hanson 17.1 VISÃO GERAL, 651 17.2 NATUREZA QUÍMICA DE ÁCIDOS GRAXOS E ACILGLICERÓIS, 652 Ácidos graxos são cadeias alquila terminando em um grupo carboxila, 652 A maioria dos ácidos graxos no homem ocorre como triacilgliceróis, 653 A hidrofobicidade dos triacilgliceróis é importante para suas funções, 653 17.3 TRANSPORTE INTERÓRGÃOS DE ÁCIDOS GRAXOS E SEUS PRODUTOS PRIMÁRIOS, 656 Transporte de lipídeos no estado alimentado, 656 Transporte de lipídeos no estado de jejum, 657 17.4 SÍNTESE DE ÁCIDOS GRAXOS: LIPOGÊNESE, 657 Glicose é o principal precursor para síntese de ácidos graxos, 657 Via de biossíntese de ácidos graxos, 658 Formação de malonil-CoA é a etapa de com-

BioQ.17 650

prometimento na síntese de ácidos graxos, 658 Seqüência de reações para a síntese de ácido palmítico, 658 Ácido graxo sintase de mamíferos é um polipeptídeo multifuncional, 659 Estequiometria da síntese de ácidos graxos, 659 Via de clivagem de citrato fornece acetil-CoA e NADPH para lipogênese no citosol, 660 Modificação de ácidos graxos, 662 Reações de elongação, 662 Formação de ácidos monoenóicos pela estearoil-CoA dessaturase, 662 Formação e modificação de ácidos graxos poliinsaturados, 663 Formação de hidroxiácidos graxos no tecido nervoso, 664 Ácido graxo sintase pode produzir outros ácidos graxos além do palmitato, 664 Acil graxo-CoAs podem ser reduzidos a álcoois graxos, 664

22.01.07 18:11:45

656

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

|

17.3 TRANSPORTE INTERÓRGÃOS DE ÁCIDOS GRAXOS E SEUS PRODUTOS PRIMÁRIOS Em todos os mamíferos, o transporte e o armazenamento de ácidos graxos são regulados pelo estado dietético. Triacilglicerol é armazenado no estado alimentado, com deposição em tecido adiposo. Durante jejum, triacilglicerol do tecido adiposo é hidrolisado, e os produtos são distribuídos por todo o corpo para serem usados para produção de energia. Em jejum prolongado (mais de 2 dias), o fígado converte ��cidos graxos em corpos cetônicos, acetoacetato e β-hidroxibutirato, que são liberados no sangue e são uma fonte importante de energia para muitos tecidos. Esses processos são resumidos na Figura 17.6

���

Estado alimentado

Transporte de Lipídeos no Estado Alimentado Triacilgliceróis da dieta são digeridos no estômago e intestino delgado por lípases gástrica e pancreática (ver p. 1031). Os principais produtos são 2-monoacilgliceróis e ácidos graxos livres, que são absorvidos pelas células epiteliais que revestem o intestino delgado. Estas células ligam os ácidos graxos e monoacilgliceróis absorvidos em triacilgliceróis (ver p. 1031), que são então empacotados em quilomícrons, uma lipoproteína plasmática rica em triacilglicerol (ver p. 1035). Quilomícrons são secretados na linfa e, depois, circulam para a corrente sangüínea. O fígado é outra fonte de triacilgliceróis no estado alimentado. Ácidos graxos são sintetizados nesse tecido a partir do excesso de carboidratos e aminoácidos. Esses ácidos graxos são ligados em triacilgliceróis e acondicionados em lipoproteínas de muito baixa densidade (VLDL), uma segunda li-

Glicose e outros combustíveis

Fígado

Acetil-CoA Intestino delgado

Ácidos graxos Triacilglicerol

Triacilglicerol da dieta Quilomícrons

Corrente sangüínea

Lipoproteínas de densidade muito baixa

Triacilglicerol em quilomícrons e lipoproteínas de densidade muito baixa

FIGURA 17.6 Transporte interórgãos de ácidos graxos. (A) No estado alimentado, há deposição de triacilglicerol no tecido adiposo. As fontes são gordura da dieta e ácidos graxos sintetizados no fígado a partir de excesso de carboidratos e aminoácidos. (B) No estado de jejum, triacilgliceróis são hidrolisados, e ácidos graxos livres e glicerol são liberados no sangue. *Durante jejum prolongado, o fígado sintetiza corpos cetônicos, que se tornam um importante combustível no sangue.

Ácidos graxos

Ácidos graxos ����������������������� �����������

Triacilglicero l

Músculo Tecido adiposo

��� Estado de jejum Fígado

Cérebro Corpos cetônicos Acetil-CoA �������������������� ������������������

Corrente sangüínea

Corpos Ácidos graxos = albumina ceetônicos

Ácidos graxos (+ corpos cetônicos) ���������������������� ����������� Músculo e outros tecidos

BioQ.17 656

Ácido graxo Glicose ������������ �������������� Acetil-CoA ����������� Glicerol ����������� Corpos cetônicos

Glicerol Glicerol + Ácidos graxos Triacilglicerol

Tecido adiposo

22.01.07 18:11:51

668

|

PARTE 4 VIA METABÓLICAS E SEU CONTROLE

CORRELAÇÃO CLÍNICA 17.3

Ciclo Triacilglicerol/Ácido Graxo Triacilglicerol que é armazenado no tecido adiposo é hidrolisado a ácidos graxos livres (FFA) durante jejum para fornecer energia para tecidos como os músculos esquelético e cardíaco, e também indiretamente para o cérebro, via corpos cetônicos. Hormônios, principalmente insulina, controlam este processo. À medida que o nível de insulina cai durante o jejum, a taxa de hidrólise de triacilglicerol (lipólise) aumenta, resultando em liberação de FFA do tecido adiposo. Um aspecto surpreendente deste processo é o destino de FFA; em seres humanos em jejum, até 65% destes FFA são reesterificados em triacilgliceróis no fígado e em outros tecidos periféricos. No fígado, aproximadamente 60% do FFA captado é reesterificado em triacilglicerol, liberado no sangue como VLDL, e enviado de volta para o tecido adiposo para deposição como triacilglicerol. Este processo foi chamado ciclo triacilglicerol/ácido graxo. A síntese de triacilglicerol em tecidos de mamíferos requer glicerol 3-fosfato, que é derivado da glicose da dieta via glicólise, no estado alimentado. Durante jejum, quando insulina baixa inibe a utilização de glicose, o glicerol 3-fosfato para a reesterificação de FFA é gerado por gliceroneogênese, uma versão abreviada da gluconeogênese. Nesta via, piruvato, ou compostos que podem gerar piruvato, como alanina ou lactato, é convertido em glicerol 3fosfato via di-hidroxiacetona fosfato (Figura 17.19). A enzima que controla a velocidade da via de gliceroneogênese é fosfoenolpiruvato carboxiquinase

(PEPCK), que tem alta atividade em tecido adiposo pardo e branco. Se a expressão do gene PEPCK for abolida no tecido adiposo de camundongos, gliceroneogênese é inibida e o estoque de triacilglicerol é reduzido. Ao contrário, superprodução do gene PEPCK no tecido adiposo de camundongos transgênicos aumenta a taxa de gliceroneogênese, resultando em obesidade. A lógica metabólica do ciclo triacilglicerol/ácido graxo reside provavelmente na importância dos ácidos graxos como combustíveis durante jejum. Para garantir que exista FFA suficiente no sangue, mais FFA é liberado de células adiposas do que o necessário; o que não é usado é reesterificado a triacilglicerol e redepositado no tecido adiposo, com um custo energético mínimo. O ciclo triacilglicerol/ácido graxo consome 3-6% da energia em uma molécula de triacilglicerol. Aparentemente, é melhor ter o combustível necessário disponível, e pagar por isso energeticamente, do que ficar sem! A taxa de reesterificação de FFA no ciclo triacilglicerol/ácido graxo é, muito provavelmente, um fator-chave na determinação da concentração de estado estacionário de FFA no sangue, um parâmetro que está diretamente envolvido na etiologia do diabetes Tipo 2. As glitazonas, uma classe de drogas antidiabéticas, induzem a atividade de PEPCK em tecido adiposo e fígado, e aumentam a taxa de reesterificação de FFA em triacilglicerol via gliceroneogênese nesses tecidos, suportando o importante papel deste processo na manutenção da homeostase lipídica.

Fonte: Reshef, L. Olswang, Y. Cassuto, H. Blum, B. Croniger, C. M. Kalhan S. C, Tilghman, S. M. e Hanson R. W. Glyceroneogenesis and the triglyceride/fatty acid cycle. J. Biol. Chem. 278:30413, 2003. Jensen, M. D., Ekberg, K. e Landau, B. R. Lipid metabolism during fasting. Am. J. Physiol. Endocrinol. Metab. 281:E789 2001. Tordjman, J. Khazan, W. Antoine, B. Chauvet, G. Quette, J Fouque, F. Beale, E. G. Benelli, C. e Forest, C. Regulation of glyceroneogenesis and phosphoenolpyruvate carboxykinase by fatty acids, retinoic acid and thiazolidinediones. Biochimie 85:1213, 2003. repouso. A maioria dos tecidos pode usar ácidos graxos como combustível. Ácidos graxos são uma importante fonte de energia em músculos esquelético e cardíaco, mas o cérebro oxida pouco os ácidos graxos devido ao transporte limitado através da barreira hemato-encefálica. Eritrócitos são incapazes de oxidar ácidos graxos, porque não têm mitocôndrias, o local de oxidação de ácidos graxos. Durante jejum prolongado, o fígado converte acetil-CoA gerado por oxidação de ácidos graxos e quebra de aminoácidos em corpos cetônicos, que se tornam importantes combustíveis. A maioria dos tecidos, incluindo o cérebro, adapta-se ao jejum pela utilização destes corpos cetônicos.

BioQ.17 668

-Oxidação de Ácidos Graxos de Cadeia Linear É um Importante Processo de Produção de Energia Ésteres de CoA dos ácidos graxos são os substratos para oxidação. Na maior parte, a via de oxidação de ácidos graxos é semelhante, mas não idêntica, ao reverso do processo de síntese de palmitato. Isto é, fragmentos de dois carbonos são removidos seqüencialmente a partir da extremidade carboxila do ácido graxo por desidrogenação, hidratação e oxidação, para formar um βcetoácido, que é então quebrado por tiólise.

22.01.07 18:12:07

CAPÍTULO 17 METABOLISMO DE LIPÍDEOS I:

|

17.7 REGULAÇÃO DO METABOLISMO DE LIPÍDEOS Regulação no estado alimentado O metabolismo de lipídeos no homem é controlado pelo estado dietético do indivíduo via um conjunto complexo de sinais hormonais. Depois de uma refeição que contém lipídeos, carboidratos e proteínas, o lipídeo da dieta é depositado como triacilglicerol no tecido adiposo. Além disso, carboidrato e aminoácidos da dieta, em excesso em relação ao necessário para energia ou síntese de proteínas, são convertidos em ácidos graxos e depositados no tecido adiposo como triacilglicerol. O principal hormônio anabólico, insulina, é necessário para síntese de ácidos graxos e para formação de triacilglicerol no tecido adiposo. Um resumo destas regulações é apresentado nas Tabelas 17.2, p. 657, e 17.3, p. 661. Este hormônio age em dois níveis; induz a transcrição de genes que codificam enzimas críticas das vias de síntese e armazenamento de lipídeos (regulação de longo prazo) e controla processos como captação de glicose e hidrólise de triacilglicerol (regulação de curto prazo). Insulina estimula síntese de ácidos graxos por aumentar os níveis de enzimas-chaves, incluindo ácido graxo sintase, NADP-malato desidrogenase (enzima málica) e acetil-CoA carboxilase, no fígado, por induzir a transcrição de seus genes. Insulina também estimula a síntese de glicose 6-fosfato desidrogenase e 6-fosfogluconato desidrogenase, as duas enzimas da porção oxidativa da via das pentoses, que geram parte do NADPH que é necessário para síntese de ácidos graxos. O efeito de curto prazo da insulina na síntese hepática de ácidos graxos é exercido por ativação de uma fosfoproteína fosfatase específica, que remove fosfato da acetil-CoA carboxilase, ativando assim esta enzima. Fluxo aumentado pela glicólise é também importante para fornecer acetil-CoA para síntese de ácidos graxos. No tecido adiposo, insulina é necessária no estado alimentado para captação de glicose via transportador GLUT 4. O metabolismo desta glicose via glicólise fornece glicerol 3-fosfato para a síntese de triacilglicerol. Insulina também bloqueia um ciclo fútil. Como no fígado, insulina exerce seus efeitos de curto prazo por ativar fosfoproteína fosfatases. Isso diminui a fosforilação de proteínas-chaves, incluindo lipase hormônio-sensível e perilipina, levando à quebra diminuída de triacilgliceróis.

Regulação no estado de jejum Jejum resulta em uma alteração dramática do metabolismo de lipídeos. À medida que a concentração de glicose no sangue diminui, há um decréscimo paralelo da concentração de insulina na circulação. Há também

BioQ.17 679

|

679

um aumento em epinefrina e glucagon, que elevam o nível de cAMP e ativam proteína quinase A. No tecido adiposo, há uma fosforilação aumentada de lipase hormônio sensível e perilipina, resultando em um aumento na quebra de triacilglicerol e liberação de ácidos graxos livres e glicerol deste tecido (ver Tabela 17.2, p. 657, para um resumo destes controles). No fígado, essas alterações hormonais levam a uma diminuição na síntese de ácidos graxos, devido à redução nos níveis de enzimas chaves (ver Tabela 17.3, p. 661). Há também inibição da enzima limitante da velocidade, acetil-CoA carboxilase, devido à fosforilação cAMP-dependente da enzima. Glicólise é também inibida, com diminuição no suprimento de acetil-CoA para lipogênese. O fígado começa a produzir corpos cetônicos, à medida que o jejum progride, devido a um aumento na taxa de oxidação de ácidos graxos e níveis aumentados de enzimas da síntese de corpos cetônicos. Durante jejum prolongado, cerca de metade dos ácidos graxos que entram no fígado são convertidos em corpos cetônicos e liberados no sangue para utilização por tecidos como músculo, coração e (após 2 dias de jejum) o cérebro, economizando assim o uso de glicose.

Regulação da oxidação de ácidos graxos A taxa de oxidação de ácidos graxos em mitocôndrias é controlada pela regulação da entrada de substratos nestas organelas. A enzima-chave é carnitina palmitoiltransferase I (CPT I), que sintetiza acilcarnitina a partir de acil-CoA citosólico (Figura 17.20). No fígado, acetil-CoA carboxilase é ativada no estado alimentado, porque os níveis de enzima são altos, fosforilação cAMP-dependente é baixa e a enzima é ativada por citrato. A alta concentração de malonil-CoA resultante estimula síntese de ácidos graxos, mas bloqueia oxidação de ácidos graxos por inibir CPT I. Esta regulação impede um ciclo fútil. Ao contrário, no estado de jejum, a atividade de acetil-CoA carboxilase no fígado é baixa, porque os níveis de enzima são baixos, a enzima está fosforilada e oxidação de ácidos graxos ocorre em alta velocidade nessas condições, devido aos baixos níveis de malonil-CoA. Oxidação de ácidos graxos em músculo é também regulada por malonil-CoA, embora este tecido não sintetize ácidos graxos. Músculo contém uma isoenzima da acetil-CoA carboxilase, que produz malonil-CoA exclusivamente para regulação de CPT I. A enzima é ativada por citrato e inibida por fosforilação. É fosforilada pela proteína quinase A e por uma quinase dependente de AMP. Fosforilação pela primeira enzima permite que a oxidação de ácidos graxos seja regulada pelo estado dietético. No estado alimentado, a alta concentração de insulina resulta em baixos níveis de fosforilação. A enzima produz malonil-CoA, que inibe CPT I e bloqueia oxidação de ácidos graxos. Ao contrário, no estado de

22.01.07 18:12:19

684

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

18.5 PROSTAGLANDINAS E TROMBOXANES, 714 Prostaglandinas e tromboxanes são derivados de ácidos monocarboxílicos, 714 Síntese de prostaglandinas envolve uma ciclooxigenase, 715 Produção de prostaglandinas é inibida por agentes antiinflamatórios esteroídicos e não-esteroídicos, 717 Prostaglandinas têm muitos efeitos fisiológicos 718 18.6 LIPOXIGENASE E ÁCIDOS OXIEICOSATETRAENÓICOS, 718 Ácidos mono-hidroperoxieicosatetraenóicos são produtos da ação da lipoxigenase, 718

18.1 | VISÃO GERAL Lipídeo é um termo geral que descreve substâncias que são relativamente insolúveis em água e que podem ser extraídas por solventes apolares. Lipídeos complexos do homem estão classificados em duas categorias amplas: lipídeos não-polares, tais como triacilgliceróis e ésteres de colesterol, e lipídeos polares, que são anfipáticos pois contêm tanto uma região hidrofóbica, como uma região hidrofílica na mesma molécula. Este capítulo discute lipídeos polares, incluindo fosfolipídeos, esfingolipídeos e eicosanóides. As regiões hidrofóbicas e hidrofílicas são unidas por um resíduo de glicerol em glicerofosfolipídeos, e por esfingosina em esfingomielina e glicoesfingolipídeos. Triacilglicerol está confinado, em grande parte, a locais de armazenamento no tecido adiposo, enquanto lipídeos polares ocorrem primariamente em membranas celulares. Membranas geralmente contêm 40% do seu peso seco como lipídeo, e 60% como proteína. Reconhecimento célula-célula, fagocitose, inibição por contato e rejeição de tecidos e órgãos transplantados são todos fenômenos de importância médica, que envolvem sítios de reconhecimento muito específicos na superfície das membranas plasmáticas. Glicoesfingolipídeos parecem desempenhar um papel nestes eventos biológicos. Sua síntese será descrita. Vários esfingolipídeos acumulam-se no fígado, no baço, no rim e no sistema nervoso em certas doenças genéticas chamadas esfingolipidoses. Glicolipídeos merecem estudo, porque os determinantes antigênicos dos grupos sangüíneos ABO são primariamente de natureza glicolipídica. A via de biossíntese de colesterol e sua regulação, como colesterol funciona como um precursor de sais biliares e hormônios esteróides, e o papel da lipoproteína de alta densidade (HDL, high density lipoprotein) e da lecitina:colesterol aciltransferase (LCAT) no gerenciamento do colesterol plasmático são descritos. Finalmente, o metabolismo e a função de duas classes

BioQ.18 684

Leucotrienos e ácidos hidroxieicosatetraenóicos são hormônios derivados de HPETEs, 719 Leucotrienos e HETEs afetam vários processos fisiológicos, 719 BIBLIOGRAFIA, 721 QUESTÕES E RESPOSTAS, 722 CORRELAÇÕES CLÍNICAS 18.1 Síndrome do Desconforto Respiratório, 687 18.2 Tratamento da Hipercolesterolemia, 703 18.3 Aterosclerose, 704 18.4 Diagnóstico da Doença de Gaucher em um Adulto, 713 de hormônios farmacologicamente potentes derivados do ácido araquidônico – a saber, prostaglandinas e leucotrienos – serão discutidos. Ver o Apêndice para uma discussão sobre nomenclatura e química dos lipídeos.

18.2 | FOSFOLIPÍDEOS Duas classes principais de acilglicerolipídeos são triacilgliceróis e glicerofosfolipídeos, que têm em seu núcleo o poliol C3 glicerol. Os dois grupos álcool primário do glicerol não são estereoquimicamente idênticos; no caso de fosfolipídeos, geralmente é o mesmo grupo hidroxila que é esterificado ao resíduo de fosfato. O sistema de numeração esteroespecífica é a melhor maneira de designar diferentes grupos hidroxila. Neste sistema, quando a estrutura do glicerol é desenhada na projeção de Fischer, com o grupo hidroxila C2 projetando-se para a esquerda da página, os átomos de carbono são numerados como mostra a Figura 18.1. Quando o sistema de numeração estéreo-específica (sn) é utilizado, o prefixo sn- é usado antes do nome do composto. Glicerofosfolipídeos geralmente contêm um resíduo de sn-glicerol 3-fosfato. Embora ambos contenham o resíduo de glicerol como um elemento estrutural fundamental, triacilgliceróis neutros e fosfolipídeos iônicos carregados têm propriedades físicas e funções muito diferentes.

Número do carbono CH2OH 1 HO

C

H

2

CH2OH

3

FIGURA 18.1 Numeração estéreo-específica do glicerol.

22.01.07 19:25:50

694

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE O

O R1C

CoA

H2COH O

C

O

H2C

CoA 1

O O–

P

H2C

O

CR1

C

O

O

H2C

O

P

R2OH

2

O–

O–

OR2

H2C

R1CO–

O–

O

C

O

O

H 2C

O

P

DHAP

O R3C

H2C H2C

6

O– OR2

CH

O

O OCH2CH2

P

O

NADPH + H+

3

NADP+

+

N(CH3)3

O–

CMP

O–

OR2

H2C

Colina plasmalogênio

HOCH

O

CDP-colina

O–

O R3C

O–

P

O

H 2C H2C O

4

OR2

CH H2C

5

O H C 2

OH Pi

H2O

R3C

H 2C

R3C

OR2

CH

CoA

CoA

O O

O

O–

P O–

FIGURA 18.25 Via de biossíntese de colina plasmalogênio a partir de DHAP. 1, acil-CoA:di-hidroxiacetona fosfato aciltransferase; 2, alquil-di-hidroxiacetona fosfato sintase; 3, NADPH:alquil-di-hidroxiacetona fosfato óxi-redutase; 4, acil-CoA:1-alquil-2-liso-sn-glicero-3-fosfato aciltransferase; 5, 1-alquil-2-acil-sn-glicerol-3-fosfato fosfohidrolase; 6, CDP-colina:1-alquil-2-acil-sn-glicerol colina fosfotransferase.

18.3 | COLESTEROL Colesterol, um Composto Alicíclico, É Amplamente Distribuído nas Formas Livre e Esterificada Colesterol é um composto alicíclico, cuja estrutura inclui (1) o núcleo peridrociclopentanofenantreno com seus quatro anéis fundidos, (2) um único grupo hidroxila em C3, (3) um centro insaturado entre C5 e C6, (4) uma cadeia hidrocarbônica ramificada de oito membros ligada ao anel D em C17 e (5) um grupo metil (designado por C19) ligado à posição C10, e outro grupo metil (designado por C18) ligado à posição C13 (Figuras 18.26 e 18.27). Colesterol tem solubilidade muito baixa em água; a 25oC, o limite de solubilidade é aproximadamente 0,2 mg dL -1, ou 4,7 mM. A concentração real de colesterol no plasma de uma pessoa sadia é geralmente 150 a 200 mg dL -1. Este valor é quase duas vezes a concentração normal de glicose no sangue. Esta alta concentração de colesterol no sangue é possível graças às lipoproteínas plasmáticas (principalmente LDL e VLDL), que contêm grandes quantidades de colesterol (ver p. 698). Apenas cerca de 30% do total de colesterol no plasma está livre

BioQ.18 694

(não-esterificado); o restante é colesteril ésteres, nos quais um ácido graxo de cadeia longa, geralmente ácido linoléico, é esterificado ao C3 do anel A. Este resíduo de ácido graxo aumenta a hidrofobicidade do colesterol (Figura 18.28). 12 11 1 2

10

A 3 4

9

17 16

D

C 14

8

B 5

13

15

7 6

FIGURA 18.26 O anel ciclopentanofenantreno.

21 18

20 17

24

22 23

25

26

27

19

3

HO

FIGURA 18.27 Estrutura do colesterol (5-colesteno-3-ol).

22.01.07 19:26:07

704

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

Em tecidos especializados, como córtex adrenal e ovários, o colesterol derivado de LDL é o precursor de hormônios esteróides, como cortisol e estradiol, respectivamente. No fígado, o colesterol extraído de LDL e HDL é convertido em sais biliares, que funcionam na digestão intestinal de gordura.

Colesterol É Excretado Primariamente como Ácidos Biliares Ácidos biliares são os produtos finais do metabolismo de colesterol. Ácidos biliares primários são sintetizados em hepatócitos, diretamente a partir de colesterol. Os

CORRELAÇÃO CLÍNICA 18.3

Aterosclerose Aterosclerose é a principal causa de morte em países ocidentais industrializados. O risco de desenvolvê-la é diretamente relacionado com a concentração plasmática de LDL-colesterol e inversamente proporcional ao nível de HDL-colesterol. Isso explica por que o primeiro é freqüentemente chamado colesterol “ruim”, e o último, colesterol “bom”, embora quimicamente não exista diferença. Na aterosclerose, a parede arterial contém colesteril-ésteres acumulados em células derivadas da linhagem monócito-macrófago, há também proliferação de células musculares lisas e fibrose. A anomalia mais precoce é migração de monócitos do sangue para o subendotélio da artéria. Estas células então se diferenciam em macrófagos e acumulam colesteril-ésteres derivados de LDL plasmática. Parte da LDL pode ser captada por vias que não requerem receptor de LDL. Por exemplo, existem receptores que captam LDL acetilada ou LDL complexada com dextran sulfato; entretanto, esta via não é regulada por conteúdo celular de colesterol. Distorção do subendotélio leva à agregação plaquetária na superfície do endotélio e liberação de mitógenos derivados de plaquetas, como o fator de crescimento derivado de plaquetas (PDGF, platelet derived growth factor), que estimula o crescimento de células musculares lisas. Morte das células esponjosas leva à deposição do lipídeo celular e fibrose. A placa aterosclerótica resultante estreita o vaso sangüíneo e leva à formação de trombo, o que precipita o infarto do miocárdio (ataque cardíaco). Fonte: Wick, G, Knoflach, M. e Xu, Q. B. Autoimmune and inflammatory mechanisms in atherosclerosis. Annu. Rev. Immunol. 22:361,~2004.

BioQ.18 704

ácidos biliares são derivados de ácido colânico (Figura 18.41). Ácido cólico e ácido quenodesoxicólico (Figura 18.42) são compostos C24, contendo três e dois grupos OH, respectivamente, e uma cadeia lateral C5 que termina em um grupo carboxila, que é ionizado a pH 7,0 (daí o nome sal biliar). O grupo carboxila é freqüentemente conjugado, por uma ligação amida, com glicina (NH2-CH2-COOH) (Figura 18.43) ou taurina (NH2-CH2-CH2-SO3H), para formar ácido glicocólico ou taurocólico, respectivamente. Os ácidos biliares primários são modificados por microorganismos dos intestinos para ácidos biliares secundários: ácido desoxicólico e ácido litocólico são derivados do ácido cólico e do ácido quenodesoxicólico, respectivamente, por remoção de um grupo OH (Figura 18.42). Transformação de colesterol em ácidos biliares requer: (1) epimerização do grupo 3β-OH, (2) redução da dupla ligação C5, (3) introdução de grupos OH em C7 (ácido quenodesoxicólico) ou em C7 e C12 (ácido cólico), e (4) conversão da cadeia lateral C27 em um ácido carboxílico C24 por eliminação de um equivalente propil. Ácidos biliares são secretados na bile, armazenados na vesícula biliar e depois secretados no intestino delgado. Produção hepática de ácidos biliares é insuficiente para atender as necessidades fisiológicas, de modo que o corpo depende de uma circulação êntero-hepática, que carrega os ácidos biliares do intestino, de volta para o fígado, várias vezes por dia. Ácidos biliares e fosfolipídeos solubilizam colesterol na bile e, assim, impedem que colesterol se precipite na vesícula biliar. Ácidos biliares no intestino atuam como agentes emulsificantes para triacilgliceróis da dieta, facilitando sua hidrólise pela lipase pancreática. Ácidos biliares desempenham um papel direto na ativação da lipase pancreática (ver p. 1031) e facilitam a absorção de vitaminas lipossolúveis, particularmente vitamina D, no intestino.

21

H3C 18

19 2 3

1

4

CH2 10

5

H

11 9

6

12

CH3

13 14

22 20 17

23

COOH 16

24

15

8 7

FIGURA 18.41 Estrutura do ácido colânico.

22.01.07 19:26:18

718

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

Prostaglandinas Têm Muitos Efeitos Fisiológicos Prostaglandinas são mediadores naturais da inflamação. Reações inflamatórias freqüentemente envolvem as articulações (p. ex., artrite reumatóide), pele (p. ex., psoríase) e olhos, e são tratadas, freqüentemente, com corticosteróides que inibem síntese de prostaglandinas. Administração de PGE2 e PGE1 induz rubor e calor (devido à vasodilatação arteriolar), juntamente com inchaço e edema resultantes de permeabilidade capilar aumentada característica da inflamação. PGE2 gerada no sistema imune (p. ex., macrófagos, mastócitos, células B) evoca quimiotaxia de células T. PGE2 em quantidades que não causam dor, antes da administração de histamina e bradicinina, aumenta a intensidade e a duração da dor causada por esses dois agentes. Acredita-se que pirógenos (agentes indutores de febre) ativem a via de síntese de prostaglandinas com liberação de PGE2 no hipotálamo, onde a temperatura do corpo é regulada. Aspirina, uma droga antipirética, inibe a ciclooxigenase. PGE2 e PGF2 têm sido utilizadas para induzir parto e para terminar gravidez não-desejada, especificamente no segundo trimestre. Também há evidências de que as prostaglandinas da série PGE possam ser efetivas no tratamento da infertilidade masculina. Prostaglandinas sintéticas são muito eficientes na inibição de secreção ácida gástrica em pacientes com úlcera péptica. Parecem inibir a formação de cAMP em células da mucosa gástrica e acelerar a cicatrização de úlceras gástricas. PGE, PGA e PGI 2 são vasodilatadores que baixam a pressão arterial sistêmica, aumentando assim o fluxo sangüíneo local e diminuindo a resistência periférica. TXA 2 causa contração da musculatura vascular lisa e do mesângio glomerular. No feto, PGE2 mantém a desobstrução do ductus arteriosus antes do nascimento. Se o ductus permanecer aberto após o nascimento, o fechamento pode ser acelerado por administração do inibidor de ciclooxigenase indometacina. Em bebês nascidos com anomalias congênitas, nos quais o defeito pode ser corrigido cirurgicamente, infusão de prostaglandinas manterá o fluxo sangüíneo através do ductus até que a cirurgia seja feita. PGI2 inibe agregação plaquetária, enquanto PGE2 e TXA 2 promovem esse processo de coagulação. TXA 2 é produzido por plaquetas e é responsável por sua agregação quando em contato com alguma superfície estranha, colágeno ou trombina. Células endoteliais que revestem os vasos sangüíneos liberam PGI2, que pode responder pela não-aderência de plaquetas à parede do vaso sangüíneo sadio. PGE2 e PGD2 dilatam os vasos sangüíneos renais e aumentam o fluxo sangüíneo pelo rim. Elas também regulam a excreção de sódio e o ritmo de filtração glomerular.

BioQ.18 718

|

18.6 LIPOXIGENASE E ÁCIDOS OXIEICOSATETRAENÓICOS Ciclooxigenase direciona ácidos graxos poliinsaturados para a via das prostaglandinas que tem ácido araquidônico como substrato. Lipoxigenase é uma dioxigenase que também atua sobre ácido araquidônico. Diferentes lipoxigenases são específicas para a dupla ligação do ácido araquidônico, na qual o ataque inicial do oxigênio ocorre (p. ex., posições 5, 12 ou 15). No homem, os leucotrienos mais importantes são os produtos da 5lipoxigenase, que são mediadores de doenças inflamatórias. Lipoxigenases ocorrem amplamente em plantas e fungos, bem como em animais, mas estão ausentes em leveduras e na maioria dos procariotos. Elas contêm ferro não-hemínico e são ativas quando este ferro está no estado férrico.

Ácidos Mono-Hidroperoxieicosatetraenóicos São Produtos da Ação da Lipoxigenase Lipoxigenase adiciona um grupo hidroperóxido ao ácido araquidônico para produzir ácidos mono-hidroperoxieicosatetraenóicos (HPETEs) (Figura 18.71). Em contraste com a ciclooxigenase da prostaglandina endoperóxido sintase, que catalisa a bis-dioxigenação de ácidos graxos insaturados a endoperóxidos, lipoxigenases catalisam a monodioxigenação de ácidos graxos insaturados a hidroperóxidos alílicos. Substituição hidroperoxi de ácido araquidônico por lipoxigenases pode ocorrer nas posições 5, 12 ou 15. Uma 15-lipoxigenase (15-LOX) oxigena ácido araquidônico no carbono 15. 5-HPETE é o principal produto em basófilos, leucócitos polimorfonucleares (PMN), macrófagos, mastócitos e qualquer órgão passando por resposta inflamatória; 12-HPETE predomina em plaquetas, células das ilhotas pancreáticas, musculatura lisa vascular e células glomerulares; 15-HPETE é o principal produto em reticulócitos, eosinófilos, linfócitos T e células epiteliais da traquéia. As 5-, 12- e 15-lipoxigenases ocorrem principalmente no citosol. Como o átomo de carbono oxigenado em HPETEs é assimétrico, existem dois estereoisômeros possíveis do ácido hidroperoxi, (R) ou (S). Por exemplo, a estéreo-configuração é especificada 12R-LOX ou 12S-LOX. Os três principais HPETEs são da configuração (S). 5-LOX tem uma atividade de dioxigenase que converte ácido araquidônico em 5HPETE, e uma atividade de desidratase que transforma 5-HPETE em LTA4. A atividade 5-LOX é restrita a poucos tipos celulares, incluindo linfócitos B, mas não linfócitos T. É ativada por uma proteína acessória chamada proteína ativadora de 5-lipoxigenase (FLAP). Em leucócitos hu-

22.01.07 19:26:40

CAPÍTULO 19 METABOLISMO DE AMINOÁCIDOS

|

725

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE Fígado NH4+

glutamato

piruvato

+

glutamato

uréia

NH4 �-cetoglutarato

glutamina

19

METABOLISMO DE AMINOÁCIDOS Marguerite W. Coomes 19.1 VISÃO GERAL, 726 19.2 INCORPORAÇÃO DE NITROGÊNIO EM AMINOÁCIDOS, 727 A maioria dos aminoácidos é obtida da dieta, 727 Grupos amino são transferidos de um aminoácido para formar outro, 728 Piridoxal fosfato é cofator de aminotransferases, 729 Glutamato desidrogenase incorpora e produz amônia, 729 Amônia livre é incorporada em e produzida a partir de glutamina, 730 O grupo amida da asparagina é derivado de glutamina, 732 Aminoácido oxidases removem grupos amino, 732 19.3 TRANSPORTE DE NITROGÊNIO PARA FÍGADO E RIM, 732 Proteína é constantemente degradada, 732 Aminoácidos são transportados do músculo após proteólise, 733 Amônia é liberada no fígado e no rim, 733 19.4 CICLO DA URÉIA, 733 Átomos de nitrogênios da uréia vêm de amônia e aspartato, 733 Síntese de uréia requer cinco enzimas, 734 Síntese da uréia é regulada por um efetor alostérico e indução enzimática, 735 Doenças metabólicas da síntese da uréia têm resultados sérios, 735 19.5 SÍNTESE E DEGRADAÇÃO DE AMINOÁCIDOS INDIVIDUAIS, 736

BioQ.19 725

Glutamato é o precursor de glutationa e γ-aminobutirato, 736 Arginina é também sintetizada em intestinos e rins, 737 Ornitina e prolina, 737 Serina e glicina, 738 Tetra-hidrofolato é um cofator em algumas reações de aminoácidos, 741 Treonina, 744 Fenilalanina e tirosina, 744 Metabolismo de tirosina produz fumarato e acetoacetato, 744 Dopamina, epinefrina e norepinefrina são derivados de tirosina, 746 Tirosina é necessária para síntese de melanina, hormônio tireoideano e quinoproteínas, 747 Metionina e cisteína, 747 Metionina primeiro reage com adenosina trifosfato, 749 S-Adenosilmetionina é um doador de grupo metil, 751 S-Adenosilmetionina é o precursor de espermidina e espermina, 752 Metabolismo de cisteína produz compostos que contêm enxofre, 753 Triptofano, 754 Triptofano é um precursor de NAD, 755 Piridoxal fosfato é importante no metabolismo de triptofano, 756 Serotonina e melatonina são derivadas do triptofano, 756 Triptofano induz sono, 757 Aminoácidos de cadeia ramificada, 758 Reações iniciais do metabolismo de BCAA são as mesmas, 758

22.01.07 18:16:14

732

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

O Grupo Amida da Asparagina É Derivado de Glutamina

Aminoácido Oxidases Removem Grupos Amino

O grupo amida da asparagina vem da glutamina (Figura 19.17), e não de amônia livre, como na síntese de glutamina. ATP é necessário para ativar o grupo β-carboxila receptor. Asparagina é facilmente sintetizada na maioria das células, mas algumas células leucêmicas parecem ter perdido esta capacidade. Uma abordagem terapêutica que foi tentada em pacientes com tumores deficientes em asparagina sintetase é tratamento com asparaginase exógena, para hidrolisar a asparagina originária do sangue, da qual estas células dependem (Figura 19.18). Células normais sintetizam e degradam asparagina.

Muitos aminoácidos são substratos para L-aminoácido oxidase (Figura 19.19). O significado desta reação no metabolismo é incerto, mas parece ser pequeno. A enzima contém flavina mononucleotídeo (FMN) e produz peróxido de hidrogênio. Catalase metaboliza o peróxido de hidrogênio a oxigênio e água. Os produtos finais são um α-cetoácido, amônia e água, os mesmos produtos da reação da glutamato desidrogenase. Na reação da aminoácido oxidase, diferentemente da reação catalisada pela glutamato desidrogenase, não há produção de NADH e, portanto, nenhuma produção de ATP. Uma D-aminoácido oxidase ocorre em células humanas. Muito pouco dos isômeros D-aminoácidos é encontrado no homem, e a enzima pode degradar Daminoácidos derivados de bactérias intestinais.

NH2 C COO– CH2 HC

O

CH2

+ NH3

+

CH2 HC

+ NH3

COO–

COO–

Glutamina

Aspartato

ATP AMP +

CH2 HC

PPi

COO–

NH2 C

O

CH2

+ NH3

|

19.3 TRANSPORTE DE NITROGÊNIO PARA FÍGADO E RIM

+

COO–

CH2 HC

+ NH3

Proteína É Constantemente Degradada Células morrem em uma base regular e programada, um processo chamado apoptose (ver p. 993), e suas moléculas componentes são metabolizadas. Proteínas individuais também sofrem turnover regular em condições normais (ver p. 239). Embora muitas reações envolvidas

COO–

Asparagina

Glutamato

COO– HC

FIGURA 19.17 Síntese de asparagina.

+ NH3

R NH2 C CH2 HC

H2O2

FMN O

FMNH2

+ NH3

Asparagina

COO– C

COO–

O2

+ NH2

R

H2O + NH4

H2O

COO– CH2 HC

+ NH3

Aspartato

COO––

FIGURA 19.18 Reação catalisada pela asparaginase.

BioQ.19 732

COO– C

O

+

+ NH4

R

FIGURA 19.19 Reação da L-aminoácido oxidase, uma flavoproteína.

22.01.07 18:16:32

|

CAPÍTULO 19 METABOLISMO DE AMINOÁCIDOS +

NH3 CH2

CH

tetra-hidrobiopterina di-hidrobiopterina H2O O2

COO–

fenilalanina hidroxilase

Fenilalanina

HO

+

NH3 CH2

CH

H2N

N

H N

COO–

H H H

HN O

Tirosina

745

N H

CH

CH

OH

OH

CH3

Tetra-hidrobiopterina

FIGURA 19.46 Fenilalanina hidroxilase. HN

FIGURA 19.47 Biopterina. A forma di-hidro- (quinonóide) é produzida durante oxidação de aminoácidos aromáticos e depois reduzida à forma tetra-hidro por uma desidrogenase, usando NADH.

N

H N

H H H

HN

N O

CH

CH

OH

OH

CH3

Di-hidrobiopterina

CORRELAÇÃO CLÍNICA 19.7

Fenilcetonúria Fenilcetonúria (PKU) é a doença mais comum causada por uma deficiência de uma enzima do metabolismo de aminoácidos. O nome vem da excreção do ácido fenilpirúvico, uma fenilcetona, na urina. Fenil-lactato (Figura 19.47), a forma reduzida do fenilpiruvato, e fenilacetato são também excretados. O último dá à urina um odor “murino”. Esses três metabólitos são encontrados em quantidades muito pequenas na urina de pessoas saudáveis. Os sintomas de retardo mental associados a esta doença podem ser evitados por uma dieta pobre em fenilalanina. Teste de triagem de rotina é determinado pelos governos de muitas partes do mundo. PKU clássica é uma deficiência autossômica recessiva de fenilalanina hidroxilase. Mais de 417 mutações no gene foram descritas. Em alguns casos, há sintomas neurológicos graves e QI muito baixo. Estes são geralmente atribuídos aos efeitos tóxicos da fenilalanina, possivelmente devido ao transporte reduzido e metabolismo de outros aminoácidos aromáticos no cérebro, devido à competição das altas concentrações de fenilalanina. A cor clara característica da pele e dos olhos deve-se à falta de pigmentação, devido à deficiência de tirosina. Tratamento convencional é por uma dieta sintética, pobre em fenilalanina, mas incluindo tirosina, por cerca de quatro a cinco anos, seguida de restrição de proteínas na dieta por vários anos mais ou por toda a vida. Cerca de 3% das crianças com altos níveis de fenilalanina têm hidroxilase normal, mas são defi-

cientes na síntese ou na redução de biopterina. Uma deficiência de BH4 pode ser causada por mutação na GTP ciclo-hidrolase (GTPCH), 6-piruvoiltetra-hidrobiopterina sintetase (PTPS) ou sepiapterina redutase (SPR), as três enzimas que convertem GTP em BH4. Duas enzimas são necessárias para regeneração de BH4: pterina-4a-carbinolamina desidratase (PCD) e di-hidropterina redutase (DHPR). Deficiência de BH4 ocorre a uma taxa de um em um milhão. Screening para hiperfenilalaninemia sem redução de atividade de fenilalanina hidroxilase in vitro indica a possibilidade de uma deficiência de BH4. Se a condição não for tratada, pacientes apresentam sintomas de hiperfenilalaninemia, cabelo vermelho, retardo psicomotor e deterioração neurológica progressiva. Estes últimos sintomas são um resultado da incapacidade de produzir melanina, catecolaminas e serotonina. Tratamento é suplementação com BH4 e precursor de neurotransmissores. Distonia que responde a DOPA (DRD) e deficiência de SR não podem ser detectadas em testes de screening para PKU. Fibroblastos de pele são úteis para o diagnóstico destas condições. A descoberta da deficiência de SR levou à descoberta de vias alternativas do metabolismo de BH4, incluindo um papel para di-hidrofolato redutase (DHFR). Baixos níveis de DHFR no cérebro permitem que di-hidrobiopterina se acumule e iniba tirosina e triptofano hidroxilases. DHP também desacopla óxido nítrico sintase e pode levar à morte de célula neuronal.

Fonte: Scriver, C. R. e Clow, L. L. Phenylketonuria: Epitome of human biochemical genetics. N. Engl. J. Med. 303:1336,1980. Woo, S. L. C. Molecular basis and population genetics of phenylketonuria. Biochemistry 28:1, 1989. Shintaku, H. Disorders of tetrahydrobiopterin metabolism and their treatments. Curr. Drug. Metab. 3:123; 2002. Blau, N., Bonafe, L. e Thony, B. Tetrahydrobiopterin deficiencies without hyperphenylalaninemia diagnosis and genetics of dopa-responsive distonia and sepiapterin reductase deficiency. Mol. Genet. Metab. 74:172, 2001.

BioQ.19 745

22.01.07 18:16:49

760

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

(A partir de leucina) CH3

C

CH

C

SCoA

O

CH3

ATP CO2

H2O

ADP + Pi

metilcrotonil-CoA carboxilase

�–Metilcrotonil-CoA

–OOC

O C

C O

CH2

CH

SCoA

C

C

O–

–OOC

CH2

C CH3

CH2

SCoA

C

CH2

O

CO2 propionil-CoA carboxilase

OH hidroximetilglutaril-CoA liase

CH3

Propionil-CoA

metilglutaconil-CoA hidratase

SCoA

Acetil-CoA

CH3

C

O CH3 �–Metilglutaconil-CoA H 2O

CH3

CH2

C

SCoA

O

CH3 –OOC

�–Hidroxi–�–metilglutaril-CoA (HMG CoA)

CH

C

SCoA

O D–Metilmalonil-CoA

O

Acetoacetato metilmalonil-CoA racemase

FIGURA 19.70 Reações finais na degradação de leucina.

ocorre, de maneira dependente de piridoxal. Reações subseqüentes levam a acetoacetil-CoA. Uma via minoritária começa com remoção do α-amino-grupo e prossegue via o composto cíclico pipecolato (Figura 19.73), para se juntar à via principal no nível do intermediário semialdeído. Esta não substitui a via principal, mesmo em uma deficiência de enzimas na parte inicial da via (ver Corr. Clín. 19.16).

–OOC

CH

C

SCoA

CH3 O L–Metilmalonil-CoA

FIGURA 19.71 Interconversão de propionilCoA, metilmalonil-CoA e succinil-CoA. A mutase requer 5’-desoxiadenosilcobalamina para atividade.

metilmalonil-CoA mutase

–OOC

CH2

CH2

C

SCoA

O Succinil-CoA

CORRELAÇÃO CLÍNICA 19.15

Doenças do Metabolismo de Propionato e Metilmalonato Deficiência de qualquer das três enzimas mostradas na Figura 19.71 contribui para cetoacidose. Propionato é formado na degradação de valina, isoleucina, metionina, treonina, cadeia lateral do colesterol e ácidos graxos de cadeia ímpar. Os aminoácidos parecem ser os principais precursores, uma vez que diminuição ou eliminação de proteínas da dieta minimiza imediatamente a acidose. Um defeito na propionil-CoA carboxilase resulta em acúmulo de propionato, que é desviado para vias alternativas, incluindo incorporação em ácidos graxos em lugar do primeiro grupo acetil, para formar ácidos graxos de cadeia ímpar. A extensão dessas reações é muito limitada. Em um caso, relatou-se que grandes quantidades de biotina produziram efeitos benéficos, sugerindo que mais de um defeito diminua a atividade da propionil-CoA carboxilase. As possibilidades são: uma perda de biotinidase intestinal, que libera biotina de alimento ingerido para absorção, ou uma perda de biotina holocarboxilase, que incorpora biotina de alimentos

ingeridos para absorção, ou perda de biotina holocarboxilase, que incorpora biotina em enzimas biotinadependentes. Acidose em crianças pode ser causada por altos níveis de metilmalonato, que normalmente não é detectado no sangue. Fígado retirado de autópsia ou fibroblastos em cultura mostraram em alguns casos, deficiência de metilmalonil-CoA mutase. Algumas amostras foram incapazes de converter metilmalonil-CoA em succinil-CoA em qualquer condição, mas outras amostras executaram a conversão quando 5’-adenosilcobalamina foi adicionada. É claro que aqueles com defeito no sítio ativo da enzima, não conseguem metabolizar metilmalonato, mas aqueles com defeito no manuseio da vitamina B12 respondem a altas doses da vitamina. Outros casos de acidúria metilmalônica têm uma incapacidade mais fundamental de usar vitamina B12, que leva a deficiência de metilcobalamina (co-enzima da recuperação de metionina) e deficiência de 5’-adenosilcobalamina (coenzima da isomerização de metilmalonil-CoA).

Fonte: Mahoney, M. J. e Bick, D. Recent advances in the inherited methylmalonic acidemias. Acta Paediatr. Scand. 76:689, 1987.

BioQ.19 760

22.01.07 18:17:07

770

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE HCO3–

1

"C1"–H4folato

Glicina 6

Amina de aspartato N

2

7

5

N

4

N

8

N 3

"C1"–H4folato

9

Amida de glutamina

20

METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS Joseph G. Cory 20.1 VISÃO GERAL, 771 20.2 FUNÇÕES METABÓLICAS DOS NUCLEOTÍDEOS, 771 Distribuição de nucleotídeos varia com o tipo de célula, 771 20.3 METABOLISMO DE PURINA NUCLEOTÍDEOS, 772 Síntese de purina nucleotídeos, 772 Síntese de IMP, 772 IMP é precursor de AMP e GMP, 774 Síntese de purina nucleotídeos é muito regulada, 774 Purina bases e nucleosídeos são recuperados para regenerar nucleotídeos, 775 Purina nucleotídeos são interconvertidos para equilibrar níveis celulares de adenina e guanina nucleotídeos, 778 GTP é o precursor de tetra-hidrobiopterina , 778 Ácido úrico é o produto final da degradação de purinas no homem, 778 Formação de ácido úrico, 781 20.4 METABOLISMO DE PIRIMIDINA NUCLEOTÍDEOS, 783 Síntese de pirimidina nucleotídeos, 783 Síntese de pirimidina nucleotídeos é regulada ao nível da carbamoil fosfato sintetase II, 784 Bases pirimídicas são recuperadas para regenerar nucleotídeos, 786

BioQ.20 770

20.5 FORMAÇÃO DE DESOXIRRIBONUCLEOTÍDEOS, 786 Desoxirribonucleotídeos são formados por redução de ribonucleosídeos 5’-difosfatos, 786 Síntese de desoxitimidilato requer N5, N10 -metileno H4folato, 788 Interconversões de pirimidinas com ênfase em desoxirribopirimidina nucleosídeos e nucleotídeos, 788 Pirimidina nucleotídeos são degradados a β-aminoácidos, 789 20.6 NUCLEOSÍDEO E NUCLEOTÍDEO QUINASES, 789 20.7 ENZIMAS QUE METABOLIZAM NUCLEOTÍDEOS COM UMA FUNÇÃO EM CICLO CELULAR E TAXA DE DIVISÃO CELULAR, 790 20.8 SÍNTESE DE COENZIMAS NUCLEOTÍDEOS, 791 20.9 SÍNTESE E UTILIZAÇÃO DE 5-FOSFORRIBOSIL1-PIROFOSFATO, 791 20.10 AGENTES QUIMIOTERÁPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS, 793 Inibidores do metabolismo de purina e pirimidina nucleotídeos, 794 Antimetabólitos são análogos estruturais de bases ou nucleosídeos. 794 Antifolatos inibem a formação de tetra-hidrofolato, 795

22.01.07 18:22:07

CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS

CORRELAÇÃO CLÍNICA 20.5

CORRELAÇÃO CLÍNICA 20.6

Pacientes com Câncer em Tratamento por Radiações ou Quimioterapia

Subclasse de Pacientes com Autismo

Pacientes com câncer com tumores grandes, em tratamento por radioterapia ou quimioterapia também apresentam concentrações aumentadas de ácido úrico no soro e na urina. A fonte deste ácido úrico aumentado não é síntese aumentada de purina nucleotídeos, mas sim destruição de células tumorais que, por sua vez, liberam ácidos nucléicos degradados e nucleotídeos celulares, que são metabolizados a ácido úrico. Muitos dos protocolos de tratamento de câncer incluem alopurinol como uma das drogas, com o único propósito de limitar o acúmulo de ácido úrico nos pacientes. Uma nova droga uricolítica (Rasburicase, uma enzima bacteriana) que converte ácido úrico em um composto hidrossolúvel está sendo usada em crianças e adultos para lidar com os níveis aumentados de ácido úrico formado após células tumorais terem sido destruídas. Embora o uso de uricase ter certas vantagens farmacológicas sobre alopurinol, tem a desvantagem de ser mais caro. Fonte: Smalley, R. V., Guaspari, A., Haase-\break Statz, S., Anderson, S. A., Cederberg, D. e Hohneker, J. A. Allopurinol: Intravenous use for prevention and treatment of hyperuricemia. J. Clin. Oncol. 18:1758, 2000. Ribeiro, R. C. e Pui, C. H. Recombinant urate oxidase for prevention of hyperuricemia and tumor lysis syndrome in lymphoid malignancies. Clin. Lymphoma 3:252, 2003. Yim, B. T., Sims-McCallum, R. P. e Chong, P. H. Rasburicase for the treatment and prevention of hyperuricemia. Ann. Pharmacother. 37:1047, 2003. causa de hiperuricemia/hiperuricúria pode ser definida como um defeito metabólico relacionado com a superprodução de purina nucleotídeos, e outras situações nas quais não há alterações metabólicas definidas (ver Corr. Clín. 20.1, 20.2, 20.5 e 20.6).

|

20.4 METABOLISMO DE PIRIMIDINA NUCLEOTÍDEOS A síntese de novo do anel pirimidínico em células de mamíferos utiliza aminoácidos como doadores de carbono e nitrogênio, além de CO2. Uridina 5’-monofosfato (UMP) é sintetizado em uma via metabólica de seis

BioQ.20 783

|

783

Recentemente demonstrou-se que uma subclasse de crianças com autismo infantil excreta ácido úrico em mais de dois desvios padrões acima da média normal. Este grupo de crianças representa aproximadamente 20% da população autista. Com cultura de fibroblastos destas crianças autistas, descobriu-se que a síntese de novo de purina nucleotídeos, medida por incorporação de [14C]-formato em purina nucleotídeos, estava aumentada quatro vezes, em relação ao observado em fibroblastos de controles normais. A razão de adenina nucleotídeos para guanina nucleotídeos no pool estava alterada, sugerindo que a via de interconversão de purina nucleotídeos estava comprometida. Até o momento, a base molecular para a síntese de novo aumentada de purina nucleotídeos nestas crianças autistas não é conhecida. Um aspecto incomum da síntese aumentada de purina nucleotídeos nestas crianças é que a excreção de ácido úrico é elevada, mas a concentração de ácido úrico no soro está na faixa normal. Em um relato recente, um paciente do sexo masculino foi tratado com uma dose oral de uridina por um período de dois anos. Como resultado, o paciente teve notável melhora no desempenho social, cognitivo, de linguagem e motor. Surpreendentemente, quando a uridina foi descontinuada, os sintomas de autismo voltaram, mas com o reinício do tratamento com uridina, o comportamento do menino melhorou novamente. Page, T. e Coleman, M. Purine metabolism abnormalities in a hyperuricosuric subclass of autism. Biochim. Biophys. Acta 1500:291, 2000. Page, T. e Moseley, C. Metabolic treatment of hyperuricosuric autism. Prog. Neuro-Psychopharmacol. Biol. Psychiatry 26:397, 2002. etapas. Hidrólise de ATP (ou equivalente) é necessária para direcionar diversas etapas da via.

Síntese de Pirimidina Nucleotídeos Em contraste com a síntese de novo de purina nucleotídeos, nem todas as enzimas para a síntese de novo de pirimidina nucleotídeos são citosólicas. Reações que levam à formação de UMP são apresentadas na Figura 20.13. Aspectos importantes da via devem ser observados. O anel pirimidina é formado primeiro, e depois ribose 5-fosfato é adicionada com PRPP, sendo o doador

22.01.07 18:22:20

CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS

O pool de desoxirribonucleotídeos é extremamente pequeno em células “em repouso” (inferior a 1 μM). Como resultado do aumento de atividade de ribonucleotídeo redutase, as concentrações de desoxirribonucleotídeos alcançam 10-20 μM durante síntese de DNA. Entretanto, esta concentração suportaria síntese de DNA por alguns minutos, enquanto a replicação completa do DNA requer horas. Conseqüentemente, os níveis de atividade da ribonucleotídeo redutase não só devem aumentar, mas devem ser mantidos durante a fase S, para fornecerem os substratos necessários à síntese de DNA. Tecidos em crescimento, como o fígado em regeneração, tecidos embrionários, células da mucosa intestinal e células eritropoiéticas estão inclinados em direção à replicação de DNA e à síntese de RNA. Estes tecidos apresentarão níveis elevados das enzimas-chaves envolvidas com síntese e interconversões de purina e pirimidina nucleotídeos, juntamente com diminuição complementar na quantidade de enzimas que catalisam reações nas quais estes precursores são degradados. Estas mudanças refletem a proporção de células que estão na fase S. Um padrão ordenado de alterações bioquímicas ocorre em células tumorais. A partir de uma série de tumores de fígado, cólon e rim, com diferentes velocidades de crescimento, estas alterações foram identificadas como: (1) ligadas à transformação (significando que todos os tumores, independentemente da velocidade de crescimento, apresentam quantidades de certas enzimas aumentadas e, de certas enzimas, diminuídas), (2) ligadas à progressão (alterações que se correlacionam com a velocidade de crescimento dos tumores) e (3) alterações coincidentes (não ligadas ao estado maligno). Os níveis de ribonucleotídeo redutase, timidilato sintase e IMP desidrogenase aumentam em função da velocidade de crescimento do tumor. PRPP amidotransferase, UDP quinase e uridina quinase estão aumentadas em todos os tumores, independentemente de serem de crescimento lento ou rápido. Alterações de expressão gênica em células tumorais não são apenas alterações quantitativas em níveis enzimáticos, mas também alterações qualitativas (troca de isozimas, isozyme shifts). Enquanto algumas enzimas estão aumentadas em tecido normal de crescimento rápido (p. ex., embrionário e fígado em regeneração) e em tumores, os padrões gerais quantitativo e qualitativo para tecidos normal e tumoral podem ser diferenciados.

|

20.8 SÍNTESE DE COENZIMAS NUCLEOTÍDEOS Nicotinamida adenina nucleotídeo (NAD+), flavina adenina nucleotídeo (FAD+) e coenzima A (CoA) são importantes coenzimas ou grupos prostéticos do metabolismo intermediário. Embora todas essas

BioQ.20 791

|

791

coenzimas tenham um resíduo de AMP como parte de sua estrutura, o resíduo de AMP não está diretamente envolvido nas reações em que cada uma delas funciona. Em NAD e NADP, é o anel de nicotinamida que está envolvido na função de oxidação/redução; em FMN ou FAD, é o anel flavina que está envolvido na função de oxidação/redução; na coenzima A, é o grupo sulfidrila que é parte funcional da molécula. São sintetizadas por uma variedade de tipos de células de mamíferos. Figuras 20.27, 20.28 e 20.29 apresentam as vias biossintéticas para cada uma. Síntese de NAD requer niacina, síntese de FAD requer riboflavina, e CoA requer ácido pantotênico. NAD é sintetizado por três vias diferentes, começando com triptofano (ver p. 754), nicotinato ou nicotinamida, respectivamente. Quando triptofano está em excesso, em relação à quantidade necessária para síntese de proteínas e de serotonina (ver p. 773), ele pode ser usado para síntese de NAD. Esta situação não é provável na maioria das dietas normais; conseqüentemente, niacina é necessária na dieta. Síntese de NAD + por qualquer uma das três vias requer PRPP como doador de ribose 5-fosfato. Nicotinamida adenina dinucleotídeo fosfato (NADP+) é derivado por fosforilação do NAD +. NAD+ é usado não só como cofator em reações de oxidação-redução, mas também como um substrato em reações de ADP-ribosilação (p. ex., reparo de DNA e envenenamento por toxina pertussis; ver p. 514). Estas reações levam ao turnover de NAD+. O produto final da degradação de NAD + é 2-piridona-5-carboxamida, que é excretado na urina. Síntese de coenzimas nucleotídeos é regulada de maneira que existam concentrações essencialmente constantes destas coenzimas na célula. Quando se diz que uma certa condição metabólica é favorecida quando a concentração de NAD + é baixa, a concentração de NADH é correspondentemente alta. Como um exemplo, para que a glicólise continue em condições anaeróbicas, NAD+ deve ser continuamente regenerado por redução de piruvato a lactato, catalisado pela lactato desidrogenase (ver p. 582).

|

20.9 SÍNTESE E UTILIZAÇÃO DE 5-FOSFORRIBOSIL1-PIROFOSFATO 5-Fosforribosil-1-pirofosfato (PRPP) é uma molécula chave na síntese de novo de purina e pirimidina nucleotídeos, na recuperação de bases púricas e pirimídicas, e na síntese de NAD+. PRPP sintetase catalisa a reação apresentada na Figura 20.30. Ribose-5-fosfato usada nesta reação é gerada a partir do metabolismo de glicose 6-fosfato, pela via das pentoses fosfato, ou da ribose 1-fosfato gerada por fosforólise de nucleosídeos, via nucleosídeo fosforilase. PRPP sintetase tem uma necessidade absoluta de fosfato inorgânico e é fortemente regulada. A curva de velocidade versus concentração

22.01.07 18:22:30

CAPÍTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS

CH2

H

H

H

C

C

C

|

793

FIGURA 20.28 Síntese de flavina adenina dinucleotídeo.

CH2OH

OH OH OH N

H3C

N

O Riboflavina

H3C

NH

N O

ATP riboflavina quinase ADP

CH2

H

H

H

C

C

C

O CH2

O

N

H3C

N

N

O–

O–

OH OH OH

H3C

P

O

Riboflavins fosfato (flavina mononucleotídeo, FMN)

NH O ATP FAD - pirofosforilase PPi

NH2 N

N

N

N CH2

H

H

H

C

C

C

OH OH OH

H3C H3C

N

N

N

O

O CH2

O

P –O

O O

P

O

CH2

–O

HO

OH

NH O

5. Síntese de NAD + PRPP + nicotinato   nicotinato mononucleotídeo + PPi PRPP + nicotinamida   nicotinamida mononucleotídeo + PPi PRPP + quinolinato   nicotinato mononucleotídeo + PPi Deve-se lembrar que os níveis celulares de pirofosfatase são muito altos em células, levando à hidrólise de pirofosfato a fosfato, e tornando as reações irreversíveis.

BioQ.20 793

Flavins adenina dinucleotídeo (FAD)

O

|

20.10 AGENTES QUIMIOTERÁPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTÍDEOS Síntese de novo de purina e pirimidina nucleotídeos é crítica para replicação, manutenção e função da célula normal. Regulação destas vias é importante, uma vez que foram identificadas doenças que surgem de defeitos nas enzimas regulatórias. Compostos sintéticos e produtos naturais de plantas, bactérias ou fungos, que são análogos estruturais das nucleobases ou dos nucleosídeos usados em reações metabólicas, têm

22.01.07 18:22:33

CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO

|

803

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE M

V �

N

M N

M

Fe

P

N

V

N

P

M

Heme

21

METABOLISMO DO HEME E DO FERRO William M. Awad, Jr.

21.1 METABOLISMO DO FERRO: VISÃO GERAL, 804 21.2 PROTEÍNAS QUE CONTÊM FERRO, 804 Transferrina transporta ferro no soro, 804 Lactoferrina liga ferro no leite, 805 Ferritina é uma proteína envolvida no armazenamento de ferro, 805 Proteínas que contêm ferro não-hemínico estão envolvidas em processos enzimáticos, 806 21.3 ABSORÇÃO INTESTINAL DE FERRO, 807 21.4 REGULAÇÃO MOLECULAR DA UTILIZAÇÃO DE FERRO, 808 21.5 DISTRIBUIÇÃO E CINÉTICA DO FERRO, 811 21.6 BIOSSÍNTESE DO HEME, 813 Enzimas da biossíntese do heme ocorrem em mitocôndrias e citosol, 818 Ácido δ-aminolevulínico sintase, 818 Ácido aminolevulínico desidratase, 818 Porfobilinogênio deaminase e uroporfirinogênio III sintase, 818 Uroporfirinogênio descarboxilase, 819 Coproporfirinogênio oxidase, 820 Protoporfirinogênio oxidase, 820 Ferroquelatase, 820 ALA sintase catalisa a etapa limitante da velocidade da biossíntese do heme, 821

BioQ.21 803

21.7 CATABOLISMO DO HEME, 821 Bilirrubina é conjugada para formar bilirrubina diglucuronídeo no fígado, 821 Hemólise intravascular requer remoção de ferro, 823 BIBLIOGRAFIA, 826 QUESTÕES E RESPOSTAS, 827 CORRELAÇÕES CLÍNICAS 21.1 Sobrecarga de Ferro e Infecção, 805 21.2 Patogenicidade Microbiana e Ferro, 805 21.3 Síntese do Grupo Ferro-Enxofre e Doença Humana, 807 21.4 Ataxia de Friedreich, 807 21.5 Absorção Duodenal de Ferro, 809 21.6 Elementos de Resposta ao Ferro Mutante, 811 21.7 Deficiência de Ceruloplasmina, 812 21.8 Anemia por Deficiência de Ferro, 812 21.9 Hemocromatose Tipo I: Genética Molecular e a Questão das Dietas Enriquecidas em Ferro, 814 21.10 Hemocromatose Tipo III, 814 21.11 Porfiria Intermitente Aguda, 817 21.12 Papel Citoprotetor de Heme Oxigenase, 822 21.13 Hemólise Isoimune Neonatal, 824 21.14 Deficiência de Bilirrubina UDP-Glucuronosiltransferase, 824 21.15 Elevação de Bilirrubina Conjugada no Soro, 825

22.01.07 18:25:39

|

CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO

811

CORRELAÇÃO CLÍNICA 21.6

Elemento de Resposta ao Ferro Mutante Mutações simples foram descritas no segmento de alça do elemento de resposta ao ferro do mRNA da cadeia leve da ferritina, com uma quantidade aumentada de apoferritina sendo sintetizada, mas sem um aumento no ferro total do corpo. Esta mutação leva a uma afinidade 28 vezes menor para IRP-1, em um caso. O conteúdo de L-ferritina do cristalino pode aumentar nove vezes em comparação ao conteúdo no cristalino de indivíduos controles. Como conseqüência, cristais de cadeias leves puras de ferritina aparecem no cristalino, levando a catarata. A

síntese muito aumentada de ferritina no cristalino pode levar a uma quantidade aumentada de reações catalisadas por ferro, com dano lenticular oxidativo muito bem descrito. Uma mutação numa família japonesa ocorre no IRE do mRNA da cadeia H da ferritina, com um marcado aumento na afinidade por IRP. O seqüestro de IRPs leva à síntese diminuída de cadeia H e síntese aumentada de cadeia L. Esta condição está associada com aumento significativo no conteúdo de ferro do corpo, mas aparentemente sem evidência de catarata.

Fonte: Girelli, D., Corrocher, R., Bisceglia, L., et al. Molecular basis for the recently described hereditary hyperferritinemia-cataract syndrome: a mutation in the iron-responsive elements of ferritin L-subunit gene (the “Verona mutation”). Blood 86: 4050, 1995. Beaumont, C., Leneuve, P., Devaux, I., Scoazec, J.Y., et al. Mutation in the iron responsive element of the L ferritin mRNA in a family with dominant hyperferritinaemia and cataract. Nature Genet. 11: 444, 1995. Mumford, A. D., Cree, I. A., Arnold, J. D., et al. The lens in hereditary hyperferritinemia cataract syndrome contains crystalline deposits of L-ferritin. Br. J. Ophthalmol. 84:697, 2000. Kato, J., Fujikawa, K., Kanda, M., et al. A mutation in the ironresponsive element of H-ferritin mRNA, causing autosomal dominant iron overload. Am. J. Hum. Genet. 69:191, 2001. TABELA 21.2 Síndromes de Sobrecarga de Ferro Nome

Gene

Cromossomo

Herança

Ocorrência

Síndrome GRACILE

BCS1L

Hemocromatose juvenil

Proteína

2q33

Recessiva

Muito rara

Chaperone mitocondrial

HFE2

1q21

Recessiva

Incomum

Hemojuvelina

Hemocromatose juvenil

HFE2B

19q13

Recessiva

Incomum

Hepcidina

Hemocromatose

HFE1

6p21

Recessiva

Comum

Proteína HFE

Hemocromatose

HFE3

7q22

Recessiva

Incomum

Receptor 2 de transferrina

Hemocromatose

HFE4

2q32

Dominante

Rara

Ferroportina

Sobrecarga de ferro

FTH1

11q13

Dominante

Muito rara

Ferritina H

Aceruloplasminemia

CP

3q23

Recessiva

Rara

Ceruloplasmina

Fonte: Fellman, V. The GRACILE syndrome, a neonatal lethal metabolic disorder with iron overload. Blood Cells Mol. Dis. 29:444, 2002. Ver Corr. Clín. 21.6, 21.7, 21.9 e 21.10 para maiores detalhes.

|

21.5 DISTRIBUIÇÃO E CINÉTICA DO FERRO Um homem normal de 70 kg contém 3-4 g de ferro, dos quais apenas 0,1% (3,5 mg) no plasma. Aproximadamente 2,5 g estão na hemoglobina. Tabela 21.3 lista a distribuição de ferro no ser humano. Normalmente, cerca de 33% dos sítios de transferrina contêm ferro. Ferro absorvido do intestino é entregue primariamente à medula óssea, para incorporação em hemoglobina dos eritrócitos.

BioQ.21 811

TABELA 21.3 Distribuição Aproximada de Ferro: Homem de 70 kg g

%

Hemoglobina

2,5

68

Mioglobina

0,15

4

Transferrina

0,003

0,1

Ferritina, tecido

1,0

Ferritina, soro

0,0001

0,004

Enzimas

0,02

0,6

Total

3,7

27

100

22.01.07 18:25:46

CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO

|

817

CORRELAÇÃO CLÍNICA 21.11

Porfiria Intermitente Aguda Uma mulher de 40 anos de idade procurou o pronto-socorro em um estado agitado, chorando e reclamando de intensa dor abdominal. Estava constipada há vários dias e notou marcada fraqueza nos braços e nas pernas e que “as coisas não parecem estar completamente corretas”. Exame físico revelou uma velocidade de batimento cardíaco ligeiramente acelerada (100/min) e hipertensão moderada (pressão sangüínea de 160/110 mmHg). Episódios anteriores de dor abdominal severa já haviam ocorrido; operações realizadas em duas ocasiões não revelaram nenhuma anormalidade. Os testes laboratoriais comuns são normais. As queixas neurológicas não são localizadas num foco anatômico. Decide-se que os sintomas presentes são amplamente de origem psiquiátrica e têm uma base funcional, e não orgânica. A paciente é sedada com 60 mg de fenobarbital; um psiquiatra consultado concorda, por telefone, em ver a paciente em aproximadamente 4 h. O corpo clínico percebe uma piora notável; fraqueza generalizada surge rapidamente, progredindo para um comprometimento da função respiratória. Esta evolução ruim leva à incorporação imediata de um regime de ventilação assistida, com transferência para unidade de terapia intensiva para monitoração fisiológica. Sua condição piora e ela morre 48 h depois. Uma amostra de urina da paciente é relatada mais tarde como apresentando um nível muito elevado de porfobilinogênio. Esta paciente tinha porfiria intermitente aguda, uma doença pouco entendida da biossíntese de heme. Há um padrão de herança dominante associado a uma superprodução de ALA e porfobilinogênio, os precursores de porfirina. Três anomalias enzimáticas foram observadas em casos que foram estudados cuidadosamente. Estas incluem: (1) um grande aumento de ALA sintase, (2) uma redução à metade da atividade de porfobilinogênio deaminase, e (3) uma redução à metade da atividade da esteróide 5α-redutase. A mudança no conteúdo da segunda enzima é consoante com uma expressão dominante. A mudança no conteúdo da terceira enzima é adqui-

rida, e aparentemente não existe expressão hereditária da doença. Acredita-se que uma diminuição na porfobilinogênio deaminase leve a uma pequena diminuição no conteúdo de heme do fígado. A concentração menor de heme leva a uma insuficiência na repressão da síntese e na inibição da atividade da ALA sintase. Quase nunca manifestada antes da puberdade, acredita-se que a doença apareça apenas com a indução da 5β-redutase, na adolescência. Sem uma quantidade suficiente de 5α-redutase, o aumento observado nos 5β-esteróides é devido a um desvio de esteróides para a via da 5β-redutase. A importância de anomalias nesta última via metabólica na patogênese da porfiria é controversa. A doença é um grande enigma: o desarranjo do metabolismo da porfirina é confinado ao fígado, que anatomicamente parece normal, enquanto achados patológicos estão restritos ao sistema nervoso. No presente caso, envolvimento de (1) cérebro leva ao estado agitado e confuso e ao colapso respiratório, (2) sistema autônomo leva à hipertensão, aumento na velocidade de batimentos cardíacos, constipação e dor abdominal, e (3) sistema nervoso periférico e medula espinhal levam à fraqueza e distúrbios sensoriais. Experimentalmente, nenhum intermediário metabólico conhecido da biossíntese do heme pode causar a patologia observada na porfiria intermitente aguda. Deveria ter havido uma suspeita maior da possibilidade de porfiria, logo após a chegada da paciente. O tratamento incluiria infusão de glicose, exclusão de qualquer droga que pudesse causar aumento de ALA sintase (p.ex., barbituratos) e, se a doença não respondesse satisfatoriamente apesar destas medidas, administração de hematina intravenosa para inibir a síntese e a atividade de ALA sintase. Porfiria hepática aguda é de interesse político histórico. A doença foi diagnosticada em dois descendentes do rei George III, sugerindo que o último tinha uma personalidade alterada antes e durante a Revolução Americana, que poderia talvez ser atribuída à porfiria.

Fonte: Meyer, U.A., Strand, L.J., Doss, M., et al. Intermittent acute porphyria: demonstration of a genetic defect in porphobilinogen metabolism. N. Engl. J. Med. 286: 1277, 1972. Stein, J.A. e Tscudy, D.D. Acute intermittent porphyria: a clinical and biochemical study of 46 patients. Medicine (Baltimore) 49: 1, 1970.

BioQ.21 817

22.01.07 18:25:51

CAPÍTULO 21 METABOLISMO DO HEME E DO FERRO

sensível aos efeitos de metais pesados, especialmente chumbo, e, é claro, à deprivação de ferro. Nestes últimos casos, zinco é incorporado em lugar do ferro, formando um complexo zinco-protoporfirina IX. Em contraste com heme, o complexo zinco-protoporfirina IX é muito fluorescente e facilmente detectável em pequenas quantidades. Ferroquelatase procariótica não contém um grupo prostético; enquanto a enzima de mamíferos contém um grupo Fe2S2.

ALA Sintase Catalisa a Etapa Limitante da Velocidade da Biossíntese do Heme ALA sintase controla a etapa limitante da velocidade de síntese de heme em todos os tecidos. Succinil-CoA e glicina são substratos para uma variedade de reações. A modulação da atividade de ALA sintase determina a quantidade de substratos que será desviada para biossíntese de heme. Heme e hematina agem como repressores da síntese de ALA sintase e como inibidores de sua atividade. Como heme não se assemelha nem com os substratos nem com o produto da ação da enzima, é provável que atue sobre um sítio alostérico. Quase 100 drogas e metabólitos diferentes podem causar indução de ALA sintase; por exemplo, um aumento de 40 vezes é observado em rato após tratamento com 3,5-dicarbetoxi-1,4-di-hidrocolidina. O efeito dos agentes farmacológicos levou a uma característica clínica importante: alguns pacientes com certos tipos de porfiria tiveram exacerbação de sua condição após administração inadequada de certas drogas (p. ex., barbituratos). ALA desidratase é também inibida por heme; mas isto tem poucas conseqüências fisiológicas, uma vez que a atividade de ALA desidratase é cerca de 80 vezes maior do que a de ALA sintase e, portanto, efeitos inibitórios do heme refletem-se primeiro na atividade de ALA sintase. Glicose ou um de seus metabólitos proximais inibe biossíntese de heme por um mecanismo desconhecido. Isto é de relevância clínica, uma vez que alguns pacientes manifestam seu estado porfírico pela primeira vez quando colocados em dieta muito hipocalórica (e, portanto, de pouca glicose). Outros reguladores do metabolismo de porfirinas incluem certos esteróides. Hormônios esteróides (p. ex., pílulas contraceptivas orais) com uma dupla ligação no anel A entre os átomos C4 e C5 podem ser reduzidos por duas redutases diferentes. O produto da redução de 5α tem pouco efeito sobre a biossíntese de heme; entretanto, o produto da 5β-redução serve com um estímulo para síntese de ALA sintase.

BioQ.21 821

|

821

|

21.7 CATABOLISMO DE HEME Catabolismo de proteínas contendo heme apresenta duas necessidades para o mamífero hospedeiro: (a) um meio para processar os produtos hidrofóbicos de clivagem do anel porfirínico e (b) retenção e mobilização do ferro contido, de forma que possa ser reutilizado. Eritrócitos têm um tempo de vida de aproximadamente 120 dias. Células senescentes são reconhecidas por alterações em suas membranas, e removidas pelo sistema retículoendotelial em locais extravasculares. As cadeias de globina desnaturam, liberando heme no citoplasma. A globina é degradada até seus aminoácidos constituintes, que são reutilizados para suprir necessidades metabólicas gerais. Figura 21.12 mostra os eventos do catabolismo de heme. Heme é degradado primariamente por um sistema de enzimas do retículo endoplasmático em células retículoendoteliais, que requerem oxigênio molecular e NADPH. Heme oxigenase tem dois isômeros; tipo I é induzido por substrato e tipo II é constitutivo. A enzima catalisa clivagem da ponte α-meteno, que une os dois resíduos pirrólicos contendo substituintes vinil. O carbono α-meteno é convertido, quantitativamente, em monóxido de carbono. Esta é a única fonte endógena de monóxido de carbono no homem. Uma fração do monóxido de carbono é liberada pelo trato respiratório. Assim, a medida de monóxido de carbono na respiração exalada fornece um índice da quantidade de heme que é degradada em um indivíduo. O oxigênio presente no monóxido de carbono e nos anéis lactâmicos recém-derivados é gerado totalmente a partir de oxigênio molecular. A estequiometria da reação requer 3 moles de oxigênio para cada clivagem de anel. Heme oxigenase só usará heme como substrato, com o ferro possivelmente participando no mecanismo de clivagem. Assim, protoporfirina IX livre não é substrato. O tetrapirrol linear biliverdina IX é formado por heme oxigenase. Biliverdina IX é reduzida por biliverdina redutase a bilirrubina IX. Descobriu-se que os produtos de ação da heme oxigenase são citoprotetores (ver Corr. Clín. 21.12).

Bilirrubina É Conjugada para Formar Bilirrubina Diglucuronídeo no Fígado Bilirrubina é derivada de glóbulos vermelhos senescentes, mas também do turnover de outras proteínas que contêm heme, como os citocromos. Estudos, com glicina marcada como um precursor, revelaram que uma bilirrubina marcada precocemente, com um pico em 1-3 h, aparece muito rapidamente após uma administração em pulso do precursor marcado. Uma quantidade maior de bilirrubina aparece muito mais tarde, em aproximadamente 120 dias, refletindo o turnover do heme em

22.01.07 18:25:56

CAPÍTULO 22 INTER-RELAÇÕES METABÓLICAS

|

829

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE Fígado Aminoácidos Síntese protéica

Glicose

Piruvato

Glicogênio

Uréia

Gordura Lactato

Síntese protéica (todos os tecidos)

Cérebro CO2 + H2O

22

INTER-RELAÇÕES METABÓLICAS Robert A. Harris e David W. Crabb 22.1 VISÃO GERAL, 830 22.2 CICLO JEJUM-ALIMENTAÇÃO, 830 No estado bem alimentado a dieta supre as necessidades energéticas, 830 No estado de jejum inicial, glicogenólise hepática é uma importante fonte de glicose sangüínea, 834 O estado de jejum requer gluconeogênese a partir de aminoácidos e glicerol, 835 No estado de realimentação inicial, glicogênio é formado por uma via indireta, 837 Importantes interações metabólicas interórgãos, 838 Necessidades energéticas, reservas e homeostase calórica, 839 Homeostase da glicose tem cinco fases, 842 22.3 MECANISMOS ENVOLVIDOS NA MUDANÇA DO METABOLISMO HEPÁTICO ENTRE OS ESTADOS BEM-ALIMENTADO E DE JEJUM, 843 Disponibilidade de substratos controla muitas vias metabólicas, 843 Efetores alostéricos regulam enzimas-chaves, 843 Modificação covalente regula enzimas-chaves, 845 Mudanças nas quantidades de enzimas-chaves fornecem adaptação de longo prazo, 849 22.4 INTER-RELAÇÕES METABÓLICAS DE TECIDOS EM VÁRIOS ESTADOS NUTRICIONAIS E HORMONAIS 852

BioQ.22 829

Obesidade, 853 Fazendo dieta, 853 Diabetes mellitus tipo 2, 855 Diabetes mellitus tipo 1, 856 Câncer, 858 Exercícios aeróbico e anaeróbico, 858 Gravidez, 860 Lactação, 860 Estresse e trauma, 861 Doença hepática, 862 Doença renal, 863 Álcool, 863 Equilíbrio ácido-base, 864 Cólon, 866 BIBLIOGRAFIA, 866 QUESTÕES E RESPOSTAS, 868 CORRELAÇÕES CLÍNICAS 22.1 Obesidade, 831 22.2 Subnutrição Protéica, 832 22.3 Jejum, 833 22.4 Síndrome de Reye, 837 22.5 Coma Hiperglicêmico, Hiperosmolar, 841 22.6 Hiperglicemia e Glicação de Proteínas, 841 22.7 Diabetes Mellitus Tipo 2, 855 22.8 Diabetes Mellitus Tipo 1, 857 22.9 Via do Poliol e Complicações do Diabetes, 857 22.10 Caquexia do Câncer, 858

22.01.07 18:27:18

CAPÍTULO 22 INTER-RELAÇÕES METABÓLICAS

corpos cetônicos se acumularam até concentrações suficientemente elevadas para que entrem no cérebro e supram parte de suas necessidades energéticas. Gluconeogênese renal também se torna significativa nesta fase. Fase V ocorre após jejum muito prolongado de indivíduos extremamente obesos, e é caracterizada por dependência ainda menor da gluconeogênese. Nesta fase, as necessidades energéticas de quase todos os tecidos são supridas, em grande parte, por oxidação de ácidos graxos ou de corpos cetônicos. Enquanto as concentrações de corpos cetônicos estiverem elevadas e os níveis de glicose mantidos, proteólise será um tanto restrita, talvez por pequenas quantidades de insulina ainda produzidas pelo pâncreas, e preservação de proteínas musculares e enzimas ocorrerá. Isto continua até que praticamente toda a gordura tenha sido consumida, e os níveis de corpos cetônicos caem. Depois que toda a gordura se esgotou, o corpo precisa usar proteína muscular para manter a glicose sangüínea. Antes que ela se acabe, você se acabou (ver Corr. Clín. 22.3).

|

22.3 MECANISMOS ENVOLVIDOS NA MUDANÇA DO METABOLISMO HEPÁTICO ENTRE OS ESTADOS BEM-ALIMENTADO E DE JEJUM O fígado de pessoas bem-alimentadas sintetiza ativamente glicogênio e triacilglicerol; tal fígado é glicogênico, glicolítico e lipogênico. Em contraste, o de uma pessoa em jejum é glicogenolítico, gluconeogênico, cetogênico e proteolítico. A estratégia empregada é armazenar calorias quando alimento está disponível, e mobilizá-las quando o resto do corpo estiver precisando. O fígado muda entre estes extremos metabólicos por uma variedade de mecanismos regulatórios: suprimento de substratos, efetores alostéricos, modificação covalente e indução-repressão de enzimas.

Disponibilidade de Substratos Controla Muitas Vias Metabólicas Este mecanismo de controle é freqüentemente ignorado. Entretanto, a concentração de ácidos graxos no sangue que entra no fígado é um importante determinante da taxa de cetogênese. Síntese de glicose pelo fígado é afetada pela velocidade com que substratos gluconeogênicos fluem para o fígado. Entrega de aminoácidos para o fígado no diabetes, em virtude de proteólise acelerada e descontrolada, estimula gluconeogênese e exacerba hiperglicemia. Por outro lado, incapacidade de suprir o fígado adequadamente com substratos glucogênicos

BioQ.22 843

|

843

explica alguns tipos de hipoglicemia, como as observadas durante gravidez ou jejum avançado. Síntese de uréia também é regulada por suprimento de substratos. Metabolismo de aminoácidos no intestino fornece uma fração substancial da amônia usada pelo fígado para produção de uréia. O intestino libera citrulina, como discutido acima, o precursor metabólico de ornitina. Um pool maior de ornitina permite síntese aumentada de uréia após uma refeição rica em proteínas. Na deficiência de proteínas, a velocidade de formação de uréia diminui. Podemos concluir que suprimento de substratos é um importante determinante da velocidade em que operam virtualmente todos os processos metabólicos do corpo. Entretanto, variações no suprimento de substratos não são suficientes para explicar as mudanças marcantes no metabolismo, que devem ocorrer no ciclo jejum-alimentação. Ajuste mais fino das vias é necessário.

Efetores Alostéricos Regulam Enzimas-Chaves Figuras 22.10 e 22.11 resumem os efeitos de efetores alostéricos no fígado, em estados bem-alimentado e jejum, respectivamente. Como mostra a Figura 22.10, glicose ativa glucoquinase [indiretamente por promover seu deslocamento do núcleo para o citoplasma (p. 590)], promovendo assim fosforilação da glicose. Glicose também inativa glicogênio fosforilase e ativa glicogênio sintase indiretamente, dessa forma impedindo degradação e promovendo síntese de glicogênio. Frutose 2,6-bisfosfato estimula 6-fosfofruto-1-quinase e inibe frutose 1,6-bisfosfatase, desta forma estimulando glicólise e inibindo gluconeogênese. Frutose 1,6-bisfosfato ativa piruvato quinase, desta forma estimulando glicólise, e piruvato ativa o complexo piruvato desidrogenase [indiretamente, por inibição da piruvato desidrogenase quinase (ver p. 628)]. Citrato ativa acetil-CoA carboxilase, desta forma estimulando síntese de ácidos graxos, e malonil-CoA inibe carnitina palmitoiltransferase I, desta forma inibindo oxidação de ácidos graxos. Como mostra a Figura 22.11, acetil-CoA estimula gluconeogênese em estado de jejum por ativar piruvato carboxilase e inibir o complexo piruvato desidrogenase [diretamente por estímulo da piruvato desidrogenase quinase (ver p. 531)]. Ésteres de acil-CoA de cadeia longa inibem acetil-CoA carboxilase, o que diminui o nível de malonil-CoA e aumenta atividade de carnitina palmitoiltransferase I e oxidação de ácidos graxos. Frutose 6-fosfato inibe glucoquinase [indiretamente por promover seu deslocamento do citoplasma para o núcleo (ver p. 590)]. Citrato, que está aumentado em concentração como conseqüência de maior oxidação de ácidos graxos, inibe 6-fosfofruto1-quinase e 6-fosfofruto-2-quinase (não mostrado); e NADH, produzido pela oxidação de ácidos graxos, inibe o ciclo dos ácidos tricarboxílicos.

22.01.07 18:27:34

852

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

22.22). Insulina se opõe a esta ação do glucagon. Vários mecanismos estão envolvidos, mas o mais importante envolve inibição da atividade de fatores de transcrição forkhead que são necessários para a transcrição dos genes contendo elementos de resposta à insulina (IRE) e codificando enzimas gluconeogênicas (Figura 22.21). Deficiência de energia leva à inibição de síntese de gordura, colesterol e glicose pelas células do fígado. Ativação de AMPK por AMP reduz a transcrição de SREBP e inibe sua atividade transcripcional e, portanto, inibe síntese de gordura e de colesterol (Figura 22.21). Ativação de AMPK também inibe a atividade transcripcional de fator nuclear hepático 4α (HNF-4α), que é necessário para transcrição de genes que codificam enzimas gluconeogênicas. Receptor de peroxissomos proliferador-ativado α (PPARα), um membro da família de receptores nucleares, é um receptor de ácidos graxos, e é expresso em altos níveis em tecidos que oxidam ácidos graxos (fígado, rim e coração). Ácidos graxos poliinsaturados estimulam o receptor para ativar transcrição de genes envolvidos em utilização de ácidos graxos (Figura 22.23), que contém um elemento de resposta a proliferador de peroxissomo (PPRE) em seus promotores, incluindo aqueles para enzimas dos sistemas de peroxissomos, microssomos e mitocôndrias para oxidação de ácidos graxos (FOX), genes de apolipoproteínas necessárias para exportação de triacilgliceróis hepáticos como VLDL, e enzimas da cetogênese. No tecido adiposo, a isoforma PPARγ é expressa. Quando ativada (talvez por derivados de ácidos graxos, como prostaglandinas), orquestra a diferenciação de pré-adipócitos em adipócitos, aumentando a capacidade de armazenar triacilglicerol. A atividade de ambas as formas de PPAR é aumentada pelo PPARγ-coativador 1 (PGC-1), que é induzido por cAMP. Estas mudanças adaptativas também influenciam a eficiência dos mecanismos regulatórios de curto pra-

Ácidos graxos

zo. Por exemplo, no jejum prolongado ou no diabetes não-controlado, mudança na concentração de efetores alostéricos de acetil-CoA carboxilase terá pouco efeito quando a enzima estiver virtualmente ausente, devido à regulação negativa da expressão do seu gene. Uma pessoa em jejum crônico não pode utilizar eficientemente uma carga de glicose devido à ausência de enzimaschaves necessárias ao metabolismo de glicose. Isto é a intolerância a glicose do jejum. Uma carga de glicose, entretanto, colocará em ação as adaptações necessárias e o restabelecimento dos mecanismos regulatórios de curto prazo.

|

22.4 INTER-RELAÇÕES METABÓLICAS DE TECIDOS EM VÁRIOS ESTADOS NUTRICIONAIS E HORMONAIS Muitas mudanças que ocorrem nos diferentes estados nutricionais e hormonais são variações do ciclo jejumalimentação. Alguns exemplos são dados na Figura 22.24. Outros são óbvios – por exemplo, o rápido crescimento de uma criança, quando aminoácidos são direcionados do catabolismo para síntese de proteínas. As mudanças que ocorrem em algumas situações fisiologicamente importantes, entretanto, são bastante sutis e pouco conhecidas. Por exemplo, no envelhecimento parece haver uma sensibilidade diminuída dos principais tecidos do corpo a hormônios, com capacidade diminuída dos tecidos de responderem normalmente durante o ciclo jejum-alimentação. Se isso é um fator que contribui ou uma conseqüência do processo de envelhecimento, não se sabe.

FIGURA 22.23 Ativação de PPAR por ácidos graxos promove transcrição de genes de oxidação de ácidos graxos (FOX) e cetogênese.

+ PPAR� +

PPRE Mitocôndria genes FOX

+

PPRE Peroxissomo genes FOX

Oxidação de ácidos graxos

BioQ.22 852

+

PPRE Genes de cetogênese

Cetogênese

22.01.07 18:27:50

858

|

PARTE 4 VIAS METABÓLICAS E SEU CONTROLE

excesso, de combustíveis provenientes do intestino. De fato, pacientes com diabetes tipo I ficam presos ao estado de jejum, sem o benefício da parada geralmente imposta, durante o jejum, pela baixa, mas constante, produção de insulina pelo pâncreas. Isto leva a severo desgaste dos tecidos do corpo e, no final, à morte, a menos que insulina seja administrada.

Câncer Tumores são compostos de células cancerosas, que precisam se alimentar como todas as células, mas ao contrário da maioria dos tecidos normais, tumores funcionam independentemente do ciclo jejum-alimentação (ver Corr. Clín. 22.10). Sua demanda por glicose como fonte de energia e aminoácidos para síntese protéica é incessante. Geralmente, preferem glicose e raramente se adaptam, na fase de jejum do ciclo jejum-alimentação, ao uso de ácidos graxos e corpos cetônicos para minimizar seu uso de glicose, para benefício do resto do corpo. A maioria dos tumores não responde a mudanças hormonais que alteram os processos metabólicos em tecidos normais. Estabelecem um ciclo de Cory com o fígado, mas ainda assim podem oxidar completamente quantidades substanciais de glicose, contanto que oxigênio esteja disponível (Figura 22.24e). Células do centro de um tumor estão freqüentemente em hipóxia porque cânceres muitas vezes ultrapassam o desenvolvimento de vasos sangüíneos, que trazem oxigênio. Falta de oxigênio em qualquer célula, normal ou cancerosa, leva a um aumento em fator 1 hipóxia induzidoα (HIF-1α), um fator de transcrição excepcionalmente potente para ativação de genes que codificam transportadores de glicose e as enzimas da glicólise. HIF-1α também se torna constitutivamente ativo em algumas células cancerosas devido a mutações que ativam certos oncogenes. Como uma conseqüência da ação de HIF-1α, a maioria dos tumores de câncer tem excepcional capacidade de gerar ATP por glicólise. Glicólise não é um processo eficiente, em comparação com oxidação completa de glicose, mas utilização eficiente dos recursos do corpo não é característica de um câncer. Capacidade excepcional de gerar ATP por glicólise permite às células cancerosas sobreviverem e crescerem enquanto se espalham e dão metástases em regiões de baixa tensão de oxigênio.

Exercícios Aeróbico e Anaeróbico Exercício aeróbico é exemplificado por corrida de longa distância, exercício anaeróbico por corrida de velocidade ou levantamento de peso. Durante exercício anaeróbico, existe pouca cooperação interórgãos. Os vasos sangüíneos do interior dos músculos são comprimidos durante o pico de contração, de modo que suas células ficam isoladas do resto do corpo e dependem muito de seu próprio glicogênio e fosfocreatina. Fosfocreatina é uma fonte de fosfato de alta energia

BioQ.22 858

CORRELAÇÃO CLÍNICA 22.10

Caquexia do Câncer Perda de peso sem explicação pode ser um sinal de malignidade, e perda de peso é comum no câncer avançado. Isto não é completamente explicado por perda de apetite e diminuição na ingestão de alimentos. A perda de peso deve-se principalmente a músculo esquelético e tecido adiposo, sendo relativamente poupadas as proteínas viscerais (i.é, fígado, rim e coração). Embora tumores comumente apresentem velocidades altas de glicólise, a necessidade energética do tumor provavelmente não explica a perda de peso, uma vez que pode ocorrer mesmo com tumores pequenos. Anomalias endócrinas foram identificadas em pacientes com câncer. Os pacientes tendem a ser resistentes à insulina, têm níveis elevados de cortisol, e têm alta taxa de metabolismo basal. Alguns tumores sintetizam e secretam peptídeos biologicamente ativos como ACTH, fator de crescimento neural, e fator de crescimento tipo-insulina, que podem modificar o metabolismo energético. A resposta do hospedeiro a um tumor, por analogia com infecção crônica, inclui liberação de interleucina-1 (IL-1), interleucina-6 (IL-6) e fator de necrose tumoral α (TNF-α) por células imunes. TNF-α é também chamado caquexina, porque produz depauperamento. TNF-α e IL-1 podem atuar de modo parácrino, uma vez que seus níveis plasmáticos não ficam elevados. Estas citocinas estimulam febre, proteólise, lipólise e secreção de reagentes de fase aguda pelo fígado. Estudos mais recentes identificaram o fator indutor de proteólise (PIF) e o fator mobilizador de lipídeo (LMF) como produtos de tumores que estimulam catabolismo de proteína esquelética e consumo do tecido adiposo, respectivamente. Fonte: Beutler, B. e Cerami, A. Tumor necrosis, cachexia, shock, and inflammation: a common mediator. Annu. Rev. Biochem. 57:1505, 1988. Tracey, K. J. e Cerami, A. Tumor necrosis factor: A pleitropic cytokine and therapeutic target. Annu. Rev. Med. 45:491, 1994. Nitenberg, G. e Raynard, B. Nutritional support of the cancer patients: issues and dilemmas. Crit. Rev. Oncol. Hematol. 34:137, 2000. Tisdale, M. J. Cancer anorexia and cachexia. Nutrition 17:438, 2001. Wray, C. J., Mammen, J. M. e Hasselgren, P. O. Catabolic response to stress and potential benefits of nutrition support. Nutrition 18:971, 2002. para síntese de ATP (Figura 22.6), até que glicogenólise e glicólise sejam estimuladas. Por falta de oxigênio, glicólise torna-se a fonte primária de ATP. Durante

22.01.07 18:27:58

870

|

PARTE 5 PROCESSOS FISIOLÓGICOS

PARTE 5 PROCESSOS FISIOLÓGICOS ACTH

1 R

AC

2 Proteína G

cAMP ATP PKAi

PKA

23

BIOQUÍMICA DE HORMÔNIOS Thomas J. Schmidt e Gerald Litwack 23.1 VISÃO GERAL, 871 23.2 HORMÔNIOS E O SISTEMA DE CASCATA HORMONAL, 872 Sistema de cascata amplifica sinais específicos, 872 Principais hormônios polipeptídicos e suas ações, 874 Hormônios polipeptídicos e pituitária anterior, 874 23.3 SÍNTESE DE HORMÔNIOS POLIPEPTÍDICOS E HORMÔNIOS DERIVADOS DE AMINOÁCIDOS, 875 Hormônios polipeptídicos: codificação gênica, 875 Pró-opiomelanocortina é precursor de oito hormônios, 875 Genes de hormônios polipeptídicos podem codificar peptídeos adicionais, 880 Um gene pode codificar múltiplas cópias de um hormônio, 881 Hormônios derivados de aminoácidos, 882 Epinefrina é sintetizada a partir de tirosina, 882 Síntese de hormônio da tireóide requer incorporação de iodo em tirosinas da tireoglobulina, 883 Inativação e degradação de hormônios derivados de aminoácidos, 883 23.4 PROTEÍNAS DE SINALIZAÇÃO HORMONAL, 883 Visão geral da sinalização, 883 Receptores de membrana, 883 Cascata de sinalização intracelular: segundos mensageiros, 885

BioQ.23 870

Sistemas hormonai s cíclicos, 887 Síntese de melatonina e serotonina é controlada por ciclos claro/escuro, 887 Ciclo ovariano é controlado por secreção pulsátil e cíclica de hormônio liberador de gonadotropina, 888 Ausência de fertilização, 888 Fertilização, 889 23.5 RECEPTORES DE HORMÔNIOS DE MEMBRANA, 891 Algumas interações hormônio-receptor envolvem múltiplas subunidades hormonais, 891 Receptor β-adrenérgico, 892 Internalização de receptores, 893 Clatrina direciona internalização de complexos hormônio-receptor da membrana plasmática, 894 23.6 CASCATA HORMONAL INTRACELULAR: PROTEÍNAS QUINASES, 894 Receptor de insulina: transdução por tirosina quinase, 895 Atividade de vasopressina: proteína quinase A, 897 Hormônio liberador de gonadotropina (GnRH): proteína quinase C, 898 Atividade do fator natriurético atrial (ANF): proteína quinase G, 900 23.7 HORMÔNIOS ESTERÓIDES, 902 Estruturas e funções de hormônios esteróides, 902 Biossíntese de hormônios esteróides, 902 Metabolismo de hormônios esteróides, 905 Regulação da síntese de hormônios esteróides, 907

22.01.07 18:32:35

CAPÍTULO 23 BIOQUÍMICA DE HORMÔNIOS

CORRELAÇÃO CLÍNICA 23.1

Testando a Atividade da Pituitária Anterior Hormônios liberadores e análogos químicos, particularmente dos peptídeos menores, são hoje sintetizados rotineiramente. O hormônio liberador de gonadotropina, um decapeptídeo, está disponível para uso na avaliação da função da pituitária anterior. Isto é de importância quando uma situação de doença puder envolver o hipotálamo, a pituitária anterior ou o órgão final. Esterilidade é um exemplo de tal situação. O que precisa ser avaliado é qual o órgão defeituoso na cascata hormonal. Isto pode ser conseguido por injeção do hormônio da pituitária anterior LH ou FSH. Se a secreção de hormônio sexual foi desencadeada, então a glândula final parece estar funcionando adequadamente. A seguir, a pituitária anterior deveria ser analisada. Isto pode ser feito por administração i.v. de GnRH sintético; por esta via, GnRH pode chegar às células gonadotrópicas da pituitária anterior e desencadear secreção de LH e FSH. Rotineiramente, os níveis de LH são medidos no sangue como uma função do tempo após a injeção. Estes níveis são medidos por radioimunoensaio (RIA), no qual LH ou hCG é deslocado da ligação com uma proteína de ligação ao LH na amostra de soro. A extensão da competição é proporcional à quantidade de LH no soro. Deste modo, uma progressão da resposta é medida e estará dentro dos limites normais ou claramente deficientes. Se a resposta for deficiente, as células da pituitária anterior não estão funcionando normalmente e são a causa da síndrome. Por outro lado, resposta normal da pituitária a GnRH indicaria que o hipotálamo não está funcional. Tal descoberta sugeriria exame do hipotálamo, quanto a condições que levam à disponibilidade/produção insuficiente de hormônios liberadores. Obviamente, o conhecimento da estrutura do hormônio e a capacidade de sintetizar hormônios específicos permite o diagnóstico destas doenças. Fonte: Marshall, J. C. e Barkan, A. L. Disorders of the hypothalamus and anterior pituitary. Em: W. N. Kelley (Ed.), Internal Medicine. New York: Lippincott, 1989, p. 2159. Conn, P. M. The molecular basis of gonadotropin-releasing hormone action. Endocr. Rev. 7: 3, 1986.

BioQ.23 875

|

875

dia), prolactina (PRL), hormônio folículo-estimulante (FSH) e hormônio luteinizante (LH). Todos são cadeias polipeptídicas únicas, exceto TSH, FSH e LH, que são dímeros que compartilham uma subunidade α semelhante ou idêntica. Como o lóbulo intermediário no homem é rudimentar, os níveis circulantes de α e β-MSH livres são relativamente baixos. É de interesse, particularmente no homem, o fato dos receptores de MSH reconhecerem e serem ativados por ACTH, já que os 13 primeiros aminoácidos do ACTH contêm a seqüência do α-MSH. Por esta razão, ACTH pode ser um fator contribuinte importante para a pigmentação da pele e pode exceder a importância de MSH, especialmente em condições em que o nível circulante de ACTH é alto. As conseqüências clínicas do hipopituitarismo são apresentadas na Correlação Clínica 23.2.

|

23.3 SÍNTESE DE HORMÔNIOS POLIPEPTÍDICOS E HORMÔNIOS DERIVADOS DE AMINOÁCIDOS Hormônios Polipeptídicos: Codificação Gênica Genes de hormônios polipeptídicos contêm a seqüência codificadora do hormônio e os elementos de controles a montante (upstream) do gene estrutural. Em alguns casos, mais de um hormônio é codificado em um gene. Por exemplo, pró-opiomelanocortina gera pelo menos oito hormônios a partir de um único produto gênico. Ocitocina e vasopressina são codificados por genes separados, juntamente com suas respectivas proteínas neurofisinas. Neurofisinas são co-secretadas com seus respectivos hormônios, mas não têm ação endócrina conhecida.

Pró-opiomelanocortina É Precursor de Oito Hormônios Pró-opiomelanocortina é um precursor de hormônios para os seguintes hormônios: ACTH, β-lipotropina, γ-lipotropina, γ-MSH, α-MSH, CLIP, β-endorfina e potencialmente β-MSH e encefalinas (Figura 23.5). Nem todos estes produtos são expressos simultaneamente em um único tipo celular, mas são produzidos em células separadas com base em seu conteúdo de proteases específicas necessárias, controles metabólicos específicos e a presença de reguladores. Assim, enquanto pró-opiomelacortina é expressa em corticotropos da pituitária anterior e em células da pars intermedia, o estímulo e os produtos são diferentes (Tabela 23.3). Pars intermedia é uma estrutura anatômica discreta, localizada

22.01.07 18:32:42

CAPÍTULO 23 BIOQUÍMICA DE HORMÔNIOS

tas seqüências de aminoácidos em torno de um resíduo de fosfotirosina. Várias vias diferentes são ativadas, e estas incluem ativação de PI3 quinase (fosfatidilinositol 3´-OH quinase), Ras (proteína pequena que liga GTP), a cascata da MAP quinase (proteína quinase ativada por mitose) e TC10 (proteína pequena que liga GTP). Uma vez ativada por troca de GTP por GDP, TC10 promove translocação de vesículas de GLUT4 para a membrana plasmática, talvez por estabilização de filamentos de actina corticais. Estas vias atuam de modo orquestrado para coordenar a regulação do tráfego de vesículas [incorporação de transportador 4 de glicose (GLUT4) à membrana plasmática], síntese de proteínas, ativação e inativação de enzimas e expressão gênica. O resultado final destas diversas vias é regulação do metabolismo de glicose, lipídeos e proteínas, bem como crescimento e diferenciação celular. A importância da atividade da quinase do receptor de insulina e da via geral de transdução de sinal da insulina é enfatizada na Correlação Clínica 23.3.

|

897

Atividade de Vasopressina: Proteína Quinase A Arginina angiotensina (AVP), ou hormônio antidiurético, causa reabsorção de água aumentada da urina no rim distal. Um mecanismo para este sistema é apresentado na Figura 23.30. Neurônios que sintetizam AVP (neurônios vasopressinérgicos) liberam AVP em resposta a estímulos de barorreceptores que respondem a uma queda na pressão do sangue ou de osmorreceptores que respondem a um aumento na concentração extracelular de sal. VP liga-se a seu receptor de membrana cognato no rim distal, na pituitária anterior, em hepatócitos e, talvez, em outros tipos celulares, No rim, a ligação de AVP a seu receptor acoplado a proteína G estimula a atividade de adenilato ciclase e ativa proteína quinase A, que fosforila subunidades que se agregam para formar canais aquosos específicos, ou aquaporinas (ver p. 459). Água atravessa a célula do rim para o lado basolateral e depois entra na circulação geral, onde dilui a concentração de sal. Mutações específicas nas seqüências

CORRELAÇÃO CLÍNICA 23.3

Atividade Reduzida do Receptor de Insulina Quinase no Diabetes Mellitus Gestacional Durante a gravidez, uma importante adaptação metabólica materna é uma redução na sensibilidade à insulina. Esta adaptação ajuda a fornecer glicose adequadamente para o feto em desenvolvimento. Entretanto, em 3-5% das mulheres grávidas, desenvolve-se intolerância a glicose. Diabetes mellitus gestacional (GDM) é caracterizada por um decréscimo adicional na sensibilidade a insulina e uma incapacidade de compensar com secreção aumentada de insulina. Embora ambos resistência à insulina induzida pela gravidez e GDM sejam geralmente reversíveis após a gravidez, aproximadamente 30-50% das mulheres com história de GDM desenvolvem diabetes tipo 2 mais tarde na vida, especialmente se forem obesas. Embora os mecanismos celulares responsáveis pela resistência à insulina em GDM não sejam totalmente conhecidos, a resistência ao transporte de glicose mediado por insulina parece ser maior em músculo esquelético de indivíduos com GDM do que em mulheres grávidas que não têm

GDM. Dados recentes indicam que defeitos na ação da insulina, e não diminuição na afinidade da insulina pelo receptor, podem contribuir para a patogênese de GDM. Mais especificamente, células de músculo esquelético de sujeitos com GDM aparentemente expressam excesso de glicoproteína-1 de membrana plasmática (PC-1), que se verificou inibir a atividade de tirosina quinase do receptor de insulina, por interagir diretamente com as subunidades α e bloquear a mudança conformacional induzida por insulina. Além disso, excessiva fosforilação de resíduos de serina/treonina localizados nos receptores de insulina do músculo parece regular negativamente (downregulate) a atividade de tirosina quinase em GDM. Assim, uma superexpressão de PC-1 e um decréscimo na atividade quinase do receptor, acoplados com expressão e fosforilação (resíduos de tirosina) diminuídas do substrato 1 do receptor de insulina (IRS-1; ver Figura 20.29), podem estar por trás da resistência à insulina em GDM.

Fonte: Shao, J., Catalono, P. M., Hiroshi, Y., Ruyter, I., Smith, S., Youngreen, J. e Friedman, J. E. Decreased insulin receptor tyrosine kinase activity and plasma cell membrane glycoprotein-1 overexpression in skeletal muscle from obese women with gestational diabetes mellitus (GDM). Diabetes 49(4): 603, 2000. Maddux, B. A. e Goldfine, I. D. Membrane glycoprotein PC-1 inhibition of insulin receptor function occurs via direct interaction with the receptor alpha-subunit. Diabetes 49(1): 13, 2000.

BioQ.23 897

22.01.07 18:33:26

914

|

PARTE 5 PROCESSOS FISIOLÓGICOS

Transporte de Hormônios Esteróides: Proteínas de Ligação Quatro proteínas plasmáticas principais respondem pela ligação dos hormônios esteróides no sangue. Elas são globulina de ligação a corticoesteróides, proteína de ligação a hormônios sexuais, proteína de ligação a andrógenos e albumina. A maior parte do cortisol circulante (75-80%) ocorre ligado a uma α2 -globulina de ligação a corticosteróide (CBG) específica, também conhecida como transcortina. Cada molécula desta glicoproteína liga uma única molécula de cortisol, com Ka de 2,4  107 M-1. A concentração normal de transcortina no plasma é 3 mg/dl, e sua capacidade de ligação é 20 μg de cortisol/dl. Cerca de 15% do cortisol do plasma ocorre ligado a albumina, com uma afinidade muito mais baixa (Ka = 103 M-1). Portanto, embora albumina esteja presente em concentração 1.000 vezes superior à de CBG, cortisol vai preencher primeiro os sítios de ligação em CBG. A concentração de transcortina, e portanto de cortisol, está aumentada durante a gravidez e administração de estrógeno. Durante o estresse, quando os níveis de cortisol são altos, os sítios de ligação de CBG estarão saturados, e o excesso de cortisol se ligará a albumina. Apenas 5-10% do cortisol plasmático está normalmente livre (não-ligado). Cortisol livre difundese através da membrana plasmática, liga-se aos receptores intracelulares de cortisol, e medeia uma resposta biológica. Em contraste com cortisol, apenas 50-70% da aldosterona circulante fica ligada com baixa afinidade a albumina e transcortina. Portanto, aldosterona tem uma meia-vida mais curta no plasma (20 minutos) em comparação com cortisol (70 minutos). Globulina de ligação a hormônios sexuais (SHBG) liga andrógenos com uma constante de afinidade de cerca de 109 M-1. Cerca de 65% da testosterona são ligados a esta glicoproteína derivada do fígado. Apenas 1-2% da testosterona circulante está na forma livre, e o andrógeno restante está ligado a albumina e a outras proteínas. As frações ligadas a SHBG servem, portanto, como reservatórios circulantes de testosterona. Cerca de 60% dos estrógenos são transportados ligados a SHBG, 20% são ligados a albumina , e 20% na forma livre. Entretanto, estradiol liga-se a SHBG com uma afinidade muito mais baixa do que testosterona. Assim, estradiol ligado a SHBG dissocia-se muito rapidamente e é captado pelos tecidos alvos. Por esta razão, mudanças nos níveis de SHBG no homem podem alterar a razão de andrógenos para estrógenos livres. A concentração plasmática de SHBG antes da puberdade é aproximadamente a mesma em homens e mulheres. Entretanto, na puberdade, há um pequeno decréscimo em mulheres e um decréscimo maior em homens, garantindo uma quantidade relativamente maior de testosterona circulante não-ligada em homens. Homens adultos têm cerca da metade da SHBG circulante de mulheres, de modo que testosterona livre é cerca de 20 vezes mais alta em homens do que em mulheres. Além

BioQ.23 914

disso, a concentração total (ligada mais não-ligada) de testosterona é cerca de 40 vezes maior em homens. A própria testosterona reduz os níveis de SHBG (aumenta a porcentagem de testosterona livre) no sangue, enquanto 17β-estradiol e hormônio da tireóide elevam os níveis de SHBG no sangue. Durante a gravidez e no hipertireoidismo, as porcentagens de testosterona e de 17β-estradiol não-ligados estariam reduzidas. Proteína de ligação a andrógeno (ABP) é produzida pelas células de Sertoli em resposta a testosterona e FSH, que estimulam síntese de proteínas nessas células. ABP é também chamada globulina de ligação a testosterona-estrógeno (TeBG). Esta proteína é semelhante a SHBG, exceto que se localiza no testículo e ajuda a manter níveis locais elevados de andrógeno no testículo e no líquido seminal. Estes níveis locais de andrógeno elevados são importantes no desenvolvimento e maturação dos espermatozóides. Progesterona liga-se fracamente a transcortina e albumina, e sua meia-vida circulante é apenas cerca de 5 minutos.

|

23.8 RECEPTORES DE HORMÔNIOS ESTERÓIDES Hormônios Esteróides Ligam-se a Proteínas Receptores Intracelulares Receptores de hormônios esteróides e receptores de não-esteróides (i. é, hormônio da tireóide, ácido retinóico, vitamina D3) localizam-se intracelularmente. O receptor de glucocorticóide não-ligado e, possivelmente, o receptor de aldosterona parecem residir no citoplasma, enquanto os outros receptores não-ligados localizam-se dentro do núcleo, provavelmente em associação com a cromatina. Na Figura 23.48, a Etapa 1 mostra um hormônio esteróide se dissociando de uma proteína plasmática transportadora. O esteróide livre entra na célula por difusão, através da bicamada lipídica (Etapa 2). Cortisol liga-se a seu receptor com uma constante de afinidade de 109 M-1, comparada a uma constante de afinidade de cerca de 107 M-1 para CBG. O receptor não-ligado (neste caso, receptor de glucocorticóide) é um complexo (~300 kDa) que contém outras proteínas associadas, incluindo um dímero de uma proteína de choque térmico 90 kDa, que mascara o domínio de ligação ao DNA do receptor (Figura 23.49), e outra proteína de choque térmico designada por Hsp56, que é uma imunofilina que liga várias drogas imunossupressoras. Ligação do ligante esteróide (Etapa 3) causa uma mudança conformacional, chamada “ativação”, da própria proteína do receptor, resultando em liberação das proteínas associadas, incluindo o dímero Hsp90, e exposição dos resíduos de aminoácidos carregados positivamente localizados no domínio de ligação ao DNA (Etapa 4).

22.01.07 18:34:18

CAPÍTULO 24 BIOLOGIA MOLECULAR DAS CÉLULAS

|

925

PARTE 5 PROCESSOS FISIOLÓGICOS ��

�� � �� ���� ���

24

BIOLOGIA MOLECULAR DAS CÉLULAS Thomas E. Smith 24.1 VISÃO GERAL, 926 24.2 TECIDO NERVOSO: METABOLISMO E FUNÇÃO, 926 ATP e potencial elétrico transmembrânico em neurônios, 928 Interação neurônio-neurônio ocorre por meio de sinapses, 929 Síntese, armazenamento e liberação de neurotransmissores, 930 Terminação de sinais em junções sinápticas, 934 Acetilcolina, 934 Catecolaminas, 935 5-Hidroxitriptamina (serotonina), 936 γ-Aminobutirato (GABA), 936 Neuropeptídeos são derivados de proteínas precursoras, 937 24.3 OLHO: METABOLISMO E VISÃO, 938 Córnea deriva ATP de metabolismo aeróbico, 938 Cristalino consiste principalmente de água e proteína, 939 Retina deriva ATP de glicólise anaeróbica, 941 Transdução visual envolve eventos fotoquímicos, bioquímicos e elétricos, 941 Bastonetes e cones são células fotorreceptoras, 943 Visão de cores origina-se nos cones, 951 Visão de cores é tricromática, 951 Outras diferenças entre bastonetes e cones, 952 24.4 MOTORES MOLECULARES E PROTEÍNAS ASSOCIADAS, 952 Contração muscular, 953 Contração do músculo esquelético, 953 Organização estrutural dos componentes do músculo esquelético, 953

BioQ.24 925

Estrutura e caracterização de algumas proteínas envolvidas nos processos contráteis, 956 Miosina forma filamentos grossos do músculo, 956 Actina, tropomiosina e troponina são proteínas de filamentos finos, 957 Contração muscular requer Ca 2+, 961 Reservatórios de energia para contração muscular, 961 Modelo de contração do músculo esquelético: o golpe de força, 963 Cálcio Regula a Contração do Músculo Liso, 963 Envolvimento de óxido nítrico e monóxido de carbono na contração muscular, 964 Outras classes de miosinas e motores moleculares, 965 Miosinas não-convencionais e suas funções, 965 Cinesinas, 966 Dineína, 967 24.5 MECANISMO DA COAGULAÇÃO DO SANGUE, 967 Processos bioquímicos da hemostasia, 967 Fase pró-coagulante da hemostasia (fase 1), 969 Via extrínseca e início da coagulação, 969 Formação de trombina, 970 Reações da via intrínseca, 970 Algumas propriedades das proteínas envolvidas na formação do coágulo, 971 Formação da rolha de plaquetas, 975 Fase anticoagulante da hemostasia (fase 2), 975 Inibição da via extrínseca, 975 Inativação de FVa e FVIIIa, 978

22.01.07 19:35:10

938

|

PARTE 5 PROCESSOS FISIOLÓGICOS

TABELA 24.3

Peptídeos Encontrados no Tecido Cerebrala

Peptídeo

Estrutura

β-Endorfina

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Met-encefalina

YGGFM

Leu-encefalina

YGGFL

Somatostatina

AGCKNFFW | | CSTFTK

Hormônio liberador de hormônio luteinizante

p-E H W S Y G L R P G NH2

Hormônio liberador de tirotropina

p-E H P-NH2

Substância P

R P K P E E F F G L M-NH2

Neurotensina

p-E L Y E N K P R R P Y I L

Angiotensina I

DRVYIHPFHL

Angiotensina II

DRVYIHPF

Peptídeo intestinal vasoativo

H S D A V F T D N Y T R L R K E M A V K K Y L N S I L N-NH2

a

Peptídeos com “p” precedendo a estrutura indicam que o N-terminal é piroglutamato. Aqueles com NH2 na extremidade indicam que o C-terminal é uma amida.

Cinesinas e miosinas, proteínas motores moleculares (ver p. 966), facilitam este processo de transporte. Neuropeptídeos são mediadores de respostas sensoriais e emocionais, tais como as associadas com fome, sede, sexo, prazer, dor e assim por diante. Incluídas nesta categoria estão encefalinas, endorfinas e substância P. Substância P é um neurotransmissor excitatório que desempenha um papel na percepção de dor. Está em uma classe de neuropeptídeos chamados neurocininas. Seu receptor, NK-1 (ou neurocinina-1), é uma proteína tipo-G consistindo de sete elementos de hélices transmembrânicas. Endorfinas e opióides ligam-se a receptores que também têm sete elementos de hélices transmembrânicas. Endorfinas desempenham papéis na eliminação da sensação de dor. Alguns dos peptídeos encontrados no tecido cerebral são apresentados na Tabela 24.3. Note que Met-encefalina é derivada da região N-terminal da β-endorfina. Os aminoácidos da extremidade N-terminal ou de ambas as extremidades N- e C-terminal de muitos neuropeptídeos transmissores são modificados.

|

24.3 OLHO: METABOLISMO E VISÃO O olho, nossa janela para o mundo exterior, nos permite ver as belezas da natureza, as belezas da vida e, considerando o conteúdo deste livro, as belezas da bioquímica. Uma vista através de qualquer janela ou de qualquer lente de câmera é mais clara quando não obstruída. O olho evoluiu de tal modo que um objetivo semelhante foi alcançado. É composto de tecidos vivos que reque-

BioQ.24 938

rem nutrição contínua obtida pelo uso de metabólicas convencionais apropriadas a suas necessidades específicas. Estruturas pigmentadas, como citocromos e mitocôndrias, ou não estão presentes em algumas estruturas ou estão arranjadas e distribuídas de modo a não interferirem com o processo visual. Além disso, o cérebro desenvolveu um sistema de filtro enormemente eficiente que torna objetos dentro do olho invisíveis, os quais poderiam levar a distorção visual. Um diagrama esquemático de um corte transversal do olho é apresentado na Figura 24.16. A luz que entra no olho passa progressivamente por (a) a córnea, a câmara anterior que contém humor aquoso, (b) o cristalino, e (c) o corpo vítreo, que contém humor vítreo; finalmente focaliza na retina, que contém o aparelho sensor visual. Lágrimas banham o exterior da córnea, enquanto o interior é banhado pelo humor aquoso, um fluido isosmótico contendo sais, albumina, globulina, glicose e outros constituintes. O humor aquoso traz nutrientes para a córnea e para o cristalino, e remove produtos finais do metabolismo deles. O humor vítreo é uma massa gelatinosa que ajuda a manter a forma do olho, enquanto o mantém um tanto flexível.

Córnea Deriva ATP de Metabolismo Aeróbico O olho é uma extensão do sistema nervoso e, como outros tecidos do sistema nervoso central, seu principal combustível metabólico é glicose. A córnea não é um tecido homogêneo e obtém uma porcentagem relativamente alta do seu ATP de metabolismo aeróbico. Cer-

22.01.07 19:35:53

956

|

PARTE 5 PROCESSOS FISIOLÓGICOS

Estrutura e Caracterização de Algumas Proteínas Envolvidas nos Processos Contráteis Miosina Forma Filamentos Grossos do Músculo Miosina, uma molécula fibrosa longa com duas cabeças globulares em uma extremidade, consiste de duas cadeias pesadas de cerca de 230 kDa cada. Ligada perto de cada grupo de cabeça está um par não-semelhante de cadeias leves, cada uma das quais com aproximadamente 20 kDa. As cadeias leves são proteínas “tipocalmodulina” e estão envolvidas em vários aspectos da regulação do processo, sendo que nem todos foram definidos com clareza. Elas ligam motivos IQ em miosinas, que estão localizados próximos dos grupos de cabeça e têm a seqüência consenso IQXXXRGXXXR. A extremidade carboxila de cada cadeia de miosina localiza-se na região da cauda, onde as duas cadeias pesadas são enroladas uma na outra, num arranjo espiral-espiral (Figura 24.29m). Tripsina cliva a cauda em cerca de um terço do seu comprimento a partir da cabeça para produzir meromiosina pesada (o grupo da cabeça e uma cauda curta) e meromiosina leve (o restante da região da cauda). Só a meromiosina leve pode agregar em condições fisiológicas in vitro, sugerindo que agregação seja um dos seus papéis na formação da cadeia pesada in vivo. A região da cabeça pode ser clivada do restante da região de cauda por papaína (Figura 24.29n), resultando em um fragmento do grupo de cabeça chamado Subfragmento 1 ou S-1. A ação destas proteases também demonstra que a molécula tem pelo menos duas regiões de articulação, perto da junção cabeça-cauda. Análise de cDNAs de miosinas de muitas espécies diferentes e tipos diferentes de músculos indicam que existe um grau muito alto de homologia entre miosinas de diferentes fontes, particularmente na região da cabeça. Existe um pouco menos de homologia de seqüência na região da cauda, mas homologia funcional existe em um grau extraordinariamente alto, independentemente do comprimento, que vai de cerca de 86 a cerca de 150 nm para espécies diferentes. A cabeça da miosina contém quase metade (cerca de 839 a cerca de 850) dos resíduos de aminoácidos da molécula inteira, em mamíferos (ver Corr. Clín. 24.7). Miosina forma um agregado simétrico cauda-cauda em torno da linha M da zona H dos sarcômeros. Regiões de cauda são alinhadas de modo paralelo em ambos os lados da linha M, com os grupos de cabeça apontando para a linha Z. Cada filamento grosso contém cerca de 400 moléculas de miosina. A proteína C (Tabela 24.7) está envolvida em sua montagem. A proteína M também está envolvida, presumivelmente, na manutenção das regiões de cauda juntas e em sua ancoragem na linha M.

BioQ.24 956

CORRELAÇÃO CLÍNICA 24.7

Glicação e Estrutura e Função de Miosina Hiperglicemia prolongada afeta a função de muitos sistemas. Glicose pode formar bases de Schiff com amino grupos livres em proteínas e alterar sua função. Experimentos in vitro usando espectroscopia de massa demonstram que miosina também poderia ser glicada. A importância desta observação em envelhecimento e diabetes ainda não foi determinada. Fonte: Ramamurthy, B., Hook, P., Jones, A. D. e Larsson, L. Changes in myosin structure and function in response to glycation. FASEB J. 15:2415, 2001. A cabeça da miosina contém atividade de ATPase, que fornece energia para contração, e sítios de ligação de actina. O fragmento S-1 também contém sítios de ligação para a cadeia leve essencial e a cadeia leve regulatória que se liga nos motivos IQ, como mencionado anteriormente. Um modelo da estrutura tridimensional do fragmento S-1 da miosina é apresentado na Figura 24.31. A região de ligação à actina localiza-se no canto inferior direito, na região da fenda visível. O fragmento S-1 tem várias regiões estruturais tipodomínio com massas de 25, 50 e 20 kDa, coloridos em verde, vermelho e azul, respectivamente. A cadeia leve essencial (ELC) e a cadeia leve regulatória (RLC) são mostradas em amarelo e lilás, respectivamente (ver Corr. Clín. 24.8). O sítio de ligação ao ATP, logo acima da fenda visível, também é uma fenda aberta de cerca de 13 Å de profundidade e 13 Å de largura. É separada do sítio de ligação

FIGURA 24.31 Um modelo de preenchimento de espaço dos resíduos de aminoácidos no fragmento S-1 da miosina. Os domínios de 25, 50 e 20 kDa da cadeia pesada são cinzaescuro, cinza e cinza quase preto, respectivamente. As cadeias leves essencial e regulatória são cinza-claro e cinza-médio, respectivamente. Reimpresso com permissão de Rayment, I., Rypniewski, W. R., Schmidt-Base, K., Smith, R., et al. Science 261:50, 1993. Direitos autorais (1993) AAAS.

22.01.07 19:36:31

CAPÍTULO 24 BIOLOGIA MOLECULAR DAS CÉLULAS

Cinesina-13 também é uma cinesina cromossômica e está provavelmente envolvida no movimento mitótico dos cromossomos. Cinesina-14 está entre os motores de extremidademenos como a cinesina mitótica Ncd em Drosophila, que funciona nos estágios iniciais da mitose. Localizase nos fusos de oócitos. Cinesinas-1 e -2 estão mais relacionadas com o material discutido neste capítulo, embora as outras estejam associadas com aspectos mais gerais da divisão celular e do movimento associado de vários componentes associados com este processo.

(+)

6

BioQ.24 967

3 2

1 ATP

Golpe de força (sem carga) ADP + Pi

Carga

ATP or ADP �2

A

Dineína Existem duas classes de motores dineínas: (a) axonêmica, que funciona na realização do movimento de flagelos e cílios, e (b) citoplasmática, que efetua a distribuição e a organização de estruturas citoplasmáticas. Estas funções incluem seleção e movimento de proteínas; organização dos cromossomos durante vários estágios de sua função; distribuição e/ou redistribuição de organelas como endossomos, lisossomos e outros; e transporte axonal retrógrado – isto é, transporte de carga na direção oposta à da maioria das cinesinas. A estrutura da dineína é muito mais complexa do que as das outras duas classes de motores. Dineína tem uma estrutura em anel plano de seis membros que tem, no total, aproximadamente 10 vezes a massa molecular das cinesinas. Uma representação esquemática de sua estrutura é mostrada na Figura 24.39. ATP liga com um motivo AAA no domínio 1. Sua ligação e hidrólise induz mudanças conformacionais que são transmitidas pelos domínios 2-4 para a haste que interage com microtúbulos e causa movimentos de passos de 24-32 nm para uma dineína descarregada. O movimento de dineína responde à carga de modo parecido com mudança para marcha mais lenta e, com carga pesada, dá passos de aproximadamente 8 nm. Essa mudança parece estar associada com mudanças conformacionais em vários de seus outros domínios e com a disponibilidade de ATP. Em condições de carga pesada, ATP também parece ligar motivos AAA no domínio 3. Motivos AAA são regiões conservadas de 220-230 resíduos de aminoácidos que existem em uma família de proteínas que participam em várias atividades celulares diferentes, que dependem de energia de hidrólise de ATP para afetar suas funções, que podem incluir proteólise, dobramento e desdobramento de proteínas, metabolismo de íon de metal, e outras atividades, além das associadas com dineína. O nome do motivo AAA refere-se a “ATPase Associada com diversas Atividades celulares”. Note que (1) dineínas como motores são estruturalmente mais complexas do que miosinas ou cinesinas, (2) estão geralmente envolvidas em movimento retrógrado de material celular, (3) estão envolvidas em vários outros aspectos de organização estrutural, e (4) seu movimento de passo ao longo dos microtúbulos é carga-dependente.

4

967

�1

Microtúbulo (–) 5

|

A ATP

A

Golpe de força (sob carga) ADP + Pi

FIGURA 24.39 Dineína funciona como uma molécula motora. Redesenhado de Mallik, R., Carter, B. C., Lex, S. A., King, S. J. e Gross, S. P. Cytoplasmic dynein functions as a gear in response to load. Nature 427:649, 2004.

|

24.5 MECANISMO DA COAGULAÇÃO DO SANGUE A circulação do sangue ocorre em um tipo muito especializado de sistema fechado no qual o volume do líquido circulante é mantido quase constante. Múltiplas funções do sistema tornam a transferência de solutos através de seus limites uma função necessária. Como em qualquer sistema de canos e tubos, vazamentos podem ocorrer como resultado de vários tipos de agressões e devem ser reparados para manter um estado de hemostasia, isto é, sem sangramento.

Processos Bioquímicos da Hemostasia Hemostasia implica em que o processo de formação do coágulo (pró-coagulação, designada como Fase 1) esteja em equilíbrio com processos de parada de formação do coágulo (anticoagulação, Fase 2) e de dissolução do coágulo (fibrinólise, Fase 3). Pró-coagulação leva à produção de fibrina a partir de fibrinogênio e agregação em uma rede insolúvel, ou coágulo, que recobre a área da ruptura e impede maior perda de sangue. Concomitantemente, agregação de plaquetas do sangue ocorre no local da lesão. Agregação plaquetária forma uma rolha física para ajudar a parar o vazamento. Plaquetas também sofrem alterações morfológicas que liberam (a) alguns compostos químicos que ajudam em outros aspectos do processo todo, como vasoconstrição para reduzir o fluxo de sangue para a área e (b) enzi-

22.01.07 19:37:01

CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER

|

987

PARTE 5 PROCESSOS FISIOLÓGICOS (Separação de cromátides e divisão celular) M

G2

G1

G0

S (Duplicação do DNA)

25

CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER Richard M. Schultz 25.1 VISÃO GERAL, 988 25.2 CICLO CELULAR, 988 Regulação do ciclo celular, 989 Regulação de Rb, 990 Regulação de p53, 991 Transdução de sinal de fator de crescimento, 991 25.3 APOPTOSE: MORTE CELULAR PROGRAMADA, 993 Principais vias, 994 Via do receptor de morte, 994 Vias mitocondriais, 995 Apoptose induzida por p53, 996 Regulação de apoptose por MAPK, 996 25.4 CÂNCER, 997 Oncogenes e genes supressores de tumor, 997 Propriedades de células de câncer, 998 Imortalidade das células de câncer, 999

BioQ.25 987

Metástase de células de câncer, 999 Angiogênese induzida por células de câncer, 1000 Múltiplas mutações são necessárias para formar um câncer, 1001 Heterogeneidade genética e bioquímica de cânceres, 1001 Agentes mutagênicos e promotores causam câncer, 1004 Análise bioquímica de cânceres, 1004 BIBLIOGRAFIA, 1005 QUESTÕES E RESPOSTAS, 1007 CORRELAÇÕES CLÍNICAS 25.1 Vírus Oncogênicos de DNA, 999 25.2 Droga Anti-Câncer Molecularmente Dirigida, 1002 25.3 Causa Ambiental de Cânceres Humanos, 1003

22.01.07 18:41:43

CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER

te um sinal por meio de uma mudança conformacional e associações proteína-proteína. Grb2 contém ambos os domínios SH2 e SH3. Ligação de Grb2 ao receptor de PDGF por seu domínio SH2 induz uma mudança conformacional que abre seus domínios SH3 para ligar uma região de hélice poliprolina na proteína GEF Ras, que depois se liga a Ras e catalisa a troca de seu GDP ligado por GTP (Figura 25.8). GPT-Ras é a forma ativa de Ras. Ras é uma enzima GTPase e se inativa por catalisar a hidrólise do GTP ligado em GDP. Mutações no gene Ras que resultam em Ras constitutivamente ativo ocorrem em aproximadamente 30% dos cânceres humanos. As mutações comumente encontradas são nos resíduos de aminoácidos 12, 13 e 61, que participam da atividade de Ras GTPase, de modo que Ras mutado não pode se desativar e permanece em uma conformação GTP-Ras ativa. No Ras normal, a atividade de Ras GTPase é aumentada 100 a 1000 vezes pela ligação de Ras a GAPRas (GAP, proteína ativadora de GTPase). Entretanto, a ligação de GAPRas ao Ras mutado cataliticamente inerte não tem efeito, porque sua atividade de GTPase está ausente. Ras também precisa se associar com a membrana plasmática para ser ativado. Isto é conseguido por modificações pós-tradução que incluem remoção por uma protease do tetrapeptídeo C-terminal, metilação do novo grupo ácido carboxílico C-terminal e adição de um grupo ácido graxo farnesil a uma cadeia lateral de cisteína na extremidade COOH-terminal. Em algumas isoformas de Ras, um segundo grupo acil graxo é adicionado, perto da extremidade COOH-terminal. Três genes Ras diferentes existem no homem – Hras, N-ras e K-ras – que produzem proteínas homólogas de 21 kDa. As seqüências de aminoácidos de seus primeiros 85 resíduos são idênticas, e os seguintes 80 resíduos mostram 85% de homologia, mas as extremidades C-terminais diferem mais dramaticamente. Embora existam diferenças em alguns dos sinais posteriores entre as isoformas de Ras, em geral seus sinais se sobrepõem. Estas isoformas são caracteristicamente expressas em diferentes tipos celulares, e mutações nos resíduos 12, 13 e 61 ativam constitutivamente todas elas. Como ativação da atividade de Ras promove o fenótipo câncer, genes Ras são conhecidos como protooncogenes. Proto-oncogenes são transformados em oncogenes por uma mutação ativadora que promove ou mantém uma célula cancerosa. O oncogene ras dá continuamente um sinal de fator de crescimento que promove divisão celular, em ausência de ativação anterior. GTP-Ras transmite seu sinal de divisão celular por ativação de MAP quinase quinase quinase (MAPKKK) (Figura 25.9). MAPKKK inicia uma cascata de quinases que inclui MAPKK e MAPK. MAPK ativada (fosforilada) se desloca para o núcleo, onde fosforila e ativa

BioQ.25 993

|

993

�������

������

������

����

���������������������� ��������� FIGURA 25.9 GTP-Ras ativa uma cascata de quinases. Ras-GTP ativa uma cascata de quinases resultando na fosforilação e ativação da quinase terminal MAPK. MAPK ativada entra no núcleo e fosforila fatores de transcrição que regulam a expressão de proteínas envolvidas na fase S. MAPK é mitógeno-ativada proteína quinase, MAPKK é MAP quinase quinase, e MAPKKK é MAP quinase quinase quinase.

fatores de transcrição, como Jun e Fos, aumentando assim a transcrição de genes como o fator de transcrição Myc e as ciclinas de G1 envolvidas na divisão celular. Myc aumenta a expressão de muitos genes envolvidos na fase S, incluindo as S-ciclinas e o fator de transcrição E2F (ver p. 211). Entretanto, se as condições não forem adequadas para divisão celular, Myc pode iniciar um processo levando à morte celular.

|

25.3 APOPTOSE: MORTE CELULAR PROGRAMADA Apoptose é a palavra grega para “folhas que caem”, e apoptose descreve um processo bioquímico freqüente natural de morte celular. Morte apoptótica é necessária durante processos de desenvolvimento, bem como para manter a homeostase de um organismo inteiro. À medida que novas células são geradas no homem, morte de um número semelhante de células é necessária na mesma escala de tempo para manter um estado estacionário. Morte apoptótica difere da morte celular necrótica. Na última, lise de uma membrana celular leva à liberação dos conteúdos celulares no espaço extracelular e a uma resposta inflamatória, como freqüentemente acontece em infecções bacterianas ou virais e em trauma. Em contraste, apoptose é freqüentemente

22.01.07 18:42:05

CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER

���

�������

�������

������

������

�����

�����

����������������������

25.4 | CÂNCER Oncogenes e Genes Supressores de Tumor O ciclo celular e a apoptose são críticos para um entendimento do câncer. Genes que codificam proteínas que promovem divisão celular ou que promovem resistência a apoptose são proto-oncogenes (Tabela 25.2). Suas mutações ativadoras ou super-expressão resultam em atividade aumentada, o que leva a divisão celular desregulada ou resistência a apoptose. Mutações em um proto-oncogene podem convertê-lo em um oncogene. Duas cópias (ou alelos) de cada gene autossômico (i.é, aqueles em cromossomos que não os cromossomos X e Y) estão presentes no genoma de toda célula somática [cada célula somática tem um alelo derivado da mãe e outro do pai para cada gene autossômico]. Uma mutação ativadora em um único alelo de um proto-oncogene é suficiente para causar um efeito pró-proliferativo ou anti-apoptótico em uma célula. Tais mutações são portanto autossômicas dominantes para progressão do câncer. Proto-oncogenes, cujos produtos promovem divisão celular ou resistência a apoptose incluem genes de fatores de crescimento, receptores de fatores de crescimento, moléculas adaptadoras tipo-Grb, tirosina quinases tipo-Src, quinases das cascatas MAPK, Cdks, ciclinas, CAKs, Cdc25, e fatores de transcrição (como Jun, Fos, Myc e E2F) que aumentam a expressão de

����������������������

FIGURA 25.14 Múltiplas vias podem ser reguladas por Ras. MAPKKK são MAPK quinase quinases. MAPKs, após ativação por uma MAPKK, podem se deslocar para o núcleo para fosforilar fatores de transcrição. As quinases também podem fosforilar proteínas outras, além dos fatores de transcrição. Alvos alternativos para as quinases incluem proteínas tipo-Bcl-2 e p53.

sobrevivência. Os resultados dos sinais são dependentes do tipo celular. Em algumas circunstâncias, JNK promove morte por fosforilação de Bcl-2 para promover sua dissociação da membrana mitocondrial (Figura 25.15), o que aumenta as concentrações mitocondriais de Bak e Bax livres e promove morte celular. JNK também pode fosforilar p53, tornando-a mais resistente a Mdm-2, resultando em um aumento na concentração de p53 e morte celular. Também a MAPK ERK, a MAPKKK Raf, e a quinase Akt promovem sobrevivência celular por fosforilação da proteína facilitadora pró-apoptótica Bad ou por ativação da expressão dos genes anti-apoptóticos tipo-Bcl-2 (Figura 25.15). Portanto, diferentes

FIGURA 25.15 Interação de quinases ativadas por Ras com proteínas que regulam apoptose. S, sobrevive (via promove sobrevivência celular); D, morre (die) (via promove morte celular apoptótica). ERK, JNK, Raf e Akt são quinases Pi3K, 1-fosfatidilinositol-3 quinase.

���

��������������������� �������

��� �����

���

������������������������������

������������

������

��� ���

�����

����

�������

� � ���

��� �

��� ������������

������������������������������

BioQ.25 997

997

quinases ativadas por Ras transmitem sinais opostos de vida e morte, e o resultado depende do contexto celular e do tipo de célula.

���

����������� ��������������

|

����

�������������������������� ���������������������

22.01.07 18:42:10

|

CAPÍTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CÂNCER

1003

CORRELAÇÃO CLÍNICA 25.3

Causa Ambiental de Cânceres Humanos Fatores ambientais e culturais são as causas predominantes do câncer humano. Se estes fatores puderem ser regulados, a incidência de câncer pode ser reduzida em mais de 75%. Fumar cigarros é responsável por aproximadamente 30% das mortes por câncer nos EUA Além disso, estima-se que dieta pode prevenir o desenvolvimento de aproximadamente 30% dos cânceres nos EUA (estimativas variam entre 10 e 70%). Estes números são baseados primariamente em dados epidemiológicos da incidência de tipos de câncer em diferentes localizações geográficas, culturas e ambientes (ver tabela anexa). Na migração de uma cultura ou localização para outra, a incidência de um tipo de câncer freqüentemente se aproxima à da população na nova cultura, à medida que os indivíduos ou seus descendentes assimilam. Também rápidas mudanças de dieta ou estilo de vida ao longo do tempo em um país mostram a importância destes fatores na incidência de câncer. A quarta parte da população americana que tem maior quantidade de frutas e vegetais na dieta tem uma incidência 30-40% menor de muitos tipos de câncer. Entretanto, os constituintes destes alimentos que inibem a formação do câncer não foram determinados. Níveis inadequados de ácido fólico na dieta americana foram implicados como um fator de risco para cânceres de cólon e de mama. A ingestão de ácido fólico pode ser particularmente crítica em indivíduos com um polimorfismo em seu gene da

metilenotetra-hidrofolato redutase, uma enzima envolvida no metabolismo de ácido fólico, que resulta em atividade diminuída. Deficiência de folato causa incorporação excessiva de uracil no DNA e quebras cromossômicas. Deficiência de folato é comum em alcoólatras e pode ser a razão para um aumento na incidência de certos cânceres com álcool. A dieta e o estilo de vida de pré-adolescentes afetam o início da menarca, e início precoce de menarca e extensão do período de tempo entre menarca e menopausa estão associados com risco aumentado de câncer de mama em mulheres. Obesidade correlaciona-se inversamente com risco de câncer de mama em mulheres pré-menopausa, e correlaciona-se positivamente na pós-menopausa. Muita gordura animal na dieta foi associada com risco aumentado de câncer de cólon, mas os dados são inconsistentes. Ao contrário da gordura animal total na dieta, os dados podem sugerir que é a razão entre gordura poliinsaturada e saturada que se correlaciona com risco de câncer cólon-retal. A incidência de câncer de cólon também tem sido inversamente correlacionada com falta de atividade ou exercício. Estudos ambientais e dietéticos são difíceis, uma vez que grandes populações devem ser estudadas ao longo do tempo de uma geração, e múltiplas variáveis devem ser controladas. Entretanto, avanços no nosso conhecimento e controle destes fatores podem ter enormes efeitos na diminuição da incidência de câncer.

Variação na Incidência de Tipo de Câncer em uma Comparação de Dois Locais Comparação de Localização

Incidência na Localização 1

Incidência na Localização 2

Diferença em Vezes a Incidência

Pulmão

New Orleans (negros) – Madras (Índia)

110

5,8

19

Mama

Hawaii (havaianos) – Israel (não-judeus)

94

14

7

Próstata

Atlanta (negros) - China (Tianjin)

91

1,3

70

Colo uterino

Brasil (Recife) – Israel (não-judeus)

83

3,0

18

Fígado

China (Xangai) – Canadá (Nova Escócia)

34

0,7

49

Cólon

Estados Unidos (Connecticut, brancos) – Índia (Madras)

34

1,8

19

Melanoma

Austrália (Queensland) – Japão (Osaka)

31

0,2

155

* Incidência em número de novos casos por ano por 100.000 pessoas, ajustado para variação de idade com a população específica. Dados retirados de Alberts, B., Johnson, A.,. Lewis, J., Raff, M., Roberts, K., e Watson, J. D. Molecular Biology of the Cell, 4th ed. New York: Garland, 2002, Tabela 24-2, que foi adaptada de DeVita, V. T., Hellman, S., e Rosenberg, S. A. (Eds.). Cancer: Principles and Practice of Oncology, 4th ed. Philadelphia: Lippincott, 1993; baseado em dados de C. Muir et al. Cancer Incidence in Five Continents, Vol. 5, Lyon: International Agency for Research on Cancer, 1987. Referências Gerais: Shibuya, K., Mathers, C. D., Boschi-Pinto, C., Lopez, A. D., e Murray, C. J. L. Global and regional estimates of cancer mortality and incidence by site: II. Results for the global burden of disease 2000. BMC Cancer 2:37, 2002. Pisani, P., Parkin, D. M., Bray, F. e Ferlay, J. Estimates of the worldwide mortality from 25 cancers in 1990. Int. J. Cancer 93:18, 1999.

(continua na página seguinte)

BioQ.25 1003

22.01.07 18:42:17

CAPÍTULO 26 DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS

|

1009

PARTE 5 PROCESSOS FISIOLÓGICOS 2Na+

Galactose SGLT1

Glicose Frutose

GLUT5

26

DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS Ulrich Hopfer 26.1 VISÃO GERAL, 1010 Vários órgãos gastrointestinais contribuem para a digestão de alimentos, 1010 26.2 CONSIDERAÇÕES GERAIS, 1012 Diferentes locais de digestão intestinal, 1012 Enzimas digestivas são secretadas como pró-enzimas, 1013 Secreção é regulada por muitos secretagogos, 1014 26.3 TRANSPORTE EPITELIAL, 1016 Transporte de solutos pode ser transcelular ou paracelular, 1016 Absorção de NaCl tem componentes ativos e passivos, 1017 Secreção de NaCl depende da ATPase trocadora de Na+/K+ contraluminal, 1019 Gradientes de concentração ou potenciais elétricos dirigem transporte de nutrientes, 1021 Células gástricas parietais secretam HCl, 1023 26.4 DIGESTÃO E ABSORÇÃO DE PROTEÍNAS, 1024 Peptidases garantem digestão eficiente de proteínas, 1024 Pepsinas catalisam digestão gástrica de proteínas, 1024 Zimogênios pancreáticos são ativados no intestino delgado, 1024 Peptidases da borda em escova e citoplasmáticas digerem peptídeos pequenos, 1025 Transportadores de aminoácidos e di e tripeptídeos, 1026 26.5 DIGESTÃO E ABSORÇÃO DE CARBOIDRATOS, 1028

BioQ.26 1009

Dissacarídeos e polissacarídeos requerem hidrólise, 1028 Transportadores de monossacarídeos, 1030 26.6 DIGESTÃO E ABSORÇÃO DE LIPÍDEOS, 1031 Digestão de lipídeos requer vencer sua solubilidade limitada em água, 1031 Lipídeos são digeridos por lipases gástrica e pancreática, 1031 Micelas de ácidos biliares solubilizam lipídeos durante a digestão, 1032 A maior parte dos lipídeos absorvidos é incorporada a quilomícrons, 1037 26.7 METABOLISMO DE ÁCIDOS BILIARES, 1037 Química e síntese de ácidos biliares, 1037 Transporte de ácidos biliares, 1038 BIBLIOGRAFIA, 1040 QUESTÕES E RESPOSTAS, 1040 CORRELAÇÕES CLÍNICAS 26.1 Cloridorréia Familiar Causa Alcalose Metabólica, 1017 26.2 Fibrose Cística, 1020 26.3 Diarréias Toxigênicas Bacterianas e Terapia de Reposição de Eletrólitos, 1021 26.4 Aminoacidúria Neutra: Doença de Hartnup, 1026 26.5 Deficiência de Dissacaridases, 1030 26.6 Intervenções Farmacológicas para Evitar Absorção de Gordura e Obesidade, 1033 26.7 Cálculos de Colesterol, 1036 26.8 A-β-Lipoproteinemia, 1038

22.01.07 18:43:16

1012

|

PARTE 5 PROCESSOS FISIOLÓGICOS

funções, o trato gastrointestinal contém glândulas especializadas e superfícies epiteliais: Órgão

Função Principal em Digestão e Absorção

Glândulas salivares

Elaboração de fluido e enzimas digestivas

Estômago

Elaboração de HCl e enzimas digestivas

Pâncreas

Elaboração de NaHCO3 e enzimas para a digestão intraluminal

Fígado

Elaboração dos ácidos biliares

Vesícula biliar

Armazenamento e concentração da bile

Intestino delgado

Digestão terminal dos alimentos, absorção de nutrientes e eletrólitos

Intestino grosso

Absorção de eletrólitos

O pâncreas e o intestino delgado são essenciais para digestão e absorção de todos os nutrientes básicos. Felizmente, ambos os órgãos têm grandes capacidades de reserva. Assim, má digestão devido a insuficiência pancreática torna-se um problema clínico só quando a taxa de secreção pancreática de enzimas digestivas cai abaixo de um décimo da taxa normal. Secreção de bile pelo fígado é importante para digestão e absorção eficientes de lipídeos, que dependem de ácidos biliares. Em contraste, a digestão gástrica de alimentos é nãoessencial para nutrição adequada, e perda desta função pode ser compensada pelo pâncreas e pelo intestino delgado. No entanto, digestão gástrica normal aumenta muito a facilidade e a eficiência do processo digestivo total. O estômago ajuda a digestão por sua função de reservatório, sua capacidade de misturar, e pelo início da hidrólise de proteínas e lipídeos que, embora pequena, é importante para estimular a secreção pancreática e biliar. Peptídeos, aminoácidos e ácidos graxos liberados no estômago estimulam a liberação coordenada do suco pancreático e da bile no lúmen do intestino delgado, assegurando assim digestão eficiente dos alimentos.

|

26.2 CONSIDERAÇÕES GERAIS Diferentes Locais de Digestão Intestinal As primeiras etapas da quebra dos alimentos são catalisadas por enzimas solúveis e ocorrem dentro do lúmen do estômago e do intestino delgado. Enzimas digestivas são secretadas pelas glândulas salivares, estômago e pâncreas, sendo que o pâncreas faz as contribuições maiores e mais importantes. Enzimas secretadas che-

BioQ.26 1012

gam a 30 g de proteínas por dia, pelo menos, em um adulto saudável. Enzimas pancreáticas, juntamente com a bile, são derramadas no lúmen da segunda parte (descendente) do duodeno, de modo que a maior parte da digestão intraluminal ocorre na porção distal, em relação a este ponto. Entretanto, mesmo após exaustivo contato com enzimas gástricas e pancreáticas, uma parte substancial dos carboidratos e aminoácidos permanece como dímeros e oligômeros, e depende, para continuar a quebra, de enzimas digestivas das células epiteliais intestinais (enterócitos). A membrana plasmática luminal dos enterócitos é aumentada por uma matriz organizada de projeções, chamadas microvilosidades, o que lhe confere a aparência de uma escova e que levou ao nome borda em escova. Esta borda em escova fornece uma grande área, que é coberta em sua superfície mais externa por muitas di- e oligossacaridases, amino- e dipeptidases, e esterases (Tabela 26.2). Muitas destas enzimas projetam-se a até 100 Å em direção ao lúmen, ligadas à membrana plasmática por um polipeptídeo de ancoragem. Este arranjo permite eficiente digestão na superfície, gerando moléculas nutrientes que podem ser absorvidas pelos enterócitos. Uma questão interessante é como as enzimas de superfície, que são elas próprias proteínas, escapam da digestão por proteases solúveis. Parece que sua grande glicosilação confere alguma proteção, impedindo o acesso de proteases a ligações peptídicas relevantes. TABELA 26.2 Enzimas Digestivas da Superfície do Intestino Delgado Enzima (Nome Comum)

Substrato

Maltase

Maltose

Sacarase/isomaltase

Sacarose/dextrina α-limite

Glucoamilase

Amilose

Trealase

Trealose

β-Glucosidase

Glucosilceramida

Lactase

Lactose

Endopeptidase

Proteína (clivagem de aminoácidos hidrofóbicos internos)

Aminopeptidase A

Oligopeptídeo com NH2 terminal acídico

Aminopeptidase N

Oligopeptídeo com NH2 terminal neutro

Dipeptidil aminopeptidase IV

Oligopeptídeo com X-Pro ou X-Ala na extremidade NH2 terminal

Leucina aminopeptidase

Peptídeos com aminoácido neutro na extremidade NH2 terminal

γ-Glutamiltransferase

Glutationa + aminoácido

Enteropeptidase (enteroquinase)

Tripsinogênio

Fosfatase alcalina

Fosfatos orgânicos

22.01.07 18:43:19

1026

|

PARTE 5 PROCESSOS FISIOLÓGICOS

duz aminoácidos livres e di e tripeptídeos, que são absorvidos por sistemas transportadores específicos de aminoácidos e peptídeos, respectivamente. Di e tripeptídeos transportados são geralmente hidrolisados dentro da célula epitelial intestinal, antes de saírem da célula. Isto explica por que praticamente só aminoácidos livres são encontrados no sangue portal após uma refeição. A ausência virtual de peptídeos era tida como evidência de que a digestão luminal de proteínas prosseguia até aminoácidos livres antes de ocorrer absorção. Entretanto, agora está estabelecido que uma grande parte do nitrogênio amino da dieta é absorvida na forma de pequenos peptídeos, com subseqüente hidrólise intracelular. Exceções são di e tripeptídeos contendo prolina, hidroxiprolina ou aminoácidos incomuns, como β-alanina na carnosina (β-alanil-histidina) ou anserina (β-alanil-1-metil-histidina). Estes peptídeos são absorvidos e liberados intactos no sangue portal, Embora incomum, β-alanina é parte da dieta, porque está presente, por exemplo, em carne de frango.

Transportadores de Aminoácidos e Di e Tripeptídeos O intestino delgado tem uma alta capacidade de absorver aminoácidos livres e di e tripeptídeos. A maior parte dos L-aminoácidos pode ser transportada através do epitélio contra um gradiente de concentração, embora a necessidade de transporte concentrador in vivo não seja óbvia, uma vez que as concentrações luminais são geralmente mais altas do que os níveis plasmáticos de 0,1-0,2 mM. A captação para dentro das células é mediada por vários transportadores diferentes na membrana luminal, enquanto a liberação no sangue é mediada por vários transportadores adicionais, diferentes, na membrana contraluminal (Tabela 26.7). É notável que várias mutações com perda de função em transportadores de aminoácidos foram descobertas, porque o intestino delgado e os túbulos proximais renais compartilham tipos de transportadores, e perda renal de qualquer transportador de aminoácidos em particular produz um resultado facilmente detectável, a saber, a excreção do aminoácido na urina (aminoacidúria). De mesma forma, a importância da absorção de di e tripeptídeos para a nutrição foi descoberta quando uma mutação com perda de função no principal transportador de aminoácidos neutros (aminoacidúria neutra) não foi acompanhada por uma deficiência esperada nos aminoácidos correspondentes, sugerindo pelo menos um transportador adicional mediando captação (ver Corr. Clín. 26.4). O mecanismo de absorção ativa de aminoácidos neutros parece ser semelhante à discutida para a D-glicose (ver Figura 26.18). Um co-transportador Na+ -dependente da família SLC6 (também chamado NBB para aminoácido neutro da borda em escova ou B0AT), e transportador facilitador, Na+ -independente (SLC3A2/ SLC7A8 ou sistema L para preferência a leucina) foram

BioQ.26 1026

CORRELAÇÃO CLÍNICA 26.4

Aminoacidúria Neutra: Doença de Hartnup Doença de Hartnup é um defeito genético no transportador Na+ -acoplado que normalmente medeia absorção de aminoácidos neutros do lúmen do intestino delgado e dos túbulos proximais. Foi assim denominada pela família na qual a anomalia foi identificada pela primeira vez, e o homólogo em camundongo foi recentemente clonado (família gênica SLC6). No rim, a incapacidade de reabsorver aminoácidos neutros do ultrafiltrado leva à sua excreção na urina (aminoacidúria neutra). No intestinal, o defeito resulta em má absorção de aminoácidos neutros da dieta. Os sintomas clínicos são os que se esperariam para uma deficiência de triptofano, com características semelhantes às da pelagra (ver p. 1074), que é uma expressão da disponibilidade diminuída de triptofano para conversão em nicotinamida. Entretanto, os sintomas são variáveis e mais brandos do que os esperados no bloqueio total de reabsorção de aminoácidos neutros. Investigações de pacientes com doença de Hartnup revelaram a existência de transportadores intestinais para di ou tripeptídeos, que são diferentes daqueles para aminoácidos livres. PEPT1 (SLC5A1) é o principal transportador intestinais para absorção de produtos peptídicos pequenos da digestão. Fonte: Broer, A., Klingel, K., Kowalczuk, S., Rasko, J. E., Cavanaugh, J. e Broer, S., Molecular cloning of mouse amino acid transport system B0, a neutral amino acid transporter related to Hartnup disease. J. Biol. Chem. 279:24467, 2004. Daniel, H. Molecular and integrative physiology of intestinal peptide transport. Annu. Rev. Physiol. 66:361, 2004. http://www.emedicine.com/derm/topic713.htm funcionalmente caracterizados nas membranas luminal e contraluminal, respectivamente. O transporte da borda em escova para outros aminoácidos, não os neutros, é energizado de modos mais complicados. Por exemplo, aminoácidos ácidos podem ser concentrados por co-transporte com 2 íons Na+ e contra-transporte com 1 íon K+ (SLC12A1), enquanto aminoácidos básicos dependem do co-transporte de uma carga positiva e do potencial negativo do interior da célula (SLC3A1/SLC7A9). Conclusões sobre transportadores envolvidos em absorção dos aminoácidos alanina, serina e cisteína estão associadas com alguma incerteza porque estes aminoácidos são substratos de vários transportadores, um dos quais parece catalisar uma troca obrigatória aminoácido/aminoácido (SLC1A5).

22.01.07 18:44:07

CAPÍTULO 26 DIGESTÃO E ABSORÇÃO DE CONSTITUINTES NUTRICIONAIS BÁSICOS

Micelas de ácidos biliares contornam este problema para os lipídeos, por aumentarem sua concentração efetiva na camada não-misturada. O aumento na velocidade de transporte é quase proporcional ao aumento na concentração efetiva e pode ser 1000 vezes superior à de ácidos graxos individuais solubilizados, de acordo com as diferentes solubilidades em água dos ácidos graxos como micelas e como moléculas individuais. Esta relação entre fluxo e concentração efetiva permanece, porque a constante de difusão é só um pouco menor para micelas do que para moléculas de lipídeos em solução. Em ausência de ácidos biliares, a absorção de triacilgliceróis não pára completamente, mas a eficiência é drasticamente reduzida. Absorção residual depende da baixa solubilidade em água dos ácidos graxos livres e dos monoacilgliceróis. Lipídeos não-absorvidos chegam ao intestino inferior, onde uma pequena parte pode ser metabolizada por bactérias. A maior parte dos lipídeos não-absorvidos, entretanto, é excretada nas fezes (esteatorréia). Micelas também transportam colesterol e as vitaminas lipossolúveis A, D, E e K através das camadas fluidas não-misturadas. Secreção de ácidos biliares é essencial para sua absorção.

A Maior Parte dos Lipídeos Absorvidos É Incorporada a Quilomícrons Captação de lipídeos por células epiteliais intestinais ocorre por difusão através da membrana plasmática. Além disso, captação de ácidos graxos de cadeia longa é aumentada por um transportador (FATP4 ou SLC27A4) e de colesterol por um canal (proteína tipoC1 de Niemann-Pick ou NPC1L1) na membrana luminal. Esteróis também podem ser bombeados de volta para fora por um transportador ABC (ver p. 479) consistindo de dois meios-transportadores (ABCG5 e ABCG8) e uma parte do colesterol é realmente devolvida ao compartimento luminal. Exportação de esteróis por transportador ABC é particularmente importante para rejeitar esteróis de plantas; normalmente, esteróis de plantas não são encontrados no soro. Mutações com perda de função em qualquer dos meios-transportadores estão associadas com uma elevação no soro do esterol de planta sintosterol (fitosterolemia ou sitosterolemia). Absorção é virtualmente completa para ácidos graxos e monoacilgliceróis, que são ligeiramente solúveis em água. É menos eficiente para lipídeos insolúveis em água. Por exemplo, apenas 30-40% do colesterol da dieta é geralmente absorvido. Dentro das células epiteliais que fazem absorção, o destino dos ácidos graxos absorvidos depende do comprimento da cadeia. Ácidos graxos de cadeias curtas ou médias (≤10 átomos de carbono) ou seus monoacilgliceróis são ligados a uma proteína citosólica que liga ácido graxo (FAB intestinal o I-FABP) e são transporta-

BioQ.26 1037

|

1037

dos para o retículo endoplasmático, onde são convertidos em triacilgliceróis. Glicerol para este processo é derivado dos 2-monoacilgliceróis absorvidos e, em menor grau, da glicose. Colesterol é esterificado pela colesterol aciltransferase. Os triacilgliceróis recém-sintetizados e os colesteril ésteres formam glóbulos lipídicos aos quais fosfolipídeos e apolipoproteínas adsorvem. Os glóbulos são chamados quilomícrons porque podem crescer até vários micrômetros e diâmetro, e deixam o intestino pelos vasos linfáticos (quilo = linfa leitosa derivada do grego chylos, que significa suco). passam através da célula para o sangue portal, sem modificação. Ácidos graxos de cadeia longa (>12 átomos de carbono) são ligados a uma proteína citoplasmática de ligação a ácidos graxos (FABP intestinal ou I-FABP, intestinal fatty-acid binding protein) e são transportados para o retículo endoplasmático, onde são convertidos novamente em triacilgliceróis. Quilomícrons são sintetizados no lúmen do retículo endoplasmático, de onde migram pelo Golgi e depois para vesículas e para a membrana contraluminal. São liberados no espaço intercelular por fusão destas vesículas com a membrana plasmática. É interessante que quilomícrons não entram no espaço capilar e na veia porta, mas sim viajam pelos vasos linfáticos intestinais (ou lacteals) e o ducto torácico para o sistema venoso sistêmico. As apolipoproteínas intestinais são designadas por A-1 e B48 (ver Corr. Clín. 26.8); são diferentes daquelas do fígado, com funções semelhantes (ver p. 698). Enquanto ácidos graxos de cadeia média da dieta chegam ao fígado diretamente com o sangue portal, ácidos graxos de cadeia longa chegam primeiro ao tecido adiposo e ao músculo via circulação sistêmica, antes de entrarem em contato com o fígado. Células adiposas e musculares captam grandes quantidades de lipídeos da dieta para armazenamento ou metabolismo. Um atalho sem passar pelo fígado pode ter evoluído para proteger este órgão da sobrecarga lipídica após uma refeição. O manuseio diferencial de ácidos graxos de cadeia média e longa por células intestinais pode ser explorado para fornecer ao fígado nutrientes altamente calóricos, na forma de ácidos graxos. Ácidos graxos de cadeia curta e média têm cheiro e gosto rançoso, e não são muito palatáveis; entretanto, triacilgliceróis que contêm estes ácidos graxos são bastante palatáveis e podem ser usados como parte da dieta. Ácidos graxos de cadeia curta são produzidos fisiologicamente, particularmente no cólon, por bactérias, a partir de carboidratos residuais. Estes ácidos graxos são absorvidos no sangue portal.

|

26.7 METABOLISMO DE ÁCIDOS BILIARES Química e Síntese de Ácidos Biliares Ácidos biliares são sintetizados em células do fígado (hepatócitos) a partir de colesterol, secretados na bile juntamente com fosfolipídeos, e modificados por enzimas bacterianas no lúmen intestinal.

22.01.07 18:44:59

CAPÍTULO 27 PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES

|

1043

PARTE 5 PROCESSOS FISIOLÓGICOS

27

PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES Stephen G. Chaney 27.1 VISÃO GERAL, 1044 27.2 METABOLISMO ENERGÉTICO, 1044 Conteúdo energético dos alimentos é medido em quilocalorias, 1044 Gasto energético é influenciado por quatro fatores, 1044 27.3 METABOLISMO DE PROTEÍNAS, 1045 Proteínas da dieta cumprem muitas funções incluindo produção de energia, 1045 Balanço de nitrogênio relaciona ingestão com excreção de nitrogênio, 1045 Aminoácidos essenciais devem estar presentes na dieta, 1045 Economia de proteínas está relacionada com o conteúdo de carboidratos e gorduras, 1046 Necessidades de proteína para adulto normal, 1046 Necessidades de proteína aumentam durante crescimento e doenças, 1047 27.4 DESNUTRIÇÃO PROTÉICO-ENERGÉTICA, 1048 27.5 EXCESSIVA INGESTÃO PROTÉICOENERGÉTICA, 1050 Obesidade tem componentes dietéticos e genéticos, 1050 Obesidade tem implicações significativas para a saúde, 1050 27.6 CARBOIDRATOS, 1051 27.7 GORDURAS, 1051

BioQ.27 1043

27.8 FIBRAS, 1052 27.9 COMPOSIÇÃO DOS MACRONUTRIENTES DA DIETA, 1054 Composição da dieta afeta colesterol do soro, 1054 Carboidratos, índice glicêmico e carga glicêmica, 1056 Mistura de proteínas vegetais e animais satisfaz as necessidades nutricionais de proteína, 1056 Fibra de fontes variadas é desejável, 1057 Recomendações dietéticas, 1057 BIBLIOGRAFIA, 1059 QUESTÕES E RESPOSTAS, 1060 CORRELAÇÕES CLÍNICAS 27.1 Dietas Vegetarianas e Necessidades Protéico-Energéticas para Crianças, 1047 27.2 Ingestão de Proteínas na Dieta e Doença Renal, 1048 27.3 Oferecendo Proteínas e Calorias Adequadas a Pacientes Hospitalizados, 1049 27.4 Carga de Carboidratos e Resistência Atlética, 1052 27.5 Dietas Ricas em Carboidratos Versus Dietas Ricas em Gorduras para Diabéticos, 1053 27.6 Ácidos Graxos Poliinsaturados e Fatores de Risco para Doença Cardíaca, 1055 27.7 Adaptação Metabólica: Relação entre Ingestão de Carboidratos e Triacilgliceróis no Soro, 1059

22.01.07 18:46:45

CAPÍTULO 27 PRINCÍPIOS DE NUTRIÇÃO I: MACRONUTRIENTES

correr mais de uma hora para queimar as calorias presentes em um pedaço de torta de maçã. Exercício regular aumenta a taxa de metabolismo basal, permitindo que calorias sejam queimadas mais rapidamente, 24 horas por dia. Um programa de exercícios regulares deve ser planejado para aumentar a massa muscular magra e deve ser repetido 3-5 dias por semana, mas não precisa ser exercício aeróbico para ter efeito sobre a taxa de metabolismo basal. Para um indivíduo idoso ou enfermo, mesmo caminhada diária pode ajudar a aumentar a um pouco a taxa de metabolismo basal. Níveis hormonais também são importantes, uma vez que tiroxina, hormônios sexuais, hormônio de crescimento e, em menor grau, epinefrina e cortisol aumentam BMR. Os efeitos da epinefrina e do cortisol provavelmente explicam, em parte, porque estresse severo e trauma importante aumentam significativamente as necessidades energéticas. Finalmente, a própria ingestão energética tem uma relação inversa com o gasto, porque durante períodos de jejum ou semijejum, BMR pode cair a até 50%. Isto é de grande valor para sobrevivência em casos de genuína falta de alimento, mas não ajuda muito a pessoa que quer perder peso com uma dieta de restrição calórica.

|

27.3 METABOLISMO DE PROTEÍNAS Proteínas da Dieta Cumprem Muitas Funções Incluindo Produção de Energia Proteína carrega certa mística como alimento de “construção do corpo”. Embora seja componente estrutural essencial de todas as células, é também importante para manutenção de secreções essenciais, como enzimas digestivas e hormônios peptídicos e protéicos. Proteína também é necessária para síntese de proteínas plasmáticas, que são essenciais para manter equilíbrio osmótico, transporte de substâncias no sangue e manutenção da imunidade. Entretanto, o adulto norte-americano médio consome muito mais proteína do que o necessário para desempenhar estas funções essenciais. O excesso de proteína é tratado como uma fonte de energia, com aminoácidos glucogênicos sendo convertidos em glicose e aminoácidos cetogênicos, em ácidos graxos e cetoácidos. Ambos os tipos de aminoácidos são eventualmente convertidos em triacilglicerol no tecido adiposo, se os suprimentos de gordura e carboidratos já forem adequados para suprir as necessidades energéticas. Assim, para a maioria de nós, a única construção corporal obtida com dietas ricas em proteínas é no tecido adiposo. Tem sido comum dizer que o corpo não tem depósitos para armazenamento de proteína e, portanto, proteína

BioQ.27 1045

|

1045

adequada na dieta deve ser fornecida em todas as refeições. Entretanto, na realidade, isto não é muito correto. Embora não exista uma classe separada de proteínas de “armazenamento”, existe certa percentagem da proteína do corpo que sofre um processo constante de quebra e síntese. No estado de jejum, a quebra desta proteína aumenta, e os aminoácidos resultantes são utilizados para produção de glicose, síntese de outros compostos nitrogenados não-proteínas, e das proteínas plasmáticas e secretórias essenciais mencionadas acima. Mesmo no estado alimentado, parte destes aminoácidos é utilizada para produção de energia e como precursores biossintéticos. Assim, o turnover de proteínas do corpo é um processo normal – e uma característica essencial do assim chamado balanço de nitrogênio.

Balanço de Nitrogênio Relaciona Ingestão com Excreção de Nitrogênio Balanço de nitrogênio (Figura 27.2) é uma relação entre ingestão de nitrogênio (principalmente na forma de proteínas) e excreção de nitrogênio (principalmente na forma de proteína não-digerida nas fezes e uréia e amônia na urina). Um adulto normal está em equilíbrio de nitrogênio, com perdas exatamente equilibradas por ingestão. Balanço de nitrogênio negativo resulta de ingestão inadequada de proteína, uma vez que os aminoácidos utilizados para energia e reações de biossíntese não são substituídos. Isto também ocorre em lesão quando há destruição dos tecidos, e em traumas graves ou doenças, quando resposta adaptativa do corpo causa catabolismo aumentado de proteína. Balanço de nitrogênio positivo ocorre quando há um aumento final na proteína do corpo, como em crianças em crescimento, mulheres grávidas ou adultos convalescentes.

Aminoácidos Essenciais Devem Estar Presentes na Dieta Vários fatores devem ser considerados, além da quantidade de proteína na dieta. Um é o complemento de aminoácidos essenciais ingeridos. Aminoácidos essenciais são aminoácidos que não podem ser sintetizados pelo corpo (Tabela 27.2). Se apenas um destes aminoácidos essenciais estiver faltando na dieta, o corpo não poderá sintetizar novas proteínas para substituir a perdida no turnover normal, e balanço de nitrogênio negativo resulta (Figura 27.2). Obviamente, o complemento de aminoácidos essenciais na proteína da dieta determina o quanto ela pode ser usada pelo corpo. A maioria das proteínas animais contém todos os aminoácidos essenciais, mais ou menos nas quantidades necessárias ao corpo humano. Proteínas vegetais, por outro lado, freqüentemente não têm um ou mais aminoácidos essenciais e podem, em alguns casos, ser

22.01.07 18:46:50

1052

|

PARTE 5 PROCESSOS FISIOLÓGICOS

CORRELAÇÃO CLÍNICA 27.4

Carga de Carboidratos e Resistência Atlética A prática de dar uma carga de carboidratos vem de observações feitas no início da década de 1960 de que a resistência durante exercício vigoroso era limitada primariamente pelos estoques de glicogênio muscular. Claro, glicogênio não é a única fonte de energia para o músculo. Ácidos graxos livres aumentam no sangue durante exercício vigoroso e são utilizados pelo músculo, juntamente com seus estoques de glicogênio. Uma vez que o glicogênio tenha se esgotado, entretanto, o músculo não pode depender inteiramente de ácidos graxos livres sem se cansar rapidamente, provavelmente porque o músculo fica cada vez mais hipóxico durante exercício vigoroso. Enquanto glicogênio é utilizado aerobicamente e anaerobicamente, ácidos graxos só podem ser utilizados aerobicamente. Em condições anaeróbicas, ácidos graxos não podem fornecer ATP em velocidade suficiente para servir como única fonte de energia. A prática de dar uma carga de carboidratos para aumentar as reservas de glicogênio foi introduzida para atletas de enduro e outras provas de resistência. O regime de carga de carboidratos original consistia de um período de 3 a 4 dias de exercício pesado com uma dieta pobre em carboidratos, seguidos por 1-2 dias de exercício leve com dieta rica em carboidratos. O período inicial de baixo carboidrato e alta demanda energética causava uma depleção das reservas musculares de glicogênio. A mudança subseqüente para uma dieta rica em carboidratos resultava na produção de níveis acima do normal de

insulina e hormônio de crescimento, e as reservas de glicogênio chegavam a quase duas vezes as quantidades normais. Esta prática realmente aumentava significativamente a resistência. Em um estudo, indivíduos em teste com dieta rica em gordura e proteína tinham menos do que 1,6 g de glicogênio por 100 g de músculo e conseguiam realizar uma carga de trabalho padronizado por apenas 60 min. Quando os mesmos indivíduos consumiram uma dieta rica em carboidratos por 3 dias, suas reservas de glicogênio aumentaram para 4 g por 100 g de músculo, e a mesma carga de trabalho pôde ser realizada por até 4 h. Embora a técnica evidentemente funcionasse, os atletas freqüentemente se sentiam letárgicos e irritáveis durante a fase pobre em carboidratos do regime, e a dieta rica em gordura estava em desacordo com as recomendações atuais para saúde. Estudos recentes indicam que o consumo regular de uma dieta rica em carboidratos complexos e pobre em gordura durante o treinamento aumenta as reservas de glicogênio, sem mudanças súbitas de dieta. Recomendações atuais são de que atletas de provas de resistência consumam uma dieta rica em carboidratos (com ênfase em carboidratos complexos) durante o treinamento. Depois, a ingestão de carboidratos é aumentada ainda mais (para 70% das calorias) e o exercício é diminuído durante os 2-3 dias que antecedem um evento atlético. Isto aumenta as reservas de glicogênio muscular até níveis comparáveis aos descritos anteriormente no regime de carga de carboidratos.

Fonte: Lambert, E. V. e Goedecke, J. H. The role of dietary micronutrients in optimizing endurance performance. Curr. Sports Med. Rep. 2:194, 2003. Hargreaves, M., Hawley, J. A. e Jeukendrup, A. Pre-exercise carbohydrate and fat ingestion: Effects on metabolism and performance. J. Sports Sci. 22:31, 2004. Burke, L. M., Kiens, B. e Ivey, J. L. Carbohydrates and fat for training and recovery. J. Sports Sci. 22:15, 2004. de ácidos graxos essenciais é uma dermatite com descamação. Deficiência de EFAs é muito rara nos Estados Unidos, ocorrendo primariamente em bebês prematuros em peso alimentados com fórmulas artificiais desprovidas de EFA e em pacientes hospitalizados mantidos em alimentação totalmente parenteral por longos períodos. Na outra extremidade, há preocupação de que excesso de gordura na dieta cause elevação de lipídeos do soro e, assim, risco aumentado de doença cardíaca. Estudos recentes sugerem que dietas ricas em gordura estejam associadas com risco aumentado de câncer de cólon, mama e próstata, mas não está claro se o risco de câncer está associado com ingestão de gordura per se ou com o excesso de calorias associado a uma dieta rica em gorduras. Estudos em animais sugerem

BioQ.27 1052

que ácidos graxos poliinsaturados da série ω-6 possam ser mais tumorigênicos do que outros ácidos graxos insaturados. A razão para isso é desconhecida, mas sugeriu-se que prostaglandinas derivadas de ácidos graxos ω-6 possam estimular progressão de tumores.

27.8 | FIBRAS Fibras da dieta compreendem os componentes do alimento que não podem ser quebrados por enzimas digestivas humanas. É incorreto, entretanto, assumir que fibras são não-digeridas, uma vez que algumas fibras são, de fato, quebradas, pelo menos parcialmente, por bactérias intestinais. Nosso conhecimento atual das

22.01.07 18:46:56

CAPÍTULO 28 PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES

|

1063

PARTE 5 PROCESSOS FISIOLÓGICOS Necessidades nutricionais aumentadas

Má-absorção

Ingestão inadequada da dieta

28

PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES Stephen G. Chaney 28.1

VISÃO GERAL, 1064

28.8

OUTRAS VITAMINAS HIDROSSOLÚVEIS, 1082 Ácido ascórbico funciona em reações de redução e hidroxilação, 1082 Colina e carnitina desempenham várias funções, 1083

28.9

MACROMINERAIS, 1084 Cálcio tem muitas funções fisiológicas, 1084 Magnésio é requerido por muitas enzimas, 1084

28.2 AVALIAÇÃO DE MÁ NUTRIÇÃO, 1064 28.3 INGESTÃO DIETÉTICAS DE REFERÊNCIAS, 1064 28.4

VITAMINAS LIPOSSOLÚVEIS, 1066 Vitamina A é derivada de carotenóides de plantas, 1066 Síntese de vitamina D requer luz do sol, 1068 Vitamina E é uma mistura de tocoferóis e tocotrienóis, 1071 Vitamina K É um derivado de quinona, 1072

28.5

VITAMINAS HIDROSSOLÚVEIS, 1073

28.6

VITAMINAS HIDROSSOLÚVEIS LIBERADORAS DE ENERGIA, 1074 Tiamina forma a coenzima tiamina pirofosfato, 1074 Riboflavina forma as coenzimas FAD e FMN, 1075 Niacina forma as coenzimas NAD e NADP, 1075 Piridoxina (vitamina B6) forma a coenzima piridoxal fosfato, 1076 Ácido pantotênico e biotina formam coenzimas envolvidas no metabolismo energético, 1079

28.7

BioQ.28 1063

VITAMINAS HIDROSSOLÚVEIS HEMATOPOIÉTICAS 1079 Ácido fólico (folacina) funciona como tetra-hidrofolato no metabolismo de um carbono, 1079 Vitamina B12 (cobalamina) contém cobalto em um anel tetrapirrólico, 1080

28.10 MINERAIS TRAÇOS, 1084 Deficiência de ferro causa anemia e imunocompetência diminuída, 1084 Iodo é incorporado a hormônios da tireóide, 1086 Zinco é requerido por muitas proteínas, 1086 Cobre é um cofator de enzimas importantes, 1086 Cromo é um componente da cromodulina, 1086 Selênio é encontrado em selenoproteínas, 1087 Manganês, molibdênio, fluoreto e boro são elementos traços essenciais, 1087 28.11 DIETA AMERICANA: FATO E FALÁCIA, 1087 28.12 AVALIAÇÃO DO ESTADO NUTRICIONAL NA PRÁTICA CLÍNICA, 1087 BIBLIOGRAFIA, 1089 QUESTÕES E RESPOSTAS, 1091 CORRELAÇÕES CLÍNICAS 28.1 Considerações Nutricionais na Fibrose Cística, 1068

22.01.07 18:48:29

CAPÍTULO 28 PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES

|

1073

CORRELAÇÃO CLÍNICA 28.3

Considerações Nutricionais em Recém-Nascidos Bebês recém-nascidos correm risco nutricional especial devido ao crescimento muito rápido e porque as necessidades de muitos nutrientes são altas. Alguns micronutrientes (tais como vitaminas E e K) não atravessam bem a membrana placentária e as reservas teciduais são baixas no recém-nascido. O trato gastrointestinal (GI) pode não estar completamente desenvolvido, levando a problemas de má absorção (particularmente com respeito às vitaminas lipossolúveis). O trato GI também é estéril ao nascer, e a flora intestinal, que normalmente fornece quantidades significativas de certas vitaminas (especialmente vitamina K), demora vários dias para se estabelecer. Se o bebê for prematuro, o risco nutricional é um pouco maior, uma vez que o trato GI será menos desenvolvido e as reservas teciduais serão ainda menores. A complicação nutricional mais séria parece ser doença hemorrágica. Recém-nascidos, especialmente bebês prematuros, têm baixas reservas teciduais de vitamina K e não têm a flora intestinal necessária para sintetizar a vitamina. Leite materno é uma fonte relativamente pobre de vitamina K. Aproximadamente 1 em cada 400 nascidos vivos apresentam alguns sinais de doença hemorrágica, que pode ser evitada por 0,5 a 1 mg da vitamina, dada ao nascer.

A maioria dos bebês recém-nascidos tem reservas de ferro suficientes para durar 3-4 meses. Como leite de vaca e leite materno contêm pouco ferro, suplementação com ferro geralmente é iniciada em idade relativamente precoce, pela introdução de cereal enriquecido com ferro. Níveis de vitamina D também são baixos no leite materno, e suplementação com 200 UI/dia de vitamina D é geralmente recomendada. Quando bebês precisam ser mantidos em ventilação assistida com altas concentrações de oxigênio, suplementação com vitamina E pode reduzir o risco de displasia broncopulmonar e fibroplasia retrolental, complicações em potencial da terapia por oxigênio. A anemia da prematuridade pode responder a suplementação com folato e vitamina B12. Em resumo, vitamina K suplementar é dada ao nascer para evitar doença hemorrágica. Bebês amamentados pela mãe geralmente recebem um suplemento de vitamina D, com ferro sendo introduzido juntamente com alimentos sólidos. Bebês alimentados com mamadeira recebem uma suplementação de ferro. Se o bebê precisar ser mantido em oxigênio, vitamina E suplementar pode ser benéfica.

Fonte: Mueller, D. P. R. Vitamin E therapy in retinopathy of prematurity. Eye 6: 221, 1992. Morin, K. H. Current thoughts on healthy term infant nutrition, MCN. Am. J. Matern. Child Nurs. 29:312, 2004. Collier, S., Fulhan, J. e Duggan, C. Nutrition for the pediatric office: Update on vitamins, infant feeding and food allergies. Curr. Opin. Pediatr. 16:314, 2004.

|

28.5 VITAMINAS HIDROSSOLÚVEIS Vitaminas solúveis em água diferem das vitaminas lipossolúveis em vários aspectos. A maioria é facilmente excretada, uma vez que sua concentração ultrapasse o limite renal, de modo que toxicidade é rara. Suas reservas metabólicas são lábeis, e depleção pode ocorrer freqüentemente em questão de semanas ou meses, de modo que deficiências ocorrem relativamente rápido, com uma dieta inadequada. Como vitaminas hidrossolúveis são coenzimas para muitas reações bioquímicas comuns, freqüentemente é possível ensaiar o estado vitamínico medindo-se uma ou mais atividades enzimáticas em eritrócitos isolados. Estes ensaios são especialmente úteis se se medir a atividade endógena e o estímulo desta atividade por adição da coenzima ativa derivada da vitamina.

BioQ.28 1073

A maior parte das vitaminas hidrossolúveis é convertida em coenzimas, que são usadas em vias de geração de energia ou hematopoiese. Deficiências das vitaminas que liberam energia produzem vários sintomas sobrepostos e aparecem primeiro em tecidos de crescimento rápido. Sintomas típicos incluem dermatite, glossite (edema e vermelhidão da língua), queilite dos cantos dos lábios e diarréia. Em muitos casos, o tecido nervoso também está envolvido devido à sua alta demanda energética ou efeitos específicos da vitamina. Sintomas neurológicos comuns incluem neuropatia periférica (formigamento dos nervos nas extremidades), depressão, confusão mental, falta de coordenação motora e indisposição. Desmielinização e degeneração do tecido nervoso também podem ocorrer. Estes sintomas de deficiências são tão comuns e sobrepostos que podem ser considerados como propriedades das vitaminas liberadoras de energia como uma classe, e não como sendo específicos para cada uma.

22.01.07 18:48:39

CAPÍTULO 28 PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES

|

1081

CORRELAÇÃO CLÍNICA 28.7

Polimorfismos Genéticos e Necessidades de Ácido Fólico Suplementação com ácido fólico reduz o risco de defeitos no tubo neural e diminui os níveis de homocisteína no soro, o que pode baixar o risco de doença cardíaca. Estes dados levaram a um aumento na RDA para ácido fólico e ao enriquecimento de produtos de grãos com ácido fólico. Entretanto, mesmo com uma dieta marginal, nem todos os adultos têm níveis elevados de homocisteína e nem todas as mães dão à luz bebês com defeitos de tubo neural. O que determina estas respostas individuais à ingestão inadequada de folato? Existe um polimorfismo genético comum no gene da 5,10-metilenotetra-hidrofolato redutase (MTHFR) que produz o 5-metiltetra-hidrofolato necessário à conversão de homocisteína em metionina (ver Figura 28.15). Uma substituição C→T no bp 677 resulta em uma substituição de valina por alanina que baixa a atividade específica e reduz a estabilidade da enzima. Aproximadamente 12% dos caucasianos e asiáticos são homozigotos (T/T) e 50% são heterozigotos

(C/T) para este polimorfismo. As concentrações plasmáticas de folato são significativamente mais baixas e os níveis de homocisteína plasmática são significativamente mais altos em indivíduos T/T consumindo dietas pobres em folato. Quando acoplado com baixa ingestão de folato, o genótipo T/T pode responder por 15% dos defeitos de tubo neural. Além disso, indivíduos mais velhos com o genótipo T/T e baixa ingestão de folato parecem ter risco aumentado de câncer de cólon. Uma investigação ativa de polimorfismos genéticos nos outros genes envolvidos no metabolismo de folato está em andamento. Polimorfismos foram descritos em metionina sintetase e receptor alfa de folato, que é necessário para captação de 5-metiltetra-hidrofolato. Ambos parecem ser benignos. Entretanto, a absorção de folato pelo intestino pode ser mais baixa em mães com uma história de gestações com defeito no tubo neural do que em mães controles. A genética deste defeito ainda não foi determinada.

Fonte: Bailey, L. B. e Gregory, J. F. Polymorphisms and methylenetetrahydrofolate reductase and other enzymes: metabolic significance, risks, and impact on folate requirement. J. Nutr. 129:919, 1999. Barber, R. C., Lammer, E. J., Shaw, G. M., Greer, K. A. e Finnell, R. H. The role of folate transport and metabolism in neural tube defect risk. Mol. Genet. Metab. 66:1, 1999. Fang, J. Y. e Xiao, S. D. Folic acid, polymorphism of methyl-group metabolism genes, and DNA methylation in relation to GI carcinogenesis. J. Gastroenterol. 38:821, 2003. um dentre vários ligantes diferentes (Figura 28.15). As formas cristalinas de B12 usadas em suplementação são geralmente hidroxicobalamina ou cianocobalamina. B12 em alimentos geralmente ocorre ligada a proteína, em forma metil ou 5’-desoxiadenosil. Para ser utilizada, B12 deve ser liberada da proteína por hidrólise ácida no estômago, ou por digestão por tripsina no intestino. Em seguida, combina com fator intrínseco, uma proteína secretada pelo estômago, que a transporta até o íleo para absorção. Vitamina B12 só participa de duas reações no homem (Figura 28.16). O metil derivado de B12 é requerido pela metionina sintase, na qual homocisteína é metilada a metionina. O 5-desoxiadenosil derivado é requerido pela metilmalonil-CoA mutase, que converte metilmalonil-CoA em succinil-CoA, uma reação-chave no catabolismo de valina, isoleucina, metionina, treonina, ácidos graxos de cadeia ímpar, timina e a cadeia lateral do colesterol. Como poderia ser esperado, deficiência de B12 causa acúmulo de homocisteína e ácido metilmalônico.

R2

R1 CH3

CH3

CH3 R1

R2

X

CH3

N

N Co

N

N R1 HNOCCH2CH2 CH3 CH3

CH3 R2

CH3

CH2

O O

N

CH3

CH P

O– O

OH N

CH3 CH3

H

HOCH2 N

H

FIGURA 28.15 Estrutura da vitamina B12 (cobalamina).

BioQ.28 1081

22.01.07 18:48:47

CAPÍTULO 28 PRINCÍPIOS DE NUTRIÇÃO II: MICRONUTRIENTES

|

1089

CORRELAÇÃO CLÍNICA 28.9

Necessidades Nutricionais de Idosos Se as tendências atuais continuarem, um a cada cinco americanos terá mais de 65 anos no ano 2030. Com este envelhecimento projetado da população americana, tem havido interesse crescente na definição das necessidades nutricionais dos idosos. Pesquisa recente demonstra necessidades alteradas de pessoas idosas para vários nutrientes essenciais. Por exemplo, absorção e utilização de vitamina B6 diminuem com a idade. Levantamentos dietéticos mostraram consistentemente que B6 é um problema nutricional para muitos americanos, e os idosos não são exceções. Muitos americanos mais velhos obtêm menos de 50% da RDA para B6 em sua dieta. Deficiência de vitamina B12 também é mais prevalente entre os idosos. Muitos adultos mais velhos desenvolvem gastrite atrófica (produção diminuída de ácido no estômago) e produção diminuída de fator intrínseco, o que leva a pouca absorção de B12. O nível sangüíneo de homocisteína, um possível fator de risco de aterosclerose, demência e doença de Alzheimer, está freqüentemente elevado no idoso. Homocisteína é um produto colateral da metilação do DNA e é normalmente metabolizada a metionina ou cisteína em reações que requerem ácido fólico, B12 e B6 (ver Figura 28.14). Suplementação simples com estas vitaminas B é geralmente suficiente para normalizar os níveis de homocisteína. Vitamina D pode ser um problema também. Muitos idosos não passam muito tempo expostos ao sol, e a conversão

de 7-desidrocolesterol em vitamina D na pele e de 1,25-(OH)D em 1,25-(OH)2D no rim diminui com a idade. Estes fatores levam a deficiências significativas de 1,25-(OH)2D no idoso, o que pode causar um balanço negativo de cálcio. Estas alterações podem contribuir para osteoporose. Existe alguma evidência de necessidade aumentada de cromo e zinco também. Muitos idosos parecem ter dificuldade em converter o cromo da dieta em cromodulina biologicamente ativa. Deficiência de cromo pode contribuir para diabetes tipo 2. De modo semelhante, a maioria dos idosos consome entre metade e dois terços da RDA para zinco, e condições como gastrite atrófica podem interferir com absorção de zinco. Sintomas de deficiência de zinco incluem perda de acuidade do paladar, dermatite e sistema imune enfraquecido. Todos estes sintomas são comuns na população idosa, e deficiência de zinco pode contribuir. Nem todas as notícias são más, entretanto. Absorção de vitamina A aumenta com a idade e sua remoção pelo fígado diminui, de modo que vitamina A permanece em circulação por um tempo maior. Não apenas a necessidade de vitamina A diminui com a idade, mas o idoso também precisa ser particularmente cuidadoso para evitar toxicidade de vitamina A. Embora isto não restrinja sua escolha de alimentos ou de suplementos multivitamínicos, geralmente devem evitar suplementos de vitamina A isolada.

Fonte: Russell, R. M. e Suter, P. M. Vitamin requirements of elderly people: An update. Am. J. Clin. Nutr. 58:4, 1993. Ubbink, J. B., Vermoak, W. J., van der Merne, A. e Becker, P. J. Vitamin B12, vitamin B6 and folate nutritional status in men with hyperhomocysteinemia. Am. J. Clin. Nutr. 57:47, 1993. Joosten, E., van der Berg. A., Riezler, R. Neurath, H. J., Linderbaum, J., Stabler, S. P. e Allen, R. H. Metabolic evidence that deficiencies of vitamin B12, folate and vitamin B6 occur commonly in elderly people. Am. J. Clin. Nutr. 58:468,1993. Wood, R. J., Suter, P. M. e Russell, R. M. Mineral requirements of elderly people. Am. J. Clin. Nutr. 62:493, 1995. Johnson, K. A., Bernard, M. A. e Funderburg, K. Vitamin nutrition in older adults. Clin. Geriatr. Med. 18:773, 2002.

| BIBLIOGRAFIA | Referências de Ingestão na Dieta Food and Nutrition Board, Institute of Medicine of the National Academy of Sciences: www.iom.edu/board.asp?id=3788 Vitamina A Goodman, D. S. Vitamin A and retinoids in health and disease. N. Engl. J. Med. 310:1023 - 1031, 1984. Soprano, D. R., Qin, P. e Soprano, K. J. Retinoic acid receptors and cancers. Annu. Rev. Nutr. 24:201, 2004. Thurnham, D. I. E Northrop-Clew, C. A. Optimal nutrition: vita-

BioQ.28 1089

min A and the carotenoids. Proc. Nutr. Soc. 58:449, 1999. Vitamina D Darwish, H. e DeLuca, H. F. Vitamin D-regulated gene expression. Crit. Rev. Eukaryot. Gene Expr. 3:89, 1993. DeLuca, H. F. Overview of general physiologic features and functions of vitamin D. Am. J. Clin. Nutr. 80:1689S, 2004. Langman, C. B. New developments in calcium and vitamin D metabolism. Curr. Opin. Pediatr. 12:135, 2000.

22.01.07 18:48:54

EXCELÊNCIA E INOVAÇÃO EM

BIOQUÍMICA


Manual de Bioquímica com Correlações Clínicas